2XJVA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae with mutation d201t in complex with calcium and glucose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPTNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 60
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjvA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjvA01
4COZA 4AHXA 4COVA 4D3WA 4COUA 4GQ7A 4AHWA 4CP1A 4COWA 4LHNA 4AI3A 4AI2A 4ASLA 5A3MA 4CP0A 4LHKA 4AI0A 4A3XA 4AI1A 2XJVA 2XJUA 4AHYA 4AFBA 2XJSA 4AHZA 2XJRA 4CP2A 4COYA 4AF9A 2XJQA 4AFCA 4AFAA 2XJPA 2XJTA 5A3LA 4LHLA
chains in the Genus database with same CATH superfamily
2B9VA 4POFA 2EVXA 4LOTA 2WINB 3NL1A 3V0AA 4NAMA 1ULDA 5EP9A 3V56A 5B2GB 1LKMA 4Q29A 5D2AA 2VGDA 3DXUA 4G9SB 3VBOB 2ZKNA 1BQ8A 2P3JA 3VBFB 1Q8VA 1HKDA 2DV9A 4QU2A 4Y5SA 1A3KA 4LHKA 5KWRA 1XNKA 1PIV3 2O5JD 3ELNA 1NUKA 2WNVC 5FYTA 2OYZA 4BQ4A 2PSMC 5M5XL 2AGSA 3P3PA 1GSLA 4GA9A 5FQ0A 2W3JA 1MS0A 4OHZA 1FV3A 5FKCA 1YWKA 4BMBA 4DNYA 4MG2A 3Q8FA 2P4EA 1DHKB 5K7PA 2VTFA 3KT4A 3J9SA 3MI8A 1HRI3 4WVMB 4A2UA 1AR72 1KD7A 1GV9A 3TN93 4QQ2A 2NVXL 1R0JA 3LQCA 5IVCA 1UMIA 1C57A 1XC6A 1OVSA 3I2FA 3MIDA 1JYIA 2CY6A 2WR9A 1R082 1X9TA 4GMP3 4D6RA 1HQNA 4G6BA 3IKWA 2D93A 2PVXA 1UYXA 4CDUA 1JZ8A 3LZZA 1RUD1 1O4YA 4I09A 3N7JA 2VOTA 3WXPA 2XKOA 5D8AC 2GMGA 1G6NA 1WCKA 3FUOA 4Q1RA 1PFWA 3PJYA 4CUBA 5ACA1 4X6QB 4Y20A 5FYIA 4JTOA 3VD9A 1VBE3 1UY2A 1W6MA 4ONUA 2AH2A 1ZRPA 2XJRA 4B3NA 1S55A 1UY4A 4CEYB 4BQ5A 1IQAA 1EYBA 2DTYA 4OUMA 1SCSA 1NA1B 2NVYL 2X10A 4BQ3A 4IESA 2RS32 1JN2P 3ZN4A 4BA6A 4Q8KA 5FZ0A 1K42A 1MACA 1AX2A 1I5PA 3HOVL 5CFDC 1BVP1 4OHVA 1BXHA 1XJAA 4XFGA 4XJWA 1PX4A 5F8PA 1BHGA 2PHLA 1G86A 2Y6HA 5FPLA 5T5PA 4AEJA 1JYWA 3AYAA 4AI8A 1UIKA 5FIXA 2BTVC 2DTWA 1CESA 1YI7A 3POEA 4A41A 3TYJA 1SFNA 3BTXA 3AP6A 4FOQA 3M2MA 2Q8CA 4CDWB 1ND2C 1QF3A 1U5ZA 2FHRA 2J22A 3DUIA 3VN4A 1Y43B 4R4ZA 5E8AA 1W9FA 1LAJA 4K9FA 3H1WA 1REDA 3MPPG 5C9AB 4FTBA 1W8UA 3H3VM 4I2OA 4NHYA 4O9GA 1CAVA 5GADc 3M4OL 1V9U2 2OPKA 2ZHMA 5M0TA 3J8F1 2ARXA 5DAWA 2JDMA 1QNYA 2YDEA 2XBO2 4LXLA 4Y5TA 4P02B 3RDIA 3WD5A 2XUEA 4CCMA 2WZR1 4LUKA 4ZS2A 1VLNA 1MS5A 1XSQA 3PKJA 2CAVA 3BTAA 4META 2WNUC 4WM7A 4NHXA 3SITA 2WWSA 4YWLA 2VXJA 3SMHA 4B7EA 4V2VA 3GZUC 1FMD2 3D0SA 1UPSA 3ZX7A 1WUVA 1ZBA3 3SCGA 5FZIA 3KGZA 3H1YA 3RZZA 2VNRA 2VQAA 4MGTA 3ABZA 2D5FA 2XWJB 4IE4A 3S1ML 4PI0A 5EQUA 5FZ9A 5T52A 2ES3A 1UOBA 2ZHNA 1N1YA 1Z7S3 2VPVA 4Q4W3 3SXWA 1MEC2 2QCSB 1ONAA 4C3JL 5T50A 1OWCA 5A6ZA 2W1SA 3E5XA 1R091 1YQ6A 1HB1A 5F39A 5FFOC 4K21A 4D69A 1JZ3A 3GJAA 5GLWA 2YUEA 2ZGKA 4AVVA 4DRVA 5L36A 2WFF2 1GZTA 3PMSA 2VCBA 2MS3A 1OC1A 1UZ0A 1CVNA 1NCQB 1CONA 3DPRA 4YW2A 5LA1A 1Y9MA 5CYYA 3ZFFA 4Z2WA 2WT1A 1G9DA 3W9AA 4BY1L 4K6BA 4CDQB 4QX1A 1JZ7A 4MH0E 2D5HA 3H9CA 2JDPA 4EWDA 3WP4A 4IW3A 2WC2A 3R0RA 3N9MA 3PL0A 1GOGA 3C7FA 4NIAA 1SMVA 3ILFA 1UYPA 3RRDA 4DXZA 5JZGC 3VD5A 3B94A 4BQXA 3MV01 5L19A 3O0WA 5I8YA 4QXCA 1SBDA 1AYN2 2GC1A 5HCAA 4YG6A 1IZ3A 4Q0QA 4IETA 2IXCA 2P3IA 2K2SA 3ZG6A 1OD5A 5FBJA 4BYYA 5F3CA 1Q8QA 4CP9B 2J1SA 3MF6A 2GC2A 4PBPA 2P3KA 5MFPA 1E5SA 2VUDA 3ACHA 3HT2A 4CCDA 2JB8A 3TNPB 3PIGA 3RNSA 1YI9A 2R7EB 2RDQA 4XURA 2PMWB 1QJEA 3JCIA 5HXVA 3ZYIB 1NLQA 4MGQA 2HWF1 2W47A 1OKOA 4XQWA 3T2QA 4FAHA 4JKKA 4FPCA 4LLOA 4XDOA 4JAFA 1H2LA 4OQ8A 1AL21 3H99A 3WQ0A 4NUBA 4LMFA 1Q8OA 2H0BA 1J3RA 3ZXAC 1Q5OA 3HOYL 1KDMA 3THPA 5JXJA 2K2DA 5FCCA 2Z79A 1O5UA 4XJ9A 4AFMA 1GZ9A 3M3CA 1ZNPA 1W0NA 3WW4A 3BU0A 2IWGB 3DV8A 1BVVA 2EAKA 1FT9A 2GZWA 2J9UB 3GBWA 1HRV3 2JXAA 4NWWA 4PIYA 4QGMA 5APAA 1POV0 5A7QA 2D6NA 1WW7A 2XLFA 4C90A 2Y6GA 1VZGA 1TMF3 5T3NA 3W58A 1OA4A 1LULA 3HIFA 3ST7A 4NIGA 2QQJA 4AYBP 3VBOA 3WNKA 1GFF2 1RMU1 3PMEA 1XPWA 5FLJA 4JDMA 1XE0A 4K9SA 4XQ4A 5M5YL 1F9KA 3VBFA 2YU9L 3G6JB 1QJU2 4GKYA 4QM8A 2X53S 3VD3A 5J96B 1C5HA 1SFOL 1FOD2 4JTNA 4HETA 4QDSA 5JLVA 2QQWA 5H9QA 3RJRA 3ZXKA 4UOJA 3K77A 3P3NA 2XQXA 1JHNA 1ZYBA 3TEYA 3UNPA 1AUYA 3OEAA 3TEXA 2NYDA 4GALA 2NPIA 4KBBA 1O91A 3HT1A 2PELA 4CE8A 4Z92B 1VBC3 3S1RL 2OW4A 4WVMA 4AQ6A 1IOAA 3WP3A 2W91A 2KM2A 2JI1A 3K35A 3JZVA 3N9PA 1QJX1 3NNJA 4HL0A 3ZYBA 3NRUA 4GULA 4UBGA 4UW3A 1US3A 3B9CA 3RVHA 1PMIA 2CU5A 3P1IA 3TEWA 4JCKA 2WDBA 1RUI2 2ZKLA 1EV12 3AXEA 1OA3A 3H0OA 2FCTA 5LY2A 1ZZ7A 2CHHA 1ND3C 4PIZA 2HR5A 3P5BA 3T4HB 2QQIA 3SH3A 1AL0G 2R041 2HEVF 3AZZA 4JKMA 4CDUC 2FDHA 1C8M2 3DYOA 2XL9A 4GB32 4Q4V3 2OZJA 4XDPA 2GNTA 2RE9A 2RR11 1RUJ2 1IS6A 1RXGA 4JHZA 1BMV1 1R64A 3E97A 4A3KL 4HK9A 4CEYA 5I0SA 2LUWA 3VUOA 5EJ3A 4OI0A 3I59B 1AYM2 1NA1A 1UO9A 2PA7A 2XBO3 2VNOA 4NMIA 5FDBA 5CKMA 3R4SA 1U5YA 2H6BA 2PYTA 5T55A 1RUE2 1SEFA 4XF1A 1PGL1 2RFKB 3VBHB 3MIBA 4YFWA 2ZACA 2WB1P 1UOJA 3H1MA 3L2YA 1SHWB 1TWFL 2ZPXA 3I97A 4MZUA 1NY71 3E6BA 4JGYC 4KWJA 3WDWA 3LSEA 3BIWE 4XCBA 3URFA 1QY4A 3KQ4B 3SKJE 2G4IA 4XFBA 1DVBA 1C1FA 2RDVA 1EY2A 5BNPB 1MEC3 3LPFA 3N9QA 5B4NA 4AFCA 5C9AA 3POJA 3K3NA 1VPHA 1AX1A 1OXCA 2WAAA 1G8WA 4AOCA 3I3QA 3WDXA 1AX0A 4A3FL 1QQP3 1NQDA 4IEZA 2PAMA 2IVJA 3T2TA 5BNQA 1LESA 5LK5A 3E5QA 4XDQA 2B5HA 3N7KA 3JBG3 3S5QA 2OA2A 4IDZA 3AYCA 5JOXA 2JDKA 1RYQA 2NN8A 3P8BA 3AL5A 3KYUA 2GMEA 3HNBM 3J4UH 3B00A 1W04A 2RMU1 4IEUA 5EIYB 3EXUA 4GAZA 5IK5A 2P1BA 5LK7B 4BK4A 1UOFA 4M3CF 2F6BA 3WP5A 4IGOA 2MEV3 1MVEA 4Y1VA 1Q8SA 3RI9A 4CPBA 1PO11 2OT7A 1XNTA 4L0PA 3AYDA 2UWAA 5GM0A 1WA4A 2WS92 5JSRA 4AF9A 1LHNA 3FBMA 1DGLA 4M01A 1PO22 1AYN3 3KF3A 4YWAA 1GQHA 1VIWB 3QOPA 5LBBA 5K9YA 3PVNA 4ZU5A 3GALA 3NJYA 1R0HA 3ZDSA 4X8NA 4YZ3A 1C3HA 2QQKA 2CYFA 1CN1A 3AKRA 2E2IL 1WMDA 1E8JA 2DVDA 3BGAA 2D7FA 5JPNB 3C7HA 4QXHA 5D8AB 3FUQA 4Z2AA 1NCQA 2VOVA 2GMPA 1T9PA 4IXLA 3MW3A 4QDRA 5AVPA 3VHPA 2R062 2Z42A 3DPRC 2JWPA 3IAQA 2Y34A 3ZFFC 4AGRA 4XBLA 4CDQA 4QIWP 3ITQA 3TNQA 1R1A2 2VAUA 1BJQA 1WWYA 4D7YA 2YZ4A 1H2MA 4CXYA 2PHTA 3PURA 4AFBA 1SLLA 1JODA 1VBA3 2KN9A 1K45A 1AR71 2XVGA 4HVQA 4DEVA 2UY8A 3TOJA 5CFDB 3NSTA 3IDBB 5FJKA 1WCML 5A3TA 4MGYE 2XB6C 1KJRA 3IZOA 4RQPC 3AK0A 1R081 3U14A 1BEV1 4F7ZA 4BHPA 2A5ZA 3K2OA 4IV1C 1M06G 5IJRA 4JZRA 4CP9A 2HYXA 3TRSB 3WZ1A 3AFGA 1OQDA 4E8DA 5C70A 1AR82 3KS7A 1ND2B 3UGHA 3B0AB 1VRH3 3AC0A 3MZHA 4QX5A 2RM23 1FOD3 2Q0AA 3N7MA 4CYDA 4ZXKA 1WLCA 1RHI3 2E51A 1JOBA 1VBD2 2PAEA 3M3EA 3C2UA 3IMNA 4OUEA 5A3WA 2JA8L 3IIIA 3O0VA 2RS31 1J84A 1L7QA 1TWGL 4XF4A 5FZKA 1OFNA 4BQ2A 4PDWB 4E27A 2PFWA 2ZIXA 1DQ4A 2QE3A 5FP9A 4MLOA 2VC9A 1J1TA 2VD7A 2BFUL 2WYSA 3ACIA 4CCOA 2V5DA 5H9PA 2W39A 3EBRA 2OX0A 4A3GL 3MFAA 2W0XA 1S1AA 5FZ6A 1OH4A 1N3PA 3I8TA 1C8M3 2ZEWA 5RXNA 1EUTA 1RUD2 3CZUA 4GD4A 4QXBA 4A3XA 3VBFC 2VE1A 1XB9A 3HEIA 5F3IA 2PPTA 1V9U1 5K0UA 3RWKX 1AR62 2B9UA 4B8CD 3S1NL 4YM3A 1CIWA 4HBNA 4TWTA 2ZGOA 4XXAA 1BK1A 1TQ5A 3WUCA 5DUUA 2C6BA 2FMYA 4LBMA 4EZHA 2TBVA 4XF3A 2YC2A 3MGUA 2W92A 4HSLA 1FMD1 5DZFA 5HCBA 5A80A 2JKBA 5KC5A 2DCTA 4CU8A 4PLOA 2VR4A 4CP0A 1T9OA 1W2UA 2BV4A 3WSOA 2Q1MA 2GNBA 3KV6A 3UETA 1QXJA 5FP7A 2WSVA 4A3ZA 5JZGB 1TG7A 4MGSA 3VL8A 3DXTA 2VUJA 1JH5A 5FR3A 2A1XA 1J83A 4TVMA 5FPZA 3M7AA 3BN6A 4XBNA 1CPNA 5T5JA 1G9CA 2E7QA 1KXGA 2WFF1 3I59A 4RN5A 5FWEA 3CQOA 2HKXA 5LCWL 4E2SA 4TLGA 5KC6A 3KV4A 4W4ZA 2QKDA 1WCSA 2PHRA 3T1LA 3B3QE 4AI9A 3ME2A 2HWE2 2WSUA 3VBHA 1XYPA 4JX0A 5FMBA 2YPDA 3DGTA 2XGXA 4QQHA 2CR8A 4ITCA 3VDCA 4LLFA 1S2EA 4GJYA 5ABJC 3KYXA 2JA5L 3BU7A 4FFHA 4FPFA 4KU7A 4LNVA 5F6LB 1YJKA 5EFUA 1VALA 2OKXA 4B1LA 3EQEA 3DKQA 4E2QA 5C3PA 5IYCL 2ZOEB 2Q8OA 5BNPA 4KMQA 2ERFA 4YW1A 1O59A 2ILMA 3KZ4C 4P9JA 2ENRA 3PVEA 2WIIB 1UNBA 3FJSA 3N9LA 2WLQA 3H97A 3USUB 4BQ1A 2NQYA 1PNGA 3HBKA 1JMUB 1RWDA 1O3QA 3SH5A 1OBNA 1W8ZA 3WDVA 5I0UA 4ZY9A 6RXNA 3RZHA 3NAPB 3NW4A 5FZHA 1RDVA 4BXXL 4BU2A 4C91A 4A93L 1JUHA 3PU3A 4BMEA 1R1A3 1QOOA 3NNLA 4AW7A 2GH2A 2HWC3 4HK8A 3VKLA 2Y33A 4OQ9A 2VQTA 5GAHc 2LRPA 2GMMA 5A70A 3U4XA 4LBKA 5J7MA 1LHUA 4IEWA 2JDUA 1ENRA 2E31A 1ND3B 3ACLA 3AMMA 5CAZA 2BP6A 2EXHA 1RUG2 2JKXA 2HVYC 2ZMKA 4QM9A 5DXDA 5A3OA 4YZ2A 4RS5B 3B5LB 2O1QA 2DWRA 4LO6B 5DQ0A 3M8LA 5DZEA 5FZCA 1QJU1 2QNKA 1Y7BA 4ISQA 3LA3A 5FK8A 5FP4A 5A6QA 4FFGA 4OI2A 4I0BA 4AGGA 2Y0OA 4URTA 1WLWA 2XMLA 2HWF2 1QEXA 5IFTA 1A6CA 1UKGA 2W9XA 4YZ4A 2JD9A 3KV9A 5SV5A 3UYJA 4NIIA 3OUHA 5FXXA 4NO4A 1GKBA 2JG9C 2BWAA 2VULA 2Y8KA 4IQPA 3NKTA 5CFDA 1C09A 1GOFA 2ZHLA 5FK7A 4M3CB 1RB8G 1S0CA 1BLZA 1RUI1 1EV11 1K5JA 1JYCA 2L0ZA 1PM4A 1UL9A 2C26A 2EALA 2R0HA 3U07A 3ZXFA 4B7KA 1LGBA 1OI6A 3LPGA 3SEPA 1OWBA 4JADA 2CDOA 2OUJA 1UAIA 4DUVA 3G7DA 4C1XA 2FQPA 4JGYB 4TPUA 2K9ZA 4EN6B 5GAGc 4HN0A 3U75A 2HEWF 5LA2A 2ARCA 3WNMA 1BQ9A 1IS5A 4NRMA 4AVCA 2FCUA 4GB31 5C3EL 1ND2A 3VKNA 1RUD3 1RUJ1 1VBB1 4QDQA 3CF6E 4QWNA 2GH8A 1N3QA 4S2HA 3L9JT 4WZCA 3DYMA 5FP8A 4ATFA 2Y0SP 1GP5A 1LOAA 2R30A 5ACA3 3PTYA 4FOYA 2GAUA 5GLZA 1AYM1 2VZOA 4MHRA 2JI3A 1OUXA 3KB5A 2C4XA 1CZTA 5A3LA 1SLBA 4KGGA 1RUE1 1V6JA 4LITA 4BM8A 2ZGQA 1SPPB 4PDWA 4KG8A 1H6XA 3AMQA 2A73B 5DPNA 2WN2A 1YC61 1PGW2 1YFUA 3OGJA 5FP3A 5BNOC 5I8TA 5FYHA 1ZVFA 3B08B 1ST8A 1PFYA 1LCLA 2IVIB 2XQRA 3PKIA 2VVEA 3F95A 1W03A 4FP3A 1MQTB 2GSYA 4K8FA 4A3EL 4A3LL 2I45A 3N9NA 4ASMB 1OA2A 1LOGA 1I5ZA 3OBAA 3ES1A 1H1IA 2WABA 2Y60A 3UT0A 3VLBB 3POGA 4YW7A 4YZ5A 1BRFA 1UIJA 5CU1A 5JXIA 5K0UC 4IE5A 1OHFA 3WF0A 1O3TA 3FKIL 2HWD2 3I2IA 3WVJA 2WL1A 2WQ4A 1POV1 3DECA 3J8F3 3JUUA 4YWMA 1WLDA 2Y0IA 4KL1A 2VL6A 5E88A 1X7NA 1HW5A 4X6AL 1PZ9A 3ZYFA 1UY0A 2VO5A 4ES8A 5IP9L 2BNMA 3IWZA 2VZPA 2WZR3 2HJIA 3ZFFB 2W95A 4YLZA 1YQ5A 4ORFA 2V72A 4NJ4A 4I0WB 3ZR5A 3OD0A 4J25A 7RXNA 4J1WA 4CCJA 2DBNA 3ETPA 5J37A 2ZS6B 3J7NA 1ZRIA 1DYOA 4QPIC 3DN7A 5FUPA 2WO3A 2WS91 3BIEA 1SDWA 4XW3A 4GWMA 5JZGA 1PO21 2P17A 3OPZA 1IPKA 3AM2A 4RQPB 5AN9H 3VD4A 3KD4A 2J7MA 1D2SA 5DAVA 4NIHA 3I2JA 1RVF2 1JYVA 3OPWA 4IV1B 4QT6A 4JVAA 2DURA 3CIHA 3ATGA 5C4WB 5FUNA 1FX5A 1NE4A 1R093 1VAKA 4Y1XA 2D98A 4Z07A 4TN7A 4HG6B 4I01A 1ZBE2 5GAEc 2BGCA 4AEDB 4CDXB 4GWIA 4BBSL 5EINC 1UYZA 3BYWA 2R061 1DF0A 4LBQB 2W1UA 3ACFA 3ZSMA 5A3MA 2XL7A 1DG6A 3O1VA 3LA7A 2E7TA 2W1WA 3WDYA 4IGPA 4H7LA 2HWB1 1PGSA 1FATA 4JHTA 2VZVA 3HBZA 1JZ6A 3ZXEA 1ZZ9A 4QPYA 2VMCA 1PVC1 4AL9A 5IWFA 2UYAA 5HXMA 2QFEA 3I3MA 2VMFA 5BNPC 3QBQA 1WD4A 1T6BX 2G9FA 3GTPL 1RJ7A 3HQRA 3PUIA 4XTPA 4COUA 1IPJA 3USUA 1MS8A 5L9BA 1PX3A 2R071 1AR81 5ANNA 4NPLA 4JDNA 4AXOA 3QH6A 3EMRA 4NHMA 2PHXA 3HAGA 2PHDA 4RGKA 4Y52L 4QPGC 3OF1A 2BJSA 2WO1A 2JG8C 1ZZ8A 4DQAA 3CDZB 1RYYA 4Q8LA 3NAPA 3NWKA 1VBD1 3KV5A 3T30A 5FY5A 2HWF3 5FJ8L 4CTEA 3T2PA 2Z2SB 2XJSA 1VP6A 2R93L 1AL23 2PHWA 1PHMA 2CV6A 1XNDA 1WLTA 3FLPA 2XXZA 1F4AA 4UFLA 2D43A 3IT8A 1H30A 3RMXA 2AUYA 2BYVE 3IM0A 3LEMA 1NQJA 2XVLA 3S17L 3EO6A 3VKFC 4IEXA 3RGBA 3C7GA 2LCQA 5M3ML 3OG2A 1ND3A 1JOPA 1V70A 1BEV2 5CKNA 1R1ZA 3BB6A 3LEGA 1ALYA 3PVBB 2WZ8A 1ZX5A 4RS5A 5AI2A 3K4AA 1RUH1 1TVGA 4YVSA 4YPJA 2Y6FA 3S7IA 2GALA 3PWFA 1RMU3 2WKKA 1AR61 2AZ5A 1YUDA 2YC0A 3GM8A 3SCFA 3Q8EA 4Q4X2 1NLSA 2GC3A 5FPXA 3Q9OA 1W8FA 4MVTA 3ZFGC 2WQ8A 1A8DA 1NAEA 2OVUA 4S2FA 1FPN1 4XZUG 3CQZL 4ASKA 4N9IA 3QCWA 1I9RA 5IK7A 4RA0A 1AVBA 4M3CA 3H50A 5DG2A 4KH9A 4MX3A 4A4AA 1JYXA 4GQ7A 4FTEA 1O3RA 1U5IA 2ZGSA 1QJX3 1WMXA 1E5HA 1F31A 1QXRA 3DCQA 1PMHX 4JGYA 4U36A 5ABJB 1WKYA 2R6QA 1UOGA 1HV0A 1WCDJ 2Q1ZB 2R1DA 2VQUA 3AFKA 3S1QL 1EAH2 2VW2A 2R043 1IG0A 3RZDL 4FOVA 4L99A 1KFUL 1BE7A 5BUVA 4C2M1 3BVCA 4NHLA 3U78A 5ISLA 4H14A 1MR5A 3NNFA 2MNGA 2ATFA 2RR13 4XAEA 4FPKA 3U4SA 1ZRRA 4ET7A 5JIUA 2HBUA 4EWEA 1I3HA 4A3IL 1EPZA 5EIOC 1RJ8A 1GQGA 1W6QA 3AMPA 2Z3QB 2A71A 5C44L 4WBBA 3WEZA 3J7HA 3CJIC 3V64A 4D3WA 4DPNA 2ZEXA 4UFJA 5CB7A 5BYNA 4UYBA 4R9AA 3VZOA 1E5IA 4AHWA 2HWE1 1SPPA 3JD71 4QB6A 3GHMA 3TWIA 4PDWC 4OCTA 1VJ2A 3VDDC 3O7OA 4OZXA 2RS52 1YIPA 4OULA 5DUXA 4A3JL 1TNRA 3I2KA 2A7AA 5H9SA 4LJHA 3ZDVA 3N3HA 4OLLA 1MQTA 4Q5OA 3ZLIA 3GHNA 5JAXA 2PLV1 1TZOA 4NROA 4GH4C 4HFSA 4M3CE 3KVAA 4KI5M 2RJLA 1ZRCA 4JAEA 4LUMA 5L9VA 5CKQA 3KF5A 3WV6A 2B63L 4MHUA 2DFBA 1N47A 4ATEA 2NZ9A 1AHSA 3WG2A 3FC0A 5C33A 2RDNA 1SBEA 4FPYA 2HBTA 5FWJA 1WA6X 2FDFA 3WHUA 1CADA 1XYOA 5IVBA 1O4TA 4AR5A 4W6WA 3RPQA 2M4YA 1LEDA 2J1RA 4B4RA 2ET7A 3WQ1A 3D8CA 2D3SA 3OGVA 1OOPC 4D8MA 2WAOA 1GICA 3O5SA 3DEMA 1DIWA 4XVHA 3FL7A 1COV2 5A1FA 2APOB 1IU5A 2NP0A 2RMU3 4KBZA 2BNOA 2JG9B 2RJKA 1H8TB 3NV2A 3K4DA 1US2A 1KEXA 1YO8A 1LNSA 2ERSA 1ODMA 1PK6B 1ZA4A 4P9LA 1PO13 4R8HA 2XONA 5JI7A 4QB2A 1G9FA 3P2AA 4RQPA 3HQXA 4DZGA 2IFWA 3EJKA 4BCUA 4MYEA 4PF1A 5HV4A 5EXOA 3POSA 3CHXA 3MPSA 3WF3A 1UX6A 4LE3A 4IV1A 5IK8A 5T5LA 5LRRA 1RUG1 5A7NA 5CADA 4SLIA 3AP7A 3HWJA 3LDBA 5FPBA 5C4WA 1J58A 1QXPA 3RZOL 5FZ4A 4PQ9A 4GXLA 3LFIA 1UU6A 4W8JA 5A7OA 5GZGA 4CDXA 4AEDA 3TEZA 2IXHA 1NKGA 5L7OC 2C6AA 4LBQA 2NVTL 2YXSA 2BBVA 2W1QA 2Y6LA 4EYUA 4UBHA 4E8CA 3RYGA 2ZTNA 2LS6A 1R0IA 2E63A 3KVBA 2CAUA 4LPLA 3PIP1 2JE7A 4P9XA 4UT5A 4CZSA 2B46X 2XJQA 1H9WA 2D3PA 1NXEA 1ODHA 5JXGA 4RSUA 1AR73 5FXZA 5J3UA 2WA3A 1X8EA 5DDJ2 3WDTA 5BNOB 3CU7A 1W9SA 4Q0VA 3MIHA 5J36A 4YZ1A 2QUOA 2R7ZL 1R083 5DM61 1BEV3 1JU4A 1YRZA 1OF3A 2VMDA 4NR1A 3WP6A 3ZMNA 4AE2A 2QZ3A 4NAOA 5LRSA 1HX6A 3I2GA 5GZCA 1ENSA 1UZZA 4AQSA 4DOUA 1YNAA 1MVQA 4C0BA 4TTGA 4LR4A 3SKVA 4CEWA 2A6XA 2JD4A 4NRPA 3CZJA 4NPRA 3NAPC 4IGQA 5K0UB 3RZKA 4TXWA 3C7EA 1D0GA 1B35B 3AJYA 4XTMA 4K1YA 1LOEA 3USSA 4K3UA 2E2HL 1NCRC 2RS33 1ENXA 2G1MA 4QX3A 3GJBA 4HSJA 2ZZJA 4R4XA 4QGNA 1PGW1 3HPNA 3A44A 3VB9A 2RDRA 1Z78A 4LORA 5KHHA 4UFIA 5HCHA 1A78A 3PL5A 3I4ML 2JDYA 3PTRB 4WVZA 5FV3A 3GTLL 2JDHA 4ZZ5A 3LF7A 2IXLA 4P08A 4QPIB 1ZZCA 4QKNA 3WDUA 2WLPA 4YARA 1VBE1 3VD7A 4FPEA 4Q27A 1HQWA 4RS5C 1J1LA 4XF9A 4Q0SA 1OPMA 4YVSC 3GCXA 4JRLA 4K8RB 5LZ6A 1RUC1 4DB5A 1JOJA 4AQTA 1W28A 1RIRA 4QX2A 2Q4SA 2BDRA 1CGPA 1REEA 1ULFA 1VBB2 1E57A 4AFAA 5FZ8A 2P6CA 1F5FA 1V9U3 2HWD1 2XWBB 3N35A 5F3GA 5FZOA 1YFXA 4I02A 3EHKA 3ETQA 1ENQA 1LTLA 3AJZA 3H3UA 5FPUA 4N90A 3BODA 4HOOA 3QVDA 4ZXEA 2ZX4A 1ZRDA 3KYWA 1B2OA 3MDPA 4PHZA 1X8MA 3CMGA 3ZKYA 4CP1A 1QDCA 2BU9A 4MV2A 4L2NA 1B09A 5DABA 2VJXA 4FAGA 4IEOA 2DF7A 5JSPA 1DGRN 2B4KA 3OYWB 1APNA 1FMD3 4OHYA 5EJ1B 1PFVA 3R4DB 4QX7A 4BWOA 5ABJA 4RD7A 5KXDA 4Y26A 2GP3A 1RUF2 2K0GA 1RUOA 4H2AA 4KWKA 5T5OA 1KRIA 3TBDA 5F1RA 5FLML 1RVF1 3R05A 4AVBA 5CISA 4HMZA 3MIEA 2XDVA 4HVRA 4A6SA 4Z1VA 1STMA 2JE9A 3GTGL 3ZFEB 1ZBE1 3JR7A 3ZR6A 1HIXA 2BOIA 4HT1T 5F2SA 5IUQA 2WFF3 3GTKL 2W08A 1OD3A 2ZGTA 4FCAA 2VCAA 4LHNA 2CKCA 1D4M1 4QPGB 5JMOA 2JG8B 2VUCA 3AX4A 4HXCA 2VMIA 4N7IA 2LROA 2P6HA 5FZEA 3T3YA 5A32B 1GYKA 2VCCA 2RHPA 1V6LA 4POGA 1LECA 1N1VA 1OQ1A 2ID4A 2UWCA 1MQTC 2DVGA 3LPEB 3KCXA 1LB2A 2YY1A 4QQOA 1YHFA 1Y9QA 4U671 5KHJA 2WT2A 4IEYA 2CNAA 1S4CA 4K1ZA 3UJQA 1JZ4A 3IN9A 3D6EA 1E5RA 1LKNA 1TME1 2VMHA 3DF0A 3MW4A 5IYBL 4I0AA 3X29B 4ES9A 2DU1A 2C1FA 2XLGA 5FREA 3GDBA 4XMAA 5DN2A 3AYEA 3CL1A 4YGDA 1WMFA 2ORXA 4J6GA 2R16A 1GZWB 2VM9A 4DXTA 1RUNA 4H55A 1OFSA 1SACA 3RS6A 3UK9A 4MUVA 5CZKA 2ADDA 5IYYA 4E6YA 2JA7L 2RJ2A 1MS3A 2WBKA 1AR92 2EIGA 4CU7A 2IUWA 3I3BA 3ZFGB 1N1TA 1SG3A 1MS9A 1KFXL 1X33A 3IDCB 1YUZA 3QH7A 2JG9A 2TUNA 1M4WA 1H8TA 1UU5A 1W6NB 2HWB2 2P34A 2V5YA 4GS7D 5IVVA 1DZTA 3NMBA 1PK6A 1GMMA 1IGOA 4X6RB 2CGPA 1JI6A 2JI2A 4DFSA 3O1UA 1PVC2 2YROA 3LNLA 4URAA 4N43C 1DGWA 1LODA 4UXAA 2FDIA 2VVFA 1O4ZA 5C3SA 3T1MA 4CXWA 1XBFA 1YV1A 1HXS2 3AKQA 1SCRA 1X9PA 4OHWA 5C3RA 5C4WC 2BE5D 2PYAA 1QQTA 1VAVA 2R072 4GIQA 4OYUA 1BYHA 4W50A 5FRAA 5LBEA 2CWSA 4CDXC 3WX5A 2VH9A 4KU8A 4AEDC 2A6ED 1LTEA 1YXWA 1QJU3 1W9WA 3LD8A 2EIDA 4Q4X1 5GZEA 5B4XA 4FFIA 1QJY1 2JECA 4E4ZA 3HOUL 1SDDB 4NRQA 1SMWA 5IAVA 1JZ5A 3INAA 2V09A 4KWLA 3CJIB 4AAXA 4CSWA 4LBJA 3TAYA 2OQ7A 2JE8A 4RGGA 3SEEA 1JU3A 1O8SA 2P3YA 5BNOA 1YK5A 3VDDB 2VUML 3FHQA 1RUI3 2XH6A 1EV13 3M3OA 2QDRA 4LIUA 4LEJA 4YGBA 5GLUA 1J3QA 3THDA 1H1AA 5H1Sc 2BNNA 3WF2A 3ZVXA 2BWCA 5A7SA 2NMOA 4E2GA 2W68A 1EAH1 1YCIA 1C5IA 1BKZA 4GH4B 4UFKA 3NJZA 4MSVA 5E1RA 5FO8B 2M6OA 1DQ1A 3J7LA 4UWDA 5LBFA 3WNNA 2A3YA 5BNNC 1RUH2 2VZSA 3FZ3A 3RZTA 2O0OA 4GB33 1LENA 1K5MA 1PM7A 1U12A 2C6SA 4UAPA 1RUJ3 1VBB3 1OMIA 4PQQA 2W5FA 4CVUA 4CEWC 4YSFA 5JI9A 2C0ZA 2PAKA 1B35A 4UF0B 5FOJB 1AYM3 1UMHA 4XUOA 1SBFA 3S2HL 1FPN2 4A42A 4RGAA 4FXGB 5LEJA 1RUE3 3NO8A 2WUHA 4DIQA 2YPJA 1W8HA 1XU2A 1OOPB 2RS51 3MHZA 1Y3TA 5A1LA 1X50A 1OLRA 4MGIE 4P9WA 4OZOA 4Y5Z0 2CKAA 3JQWA 4XJZA 1GP4A 4QPIA 2DUPA 2IC1A 5K4LA 3J7Z1 1WCUA 3NVCA 3H9AA 4XYXA 3A23A 2FD8A 3WWLA 5M3FL 4C3HL 1TE1B 2BOJA 4LA2A 3PUAA 5K2ME 2EICA 3C3VA 3PUHA 4L92A 1QU0A 4LO5B 3VGIA 1UY1A 5BY5A 2V73A 5IVJA 2MPFA 2YU2A 4QQPA 2J1AA 5F2WA 3WNPA 4EN7B 3OUJA 4FPGA 1SFPA 1ULGA 5L7OB 1CAXB 1POV3 4B8EA 3U10A 1K3IA 1XOYA 3W5MA 2WO2A 1HB3A 2CGNA 3JD72 1LGNA 1COV1 2ZJCA 4CCNA 3OYWA 2W46A 3PDQA 1TNFA 2EXJA 2SLIA 3RG0A 3HOZL 2EIBA 1ULEA 1PZXA 4HVOA 5GZFA 4CUAA 4RHV2 4JAGA 3HNYM 1W90A 2PLV2 4BE3A 1A34A 2WS93 4F8AA 4YNIA 1H2NA 2B39A 4GJZA 5G04L 1PO23 4AZZA 1XXNA 1HJFA 2AQCA 2RDSA 5EJZB 4E4DX 4GMP0 1TWCL 2A68D 3ZFEA 1HB2A 1GWLA 3QQCE 4M4PA 4CCLA 3A0NA 1ASJ2 1MZ6A 5KBFA 4P9GA 3PHMA 1HLCA 4DS0A 1DFQA 4QPGA 4WM8C 1UKRA 5FYVA 3UJOA 4LO8A 2JG8A 1UZWA 1DLLA 2AR6A 4ASLA 4QX8A 3IDAA 4EZ4A 1H9PA 2R063 5FBZA 3RI8A 3WUDA 3ES4A 5FY7A 4M0HA 3T09A 4BISA 2V0FA 3FFZA 2XLAA 1MPXA 2ETEA 3KT1A 4IL7A 1L7LA 3LDRA 3U11A 5FZDA 1GU3A 2VZTA 1VAMA 3UKNA 5A32A 3LIHA 2HWB3 2ZABA 4IEQA 1NCRB 4COYA 5FYMA 4HN1A 3AMHA 1U5XA 1EP0A 3NV4A 4UI9L 5DDJ1 3T0AA 5LEKA 1PVC3 4M00A 2VOKA 1BBT2 1W99A 3GTML 2RS12 1GZCA 2QDNA 1RITA 4IE0A 3RQ0A 3ILNA 3PO2L 3LGRA 1GZWA 1UXZA 1UXXX 2R073 4A3BL 1AR83 1XNAA 4N53C 4YVSB 5A1AA 3SNMA 3PUQA 1K83L 2BBAA 3IU3I 3JU9A 4IUGA 4B4QA 5CEHA 5LY1A 4HPKB 2OXBA 5EWSA 1QOSA 1QCVA 1S0BA 2DFCA 2X29A 5F5QA 2YHJA 2OZ6A 5GLTA 1VBD3 1W0OA 4LK6A 4RYDA 1WJVA 1NE6A 1UWWA 2WFPA 1XE7A 1NX9A 4ZZ8A 4Q4Y2 4Y7NL 1W6NA 3ZYJB 3S16L 3JB4C 5C71A 2QQPA 4V196 1H8TC 1UW8A 4RR3C 2NMNA 5JXHA 2QQOA 4BXFA 2B7YA 1OQEA 2L9LA 3ZM8A 1RXFA 1S2ZA 4COZA 3JQXA 1PK6C 5FMOS 5JUVA 4AK3A 5FO7B 3IDEA 3NV1A 4H3WA 5EZWA 3THTA 2KR2A 1FI2A 1P7PA 3ZYPA 4UW5A 3ZXDA 2BVBA 3N4MA 2XUMA 1IPSA 1JS9A 1NYWA 2GP5A 3U0ZA 3S5AA 4FPHA 1PIV2 2KKDA 2C24A 2QQMA 3Q8AA 5CNAA 5IW0A 5AFEA 5LW9A 1RUH3 1WZXA 2BGPA 4M4RA 4AI1A 3KQRA 2QBXA 2DCZA 4HLTA 3I2OA 1ZM1A 2ARBA 1FHHA 1GANA 2FCVA 2D6MA 2YB7A 1AR63 2D6OX 5M5WL 4KG0A 4LKDA 1HRI2 2P37A 1OKQA 1VMJA 2J1EA 3KM5A 1NNQA 4LBLA 3ZXLA 5IATA 1X82A 4YW6A 2QQLA 4NVPA 1AJKA 3I49A 1W6QB 3CJIA 2LM3A 3VZNA 2F17A 3ALQA 2VW0A 4XFFA 1FPN3 5FJHA 3WF4A 1ZREA 1FNZA 1QH7A 3W5NA 4C0HA 4JGZB 3VDDA 4BDVB 1KS5A 3A22A 3KSCA 3U37A 3ZYGA 2XHKA 2XVKA 3OEBA 2ARAA 5JR2A 2Y38A 2V3BB 5C4JL 1D4VB 2FMDA 1H7VA 1DGWX 1RUF1 3AZWA 3AVRA 3A7QA 4GH4A 3J26N 4C8DA 5C3QA 3KLSA 3M3YL 4BBRL 1VBE2 1GBGA 3OPTA 3WCRA 5FZFA 3FLRA 4XCAA 1S0DA 5GJ6A 3VKMA 1S0GA 5F9TA 4YM0A 1RUC2 1JXNA 1K5MC 5C4XL 2G19A 5IVEA 2PHUA 5C8WA 1S0JA 5I0TA 2OQ6A 4DY5A 2YYOA 1H4GA 3WWNB 4MXWB 4XXPA 5LASA 2ZHKA 4UF0A 5IVFA 1KDKA 3HMYA 1B35C 2EF6A 3RZLA 5C7GA 1PVXA 3DKWA 3E1F1 3JXSA 4AGVA 1ULOA 2GC0A 1VRBA 3IAPA 3IBMA 1QKQA 3FFQA 3OY8B 3NQHA 5GLVA 5KHGA 2KD7A 1OOPA 3JD73 2HWE3 3JB8A 3H3LA 4GKXA 5AC91 5C5TA 4YRDA 3PO3L 1LU2A 1YIFA 2ZMNA 4MOAA 5JIAA 3SS2A 2OUHA 1NZIA 1VZHA 3AVSA 1K12A 2H0VA 3RWNA 3VZKA 3WG3A 2DVAA 4LKSA 2PLV3 2SBAA 4FT8A 4TLFA 3E6CC 3RYKA 3GXUA 2HEYF 2QZ2A 5CIRA 4N43B 4XBQA 1UD1A 2X5IC 4HONA 4XACA 1JBCA 1LHOA 1RL3A 1PZ8A 2WRAA 3LDKA 1GQPA 1S0EA 3GTOL 2D6PA 2YC4A 2VZQA 3UKVA 3PU8A 1I50L 4CU9A 4XE9A 5L7OA 1QYBA 1CAXA 2Z69A 1DCSA 3MLLA 3VV1A 4AR2A 3H8UA 1NOVA 3HVDA 1AR91 1ZBA2 1D4M2 2EA7A 3OOXA 4K7JA 4YVWB 1LOFA 2VUAA 2W94A 1Q3EA 3K46A 4WVVA 5DAXA 3HJWB 1IU6A 2XJVA 5JVH1 2Y64A 2PMZP 1KGYA 3MO4A 5FYBA 4LO4B 3VBRC 4Q4W2 2A75A 5AVAA 5LB6A 1SMUA 1YUXA 3WLUA 4I3GA 1DYPA 3K7AL 1IQDC 1QHDA 2VBPA 3HJRA 4UW4A 3RSJA 3ZMOA 3BUCA 3T0BA 3D4KA 1F2NA 1V6IA 2LW8A 1RC6A 1FYUA 3VL9A 1NXD1 2C5DA 3OBRA 3VZJA 4BK5A 1CWPA 2K46A 1HXS1 2A6HD 1TME2 2OIIA 3F2ZA 3OD4A 4PI2A 1JUIA 4YGEA 5JOYA 1RUG3 2VXRA 3ZFEC 1SFYA 4YW3A 4Q0PA 4XJAA 1DYKA 5BNNB 1CR7A 3AKPA 4JDOA 3GYDA 5F7UA 4BQWA 5SV8A 5JCTA 2IFRA 2R0FA 2BQPA 1NLRA 4XJUA 4CEWB 4CRQA 2W2IA 4AR6A 4TZDA 2PQQA 4LTAA 4OHXA 3VBUA 1S0FA 4SBVA 5JOZA 3OTFA 1NCRA 2WWJA 1AJOA 2ZX0A 3O12A 4W6XA 3W21A 3LB9A 4QHZA 1ACCA 2JB4A 1L3JA 1GR3A 3DYPA 3PVOA 4MO3M 5FZBA 3OSDA 2A3WA 3J7MA 5KXEA 1W9TA 3WW3A 5FYZA 5CA6A 4XUQA 4A44A 3KT7A 3SCHA 4YFZA 3AZVA 3ZIXA 3EB7A 2AREA 1FV2A 4BZ4A 3BCWA 3MLKA 5HI0A 3AP9A 4XGHA 2NYYA 1FAYA 1H4HA 2AACA 3GTQL 1DQ6A 4QGLA 3WT3A 1BQPA 1IW7D 3ZSJA 4YM1A 3LKJA 4HPKA 4QMAA 2FDKA 1O7FA 3ZN6B 3NKGA 1YQ8A 2WA4A 5LWBA 1QJY2 5BV6A 3RZJA 2XJPA 2A6YA 2JIGA 4A6OA 5F37A 5FZOB 4AR4A 4LHLA 1CZSA 3IMMA 5DAQA 4GZ9A 1W8WA 3T08A 1HRV2 3NJVA 1CAUB 4LKEA 4DXRA 2DYCA 3B93A 1SLAA 2BVVA 1HB4A 1TMF2 1ULCA 3S57A 4CU6A 1QOTA 5A6XA 1GUIA 4HANA 5CFCC 4ISRA 2WYFA 4J1XA 4NIDA 2B45X 1Y1VL 1Q8PA 3GBFA 2JDNA 4FI9A 2OS2A 4XUTA 1H0BA 1W2TA 2ET1A 2VNVA 2ZX1A 1YJLA 2DCKA 1MZEA 3K75B 2JICA 3ENRA 3LWVB 1IKPA 3ZIWA 5JOWA 2FDGA 4D6QA 1W05A 2Q30A 3LWOB 1UF2C 4B4PA 1KQRA 4LK7A 1RUC3 2BGOA 4Q2FA 4XPVA 1ZRFA 4M0NA 4XETA 1VBC2 2YGMA 2VMEA 3MQKB 3WOGA 1XSRA 3PJQA 1LHWA 1ULPA 1W2OA 4N9HA 2HWD3 5EHDA 4D6SA 2VECA 2ZX3A 3AL6A 5FLIA 1VR3A 4A7ZA 5EV7A 4WM8B 3VKOA 4C1WA 4DUXA 1W9YA 2M6PA 2J1UA 4PJYA 4XILA 4JGZA 3HD8B 1CD3G 2EXKA 3N36A 4ZN1B 5C3OA 4CPBD 5I8SA 5IK4A 3GGLA 3GZAA 3LIGA 3N7LA 1MS1A 4Y1UA 5DAPA 4ZKTB 1DU3D 4GWJA 3MFCA 1BK0A 4Q4V2 4RHV1 4V1PA 4E4SA 5I0RA 2NM1A 3SH4A 1BCXA 1W0PA 2E32A 1F4LA 1GNZA 1O8PA 1NG0A 2WJSA 4FP2A 3IB3A 4BXSV 3H7YA 4PBOA 1F35A 1C1LA 2A6ZA 2DSXA 5HBAA 1RVF3 4FPJA 4L97A 4EQVA 3B69A 4PIXA 4MXWA 4XFIA 3A0KA 1ASJ1 2WZPP 3LWRB 4N53B 2LTNA 3O1SA 1QH6A 3LFMA 4F83A 4B1MA 4COWA 2Q8DA 1ZBE3 2D6LX 2WN3A 3WG1A 5IAXA 2JEMA 3KHBA 3OY8A 4YYOA 3J7Y1 2Y26A 1IS3A 1W2AX 1D4M3 5FXWA 1DBNA 1RGSA 3AP5A 3FHAA 3FWEA 1VMHA 4AFDA 2JIJA 4UW6A 1Z0HA 4KQ7A 1B2JA 5DZGA 4FQ4A 4EE2A 2VMGA 4RR3B 2CWMA 3KCYA 3PIO1 2CSGA 3O1RA 3SISA 4K20A 3VBSB 3L2HA 4BLJA 2UURA 4XXBB 3AKSA 4MGZE 1BBT1 3H8RA 4N43A 1QQP2 2RS11 1JTZX 1XE8A 1W8NA 3P6BA 4NOTA 1TME3 3GF6A 4PT6A 1OLMA 3JBG2 1NXMA 1G9AA 1XQNA 1UYYA 1C28A 3O1MA 1TEIA 3S0MA 3EYPA 3BOPA 4MGKE 1TWAL 3K3OA 1QJFA 1HDKA 2WNEA 3ZXJA 4I3PA 3ILRA 3QD6A 5JVG1 2R1BA 4AG4A 5F5AA 3D5OA 4NE9A 2UWBA 1OSGA 2MEV2 3HJYB 4YVWA 5IY0A 5BPXA 3OGGA 5A3UA 3H3ZA 1NT0A 4Q4Y1 1LOFC 1VB4A 3ZSLA 1YFYA 2QVSB 2Z5WA 3HN1A 3LWCA 1Z92B 4ME3A 2YV8A 2ZGRA 2IZWA 4Y1YA 3BI3A 1DQ2A 3O1PA 3RZGA 5C6CA 1O5LA 2A3XA 5E16A 4D0QA 4F3JA 3SLIA 1BFYA 4IEVA 1TWHL 4NHKA 2X05A 1RYTA 1GLHA 2X8KA 3FX3A 2E2JL 1RINA 1EUUA 1PIV1 5FYSA 4XFHA 4JV4A 4EROA 1O6UA 4OVEA 3MBWA 4ZS3A 5BNNA 2DCJA 3K4ZA 1YEWA 4Q1PA 1I6HL 3WW2A 4RFT0 3O1OA 1K5MB 3S6PA 3PUSA 2VG9A 2FZ2A 4AHYA 1HRI1 4Q4X3 1VBA2 3HOWL 2WT0A 1XNBA 4Y3OA 4EN8B 1OLME 1QJY3 2WQZC 3TN91 4EWAA 1H8VA 1GWMA 4LHSA 2VZ3A 2I74A 3VBUC 2V0EA 3WQBA 4IV3B 4GMP1 2YBKA 2VU9A 3FN9A 1S24A 1J3PA 3C7OA 3Q8BA 2M4VA 3N9OA 3H42B 5FZMA 1UY3A 1H1MA 1UN1A 1CX4A 2ZEZA 4QQLA 2WZEA 3MEPA 5KXCA 3OBTA 3R6SA 3FBYA 4V2WA 2QQVA 3MLJA 1R9TL 1FHMA 4AI2A 1VRH2 4Y33A 3CBNA 3UV9A 4IE6A 1W6OB 5FY1A 5EPAA 1T6GC 2EIEA 2RM22 4LO7A 2BUKA 3SQOA 5JVVA 2UY9A 3POIA 4AVSA 1C4RA 4OUSA 1EAH3 1RHI2 4R9CA 5C8CB 1WBLA 2X5IB 4KWUA 2VZ1A 1IHMA 1OURA 1B71A 3ZN6A 5JDBA 4CCEA 4RL7A 2CL2A 3M4FA 3ZPYA 5A7WA 4DINB 1N3OA 1GNHA 3V65A 4A45A 5EYXA 3ZYHA 2I2SA 5FY9A 1YFWA 3H7JA 1URXA 2GU9A 3RJ2X 3ASIA 2DDUA 2QJVA 1CAUA 3CNAA 3T4VA 1QJZA 5FOBB 1Y9GA 5EYYA 1W3VA 3LSDA 4CCCA 1F8VA 2VW1A 3HN3A 2RS53 1AXKA 1IROA 1GOHA 2ZMLA 3VDAA 1ZZBA 1OF4A 3B9IA 5I0DA 4YW4A 4AI0A 3VBRB 1PNFA 1CX1A 4A3CL 4I30A 2ERJA 3WNOA 1RTVA 3BALA 5GKAC 2R32A 3ZSKA 2PN5A 3OJBA 5J09A 2O8OA 3FLTA 4YW5A 1LOCA 5I93A 3IIAA 5H9RA 1QGLA 1W8TA 5JSOA 5AFBA 3LWPB 1D0HA 1JYTA 4FXKB 5FAXA 3KYVA 1W6PB 5FZ7A 1ZA7A 4CXXA 3RFRA 1SQ4A 1V6OA 3E5UA 4WM8A 3OUIA 1ZBA1 3OBZA 5E6HA 4BIOA 5CG9A 2D3RA 5HCFA 1S2KA 5FPVA 1HN0A 4JGZC 3CO2A 1CAWB 3M3IA 2VOWA 4LKFA 2ZGLA 2A70A 3B01A 1COV3 3FDJA 1IS4A 3NJXA 3WQ7A 1Z7S1 4Q4W1 4CDWA 1W06A 5AC92 2GDFA 2XJUA 1SZBA 4AEKA 2EXIA 1RB9A 4QAWA 5CVRA 4UFMA 2VY0A 1CIYA 2VZRA 3PIJA 1JYNA 5C5UA 4NN0A 5FO9B 4L8QA 4WZFA 3H8XA 4JQTA 2AEYA 2HYKA 4OMCA 3CJXA 1WD3A 1DLCA 4FFFA 5MFZA 1OH3A 2JJ6A 1S30A 2ZGNA 3LAGA 1LR5A 1CZVA 3A21A 3APBA 5A7PA 2Z4FA 4N53A 4CCKA 5A6YA 2WNVB 3K48A 3BKZA 4WM7C 1C8NA 2O14A 3ROUA 3LA2A 4C3IL 5ANQA 3O0XA 3MUZ1 8RXNA 1GWKA 2AYHA 2D97A 1HQLA 1PFUA 4B29A 5K8SA 1DGRA 2OPWA 4BOWA 4W65A 3ACGA 1XU1A 3KHCA 1YK4A 1MZ5A 5BXXA 2VQ0A 3VHRA 5G05L 4FPOB 4RR3A 3ZOIA 4LT5A 3VBSA 1OLQA 1LRHA 2ZCWA 2BRTA 3MV11 3THCA 3H8OA 4P5HA 3HKZP 5IYDL 2AC1A 1YQCA 2JX9A 5DDJ3 5CFCB 3UESA 3POYA 1T2XA 2VBDA 4PF5A 1QMJA 5IVYA 3CLPA 4JC1A 3MSUA 2C9KA 1JYBA 3VPBE 3LEKA 3IPVB 4DEQA 1V00A 5DUWA 1V0AA 5JPMB 4YGCA 4L9BA 5TSWA 4WVWA 4FQZA 2PTMA 4QKBA 4XIOA 5F6KA 2YU1A 3R4UA 4AEMA 1AXZA 2HWC2 5FYYA 4AVAA 5A3PA 2P5BA 3OGSA 4Y4YA 4AYUA 1S2BA 4YVWC 3S30A 3GNEA 3M70A 4P14A 5LA0A 3ZFGA 4O9EA 2W87A 1HRV1 4QD2A 1JW6A 4IEPA 1TMF1 2JDAA 4DUWA 2GN3A 1EPWA 4Q0UA 4Q26A 1WGPA 2HLEA 1JHJA 1G9BA 5FZ3A 3POFA 5L9RA 3ZPOA 2ZAAA 5FYCA 1DQ0A 3WY6A 2DVBA 2D6KA 1V6NA 2YBPA 3MPBA 4AVTA 3VDBA 3WR0A 2UYBA 4XOGA 4EN9B 4O7XA 4E9KA 3LCPA 4P9YA 4ZU7A 1FXZA 2JA6L 1UQXA 2WAQP 1W2NA 2ADEA 2ZGPA 3I4IA 4LULA 3KMHA 2E7AA 4XJ8A 5FMOL 1T9QA 1VBC1 4BIFA 4CP2A 1Q56A 3Q8CA 4FPLA 5HV0A 1PMJX 5FY4A 3FE5A 4FOWA 3HOBA 3DL3A 3MIFA 3RZMA 3OB8A 2WNUB 4IERA 1L7RA 5DUVA 1HN1A 2H12A 3HAXC 4LBOA 2VTXJ 4IV3A 2FDJA 4MXVA 5FZLA 1IKQA 3MYXA 3I3DA 4TYSA 2A6VA 3AKTA 4RFRB 4S2GA 4Y22B 3C8XA 5FMDA 2E33A 2FZ1A 1LGCA 2BPA2 5KXBA 4WFN1 2DUOA 1MZFA 3MUY1 3VBOC 5A33B 1FNYA 2J1VA 1NXGA 4Q4V1 4BY7L 1WW5A 2D40A 2GN7A 3LOIA 2NVQL 3BTYA 1W6OA 3V0BB 4XFCA 1UX7A 5LA9A 1UMZA 3NFPI 1S0IA 1VB2A 1RUF3 3I2DA 3QLQA 1UPIA 4YG0A 5FPAA 2DUQA 2AUSB 5MLC3 4ZU4A 1WW4A 2QQNA 3WINE 4FBFA 5ACA2 2GNDA 5C8CA 3POBA 5I91A 2X5IA 5KHIA 2XBO1 3HNMA 3T2OA 3O14A 4LQRA 4PCRA 4QKDA 3A4UA 4CUGA 4OFGA 1DP0A 4PLNA 5JMCA 4OI1A 5F5IA 2CDPA 3ZYRA 4AR3A 4W6YA 2G9GA 2KXLA 4Y4RA 4E4HA 5CG8A 2JDZA 4LA3A 4DO0A 1UU4A 4D94A 2E26A 3H0GL 2Y6JA 3WCSA 3MW2A 1IG3A 4PLMA 3HOXL 1QIQA 2YG0A 2YGLA 4A3DL 4P00B 5AC93 1MEC1 1SLTA 2PHFA 2YFZA 3VBRA 2XHNA 4BJ0A 1GNYA 1CAAA 1DQ5A 3BOWA 4RXNA 2BW8A 5D1IA 1H2KA 1I3QL 1QQP1 2XJTA 1KITA 1I6XA 4NPMA 4CEYC 1W3XA 1NZCA 3J8F2 2PQSA 4QX0A 5FZGA 4ZN3B 2FBEA 3JBG1 4DRRA 1NA1C 3O1TA 3BPSA 1F15A 3ZN5A 3D0JA 5LBCA 5KHKA 3U1XA 1OVPA 4DXSA 3M3QA 4P5YA 1W6PA 2WZR2 4N7UA 3E6DA 1UZYA 4XC9A 3D3AA 2J42A 3AXDA 4ARYA 3KGLA 3WF1A 2Q5TA 2RV9A 4R52A 2MEV1 3LOBA 2YBSA 4QHOA 5T54A 1LEMA 3B02A 3M1HA 3D82A 4MADA 4BLIA 3UKTA 1AR93 1CAWA 5L73A 2I07B 4LE4A 3VZLA 3ECQA 4LBNA 3PNAA 2ZBJA 2B5ID 2QQUA 1AYN1 5FMCA 1LHVA 3SC7X 3VBUB 1D2QA 3ZSEA 4CDWC 4EV0A 1VMFA 4QXKA 5A7WB 2DVFA 1R0GA 1DX8A 4HZFA 5C9AC 2AYJA 4UY81 4XFAA 2JENA 2WNOA 2G9ZA 4XMIA 3V0AB 2VTXA 3W59A 1P8JA 1U0AA 1WMEA 2TEPA 2W52A 1R092 3NNGA 3TB0A 2D44A 5AI3A 4QKFA 2YMZA 1Q43A 1QNWA 3ON7A 1N1SA 1REFA 4GWNA 5F3EA 3SHRA 1HXS3 2IXJA 2YFUA 4ZHNA 2B42B 2WNVA 3HR9A 4WV8A 1IRNA 2CGOA 2AEZA 4XF0A 5DG1A 3AZYA 1JZ2A 5FQ0B 1VCXA 1VBA1 3HQUA 5A3NA 2ZEYA 5GZDA 3RYRA 4BB3A 1DDLA 1CPMA 2TNFA 3ORJA 4BH9A 4XHBA 4XAAA 5IP7L 1CQ9A 3FMGA 2R92L 4XZPA 2ZGUA 2Y6KA 3VHOA 2V4AA 4XIKA 5D21A 5MF6A 4FTSA 2EY4E 1SLIA 4LIVA 5JR7B 2X09A 1MS4A 3VBSC 4DY3A 4CUCA 5CFCA 3NNMA 3S2DL 3GTJL 2F4PA 1DZRA 4HKWA 2C9AA 1VRH1 3RZ6A 4CDUB 1VZIA 5D8AA 4QHBA 1UZVA 3AZXA 4TSVA 2E9QA 2RM21 1FOD1 5IHRA 4OI4A 3AP4A 5LATA 5IFPA 1GP6A 1NCQC 1WBFA 3AMNA 2VVDA 2KA3A 1V6KA 1RHI1 2UU8A 5FY8A 5DMYA 2BFUS 3IPVA 4Y20B 5CBLA 1UCXA 2P2KA 1W6MB 2R49A 1SMMA 3K51A 1LOBA 1RDGA 4CDQC 2HH9A 4R9DA 3WG4A 2Q8EA 4UFHA 5E89A 1AXYA 1H6YA 2H6CA 3S7EA 1AL22 4FSJA 2A69D 4P9IA 1AF9A 4AAPA 1ZZ6A 4AWDA 4U2AA 3WNXA 4JAAA 2MHFA 2ORZA 3TN92 1Y4WA 4AHXA 4H7MA 4COVA 2DBIA 5J1XA 1I1EA 3BTZA 1Y1WL 4FVVA 4K40A 5ERLA 1A8MA 5IT6A 5FTTC 2J1TA 1KJLA 4N8MA 5GALA 2ZX2A 4O61A 3ZKUA 2ZGMA 1C8M1 1WW6A 3UGGA 2E6VA 2QL0A 5FXVA 4QPWA 1RMU2 3GCWA 3T0DA 3LEIA 3MF9A 4ZONA 4G3YC 5FYUA 2BEOA 5J48A 2BZDA 4FO9A 2CTVA 4D7TA 2XR4A 3B7MA 1CAVB 2IXKA 2RG4A 4YM2A 5FZ1A 1ODNA 2VBBA 4OMDA 1J59A 3ZXGA 4A7KA 3WHTA 2A6WA 2VOXA 3UGFA 4CA9A 2RVAA 2WNUA 5HPOA 2N7GA 4WM7B 1QJX2 2IXIA 2NLRA 4QB1A 3ZO0B 4IV3C 4KGQA 1OUSA 2ZXQA 1F5JA 1LU1A 4Y22A 1B13A 1XRUA 5MGNA 2EAAA 5JWPA 3LWQB 1XNCA 4JQRA 2V4VA 5A33A 3I4NL 4BPZA 4NWVA 3LE0A 2R042 2VCMA 1HJGA 3H9BA 3V0BA 3OGRA 4XUNA 4A7YA 2XOMA 4JRAA 4RHV3 1WCQA 3GZTB 1DZQA 3QACA 2Z3RB 2RR12 2PXJA 1W39A 5FY0A 4ARXA 3OCPA 2ZZQA 1BMV2 1PZ7A 5C8CC 2WWUA 2Q1FA 3I3EA 3WW1A 2AENA 2VNGA 2XPJA 1F4HA 4D7SA 4A3ML 4LBQD 1R0FA 5FUIA 3UL2A 4Z8BA 4XABA 3DPRB 1AZDA 1CJDA 5FLHA 4EJRA 1QDOA 4AQ2A 1O3SA 1ASJ3 3BPZA 3GBGA 4YG3A 1PGL2 2DCYA 3WNLA 5DM71 4S2DA 1G7YA 4EN0A 3KYYA 4JKLA 2F4LA 3I7DA 4XQDA 2DU0A 1KS4A 1D7PM 3I2HA 4O65A 4X8PA 1NY72 1LJ7A 2B8MA 3S15L 1OPOA 4XUPA 3I54A 3NV3A 2GNMA 3POWA 1QWRA 5FZAA 2XKPA 5F32A 1Z7S2 4Z82A 4ZPIA 3GZEA 3VZMA 3VHNA 4DMIA 3MICA 1BZWA 3KCCA 1SLCA 3PLQA 1POQA 4INDA 1OT5A 2BERA 4G4FA 4L11A 2VL4A 2QTWB 3FHIB 4HKLA 1V6MA 2ZAHA 1BBT3 1YQ2A 4R9BA 2RS13 5KR7A 4Y1ZA 2E53A 3AB0A 2ZA9A 3MIGA 4QU1A 1W8OA 3RYPA 4AI3A 4XEZA 4XHXA 1CJPA 2WO7A 3PZAA 1LKOA 3S14L 1R1A1 4Y24A 4KNCA 3VBHC 3CKHA 4IE7A 1X36A 4LOSA 4BQYA 4HKOA 1LKPA 2HWC1 2LALA 2VZUA 2RMU2 1HV1A 1YYNA 3CEWA 3RMYA 3W20A 5F5CA 1XYNA 4AHZA 1YLLA 2XG3A 5FKBA 1PO12 4Q4Y3 2PVEA 3KWVA 1VE0A 2O8QA 5J98B
chains in the Genus database with same CATH topology
4POFA 2EVXA 2WINB 3NL1A 3V0AA 1ULDA 5B2GB 3V56A 1LKMA 4Q29A 2VGDA 4G9SB 3VBOB 2ZKNA 1BQ8A 2P3JA 3VBFB 1Q8VA 1HKDA 2DV9A 4QU2A 5KWRA 1A3KA 4LHKA 1XNKA 1PIV3 2O5JD 3ELNA 2WNVC 2OYZA 2PSMC 2AGSA 3P3PA 4GA9A 1GSLA 5FQ0A 1MS0A 4OHZA 1FV3A 4BMBA 1YWKA 4DNYA 1DHKB 5K7PA 3KT4A 3J9SA 3MI8A 1HRI3 4WVMB 4A2UA 1AR72 1KD7A 1GV9A 3TN93 4QQ2A 1R0JA 1C57A 3MIDA 1JYIA 2CY6A 1R082 4GMP3 1HQNA 4G6BA 3IKWA 2D93A 2PVXA 4CDUA 3LZZA 1RUD1 1O4YA 4I09A 3N7JA 3WXPA 2XKOA 5D8AC 2GMGA 1G6NA 1WCKA 3FUOA 4Q1RA 3PJYA 5ACA1 4X6QB 4Y20A 4JTOA 1VBE3 1W6MA 4ONUA 2AH2A 1ZRPA 2XJRA 4B3NA 1S55A 4CEYB 1IQAA 1EYBA 2DTYA 4OUMA 1SCSA 1NA1B 4IESA 2RS32 1JN2P 3ZN4A 4BA6A 4Q8KA 1MACA 1AX2A 5CFDC 1BVP1 4OHVA 1BXHA 4XFGA 4XJWA 2PHLA 1G86A 4AEJA 5T5PA 3AYAA 4AI8A 1UIKA 2BTVC 2DTWA 1CESA 1YI7A 3TYJA 1SFNA 3AP6A 4FOQA 3M2MA 4CDWB 1ND2C 1QF3A 1U5ZA 2FHRA 3DUIA 3VN4A 1Y43B 4R4ZA 5E8AA 4FTBA 4K9FA 3H1WA 1REDA 3MPPG 5C9AB 4I2OA 4O9GA 1CAVA 5GADc 1V9U2 2OPKA 2ZHMA 3J8F1 2ARXA 1QNYA 2YDEA 2XBO2 3WD5A 3RDIA 2WZR1 4LUKA 1VLNA 1MS5A 3BTAA 3PKJA 2CAVA 4META 2WNUC 4WM7A 3SITA 2WWSA 4YWLA 3SMHA 4B7EA 3GZUC 1FMD2 3D0SA 1UPSA 3ZX7A 1WUVA 1ZBA3 3SCGA 3KGZA 3H1YA 3RZZA 2VNRA 2VQAA 2D5FA 2XWJB 5T52A 2ES3A 2ZHNA 1N1YA 1Z7S3 2VPVA 4Q4W3 3SXWA 1MEC2 2QCSB 1ONAA 5T50A 1OWCA 3E5XA 1R091 5FFOC 4K21A 4D69A 5GLWA 2YUEA 2ZGKA 4AVVA 4DRVA 2WFF2 3PMSA 2MS3A 1CVNA 1NCQB 1CONA 3DPRA 4YW2A 3ZFFA 4Z2WA 1G9DA 2WT1A 3W9AA 4K6BA 4CDQB 4MH0E 2D5HA 4EWDA 3WP4A 2WC2A 3R0RA 3RRDA 1SMVA 3ILFA 4DXZA 5JZGC 3B94A 5L19A 3O0WA 5I8YA 1SBDA 1AYN2 2GC1A 5HCAA 4YG6A 1IZ3A 4Q0QA 4IETA 2IXCA 2P3IA 2K2SA 3ZG6A 1OD5A 4BYYA 1Q8QA 3MF6A 2GC2A 4PBPA 2P3KA 5MFPA 3HT2A 3TNPB 3RNSA 1YI9A 3JCIA 5HXVA 3ZYIB 4B4RA 4YFZA 2HWF1 4XQWA 4FAHA 4FPCA 4LLOA 4JAFA 1H2LA 1AL21 3WQ0A 1Q8OA 2H0BA 1J3RA 3ZXAC 1Q5OA 1KDMA 3THPA 2K2DA 5FCCA 2Z79A 1O5UA 4XJ9A 4AFMA 1GZ9A 3M3CA 1ZNPA 3WW4A 2IWGB 3DV8A 1BVVA 2GZWA 1FT9A 2EAKA 2J9UB 3GBWA 1HRV3 2JXAA 4NWWA 4PIYA 4QGMA 1POV0 2D6NA 1WW7A 2XLFA 4C90A 1VZGA 1TMF3 5T3NA 3W58A 1OA4A 1LULA 3HIFA 3ST7A 3VBOA 1GFF2 1RMU1 3PMEA 5FLJA 4JDMA 4K9SA 4XQ4A 1F9KA 3VBFA 3G6JB 4GKYA 1QJU2 4QM8A 2X53S 5J96B 1C5HA 4JTNA 1FOD2 4HETA 5JLVA 5H9QA 3RJRA 3ZXKA 3P3NA 1JHNA 1ZYBA 1AUYA 2NYDA 4GALA 2NPIA 4KBBA 1O91A 3HT1A 2PELA 4Z92B 1VBC3 2OW4A 4WVMA 4AQ6A 1IOAA 3WP3A 5BNQA 2KM2A 2JI1A 3K35A 3JZVA 4HL0A 1QJX1 4GULA 4UBGA 4UW3A 3B9CA 1PMIA 4JCKA 1RUI2 2ZKLA 1EV12 3AXEA 1OA3A 3H0OA 1ZZ7A 1ND3C 4PIZA 2HR5A 3SH3A 1AL0G 2R041 2HEVF 3AZZA 4CDUC 1C8M2 2XL9A 4GB32 4Q4V3 2OZJA 2GNTA 2RE9A 2RR11 1RUJ2 1IS6A 1BMV1 3E97A 4HK9A 4CEYA 5I0SA 2LUWA 3VUOA 5EJ3A 4OI0A 3I59B 1AYM2 1NA1A 2PA7A 2XBO3 2VNOA 5FDBA 3R4SA 1U5YA 2H6BA 2PYTA 5T55A 1RUE2 1SEFA 4XF1A 1PGL1 3VBHB 3MIBA 4YFWA 2ZACA 3H1MA 3L2YA 2ZPXA 4MZUA 1NY71 3E6BA 4JGYC 4KWJA 3WDWA 3LSEA 3BIWE 3URFA 1QY4A 2G4IA 4XFBA 1DVBA 1C1FA 2RDVA 1EY2A 5BNPB 1MEC3 5C9AA 4AFCA 1AX1A 1G8WA 3WDXA 1AX0A 1QQP3 1NQDA 4IEZA 2PAMA 3T2TA 1LESA 5LK5A 3E5QA 4XDQA 2B5HA 3N7KA 3JBG3 2OA2A 3AYCA 5JOXA 2NN8A 1RYQA 3P8BA 3J4UH 3KYUA 2GMEA 4IEUA 4O9EA 3B00A 2RMU1 5IK5A 3EXUA 5LK7B 3WP5A 4M3CF 2F6BA 2MEV3 1MVEA 4Y1VA 1Q8SA 3RI9A 1PO11 3AYDA 2UWAA 5GM0A 1WA4A 2WS92 5JSRA 4AF9A 1LHNA 3FBMA 1DGLA 4M01A 1PO22 1AYN3 1GQHA 1VIWB 3QOPA 5K9YA 3PVNA 4ZU5A 3GALA 1R0HA 3ZDSA 4X8NA 4YZ3A 1C3HA 2CYFA 1CN1A 3AKRA 1WMDA 1E8JA 2DVDA 2D7FA 5JPNB 5D8AB 3FUQA 1NCQA 2VOVA 2GMPA 1T9PA 4IXLA 3MW3A 5AVPA 3VHPA 5JCTA 2R062 2Z42A 3DPRC 3ZFFC 4AGRA 4XBLA 4CDQA 3TNQA 1R1A2 1BJQA 4D7YA 2YZ4A 1H2MA 2PHTA 4AFBA 1SLLA 1VBA3 4HVQA 2KN9A 1AR71 2XVGA 2UY8A 3TOJA 5CFDB 3NSTA 3IDBB 4MGYE 2XB6C 1KJRA 4RQPC 3AK0A 1R081 1BEV1 4F7ZA 4BHPA 2A5ZA 4IV1C 1M06G 3WZ1A 3TRSB 3AFGA 1OQDA 1AR82 3KS7A 1ND2B 3B0AB 1VRH3 3MZHA 4QX5A 2RM23 1FOD3 2Q0AA 3N7MA 4CYDA 4ZXKA 1WLCA 1RHI3 2E51A 1VBD2 2PAEA 3M3EA 3C2UA 3IMNA 3O0VA 2RS31 4XF4A 1OFNA 4E27A 4PDWB 2PFWA 2ZIXA 1DQ4A 2QE3A 4MLOA 1J1TA 2BFUL 5H9PA 2W39A 3EBRA 3MFAA 2W0XA 1S1AA 1N3PA 3I8TA 1C8M3 5RXNA 1RUD2 4A3XA 3VBFC 2PPTA 1V9U1 5K0UA 1AR62 2B9UA 4B8CD 4YM3A 1CIWA 4HBNA 4TWTA 2ZGOA 4XXAA 1BK1A 1TQ5A 3WUCA 5DUUA 2C6BA 2FMYA 4LBMA 2TBVA 4XF3A 3MGUA 4HSLA 1FMD1 5DZFA 5HCBA 2JKBA 5KC5A 2DCTA 4PLOA 4CP0A 1T9OA 1W2UA 2Q1MA 2GNBA 1QXJA 2WSVA 5JZGB 3VL8A 2VUJA 1JH5A 4TVMA 5FPZA 3M7AA 4XBNA 1CPNA 5T5JA 1G9CA 2E7QA 1KXGA 2WFF1 3I59A 2HKXA 4E2SA 5KC6A 2QKDA 1WCSA 2PHRA 3T1LA 3B3QE 3ME2A 2HWE2 2WSUA 3VBHA 1XYPA 3DGTA 4QQHA 2XGXA 2CR8A 4ITCA 4LLFA 5ABJC 3KYXA 3BU7A 4FPFA 4KU7A 4LNVA 5F6LB 1YJKA 5EFUA 1VALA 4E2QA 3EQEA 2ZOEB 2Q8OA 5BNPA 2ERFA 4YW1A 2ILMA 3KZ4C 4P9JA 2ENRA 3PVEA 2WIIB 3FJSA 2WLQA 3USUB 4BQ1A 2NQYA 1PNGA 1RWDA 1O3QA 3SH5A 3WDVA 5I0UA 6RXNA 3NAPB 3NW4A 1RDVA 4C91A 1JUHA 4BMEA 1R1A3 1QOOA 4AW7A 2GH2A 2HWC3 4HK8A 3VKLA 5GAHc 2GMMA 3U4XA 4LBKA 5J7MA 1LHUA 4IEWA 1ENRA 3ACLA 1ND3B 3AMMA 5CAZA 2EXHA 4QM9A 1RUG2 5DXDA 2ZMKA 4YZ2A 4RS5B 3B5LB 2O1QA 2DWRA 4LO6B 3M8LA 5DZEA 1QJU1 2QNKA 1Y7BA 4ISQA 3LA3A 4OI2A 4I0BA 4AGGA 2Y0OA 4URTA 1WLWA 2HWF2 1A6CA 1UKGA 4YZ4A 5SV5A 4NO4A 1GKBA 2JG9C 2BWAA 2VULA 4IQPA 3NKTA 5CFDA 1C09A 2ZHLA 4M3CB 1RB8G 1S0CA 1RUI1 1EV11 1JYCA 2L0ZA 1UL9A 4B7KA 2EALA 2R0HA 3U07A 3ZXFA 1LGBA 1OI6A 1OWBA 4JADA 2OUJA 1UAIA 3G7DA 4C1XA 2FQPA 4JGYB 4TPUA 2K9ZA 4EN6B 5GAGc 4HN0A 2HEWF 1BQ9A 1IS5A 4AVCA 4GB31 1ND2A 3VKNA 1RUD3 1RUJ1 1VBB1 3CF6E 2GH8A 1N3QA 4S2HA 3L9JT 4WZCA 4ATFA 1LOAA 2R30A 5ACA3 3PTYA 4FOYA 2GAUA 5GLZA 1AYM1 2JI3A 3KB5A 5A3LA 1SLBA 4KGGA 1RUE1 1V6JA 4BM8A 2ZGQA 4PDWA 4KG8A 3AMQA 2A73B 1YFUA 1PGW2 3OGJA 5BNOC 5I8TA 1ZVFA 3B08B 1LCLA 3PKIA 2VVEA 4FP3A 1MQTB 2GSYA 4K8FA 2I45A 4ASMB 1OA2A 1LOGA 1I5ZA 3ES1A 1H1IA 3VLBB 4YZ5A 1BRFA 1UIJA 5CU1A 5K0UC 1OHFA 2HWD2 3WVJA 2WL1A 2WQ4A 1POV1 3J8F3 3JUUA 5E88A 4YWMA 1WLDA 2Y0IA 4KL1A 2VL6A 5T5LA 1X7NA 1HW5A 1PZ9A 4ES8A 3IWZA 2BNMA 2WZR3 2HJIA 3ZFFB 4YLZA 4ORFA 4I0WB 3OD0A 7RXNA 4J1WA 5J37A 2ZS6B 4QPIC 3DN7A 2WS91 1SDWA 4XW3A 4GWMA 5JZGA 1PO21 2P17A 3OPZA 1IPKA 3AM2A 4RQPB 5AN9H 3KD4A 1D2SA 1RVF2 4IV1B 4QT6A 4JVAA 2DURA 3ATGA 5C4WB 1FX5A 1NE4A 1R093 1VAKA 4Y1XA 2D98A 4Z07A 4I01A 1ZBE2 5GAEc 2BGCA 4AEDB 4CDXB 5EINC 2R061 1DF0A 4LBQB 3ZSMA 5A3MA 2XL7A 1DG6A 3LA7A 2E7TA 3WDYA 4H7LA 2HWB1 1PGSA 1FATA 3HBZA 3ZXEA 1ZZ9A 4QPYA 1PVC1 2UYAA 2QFEA 5BNPC 3QBQA 1WD4A 2G9FA 1RJ7A 4XTPA 4COUA 1IPJA 3USUA 1MS8A 2R071 1AR81 4JDNA 4AXOA 3QH6A 4NHMA 2PHXA 3HAGA 2PHDA 4QPGC 3OF1A 2JG8C 1ZZ8A 4DQAA 4Q8LA 3NAPA 3NWKA 1VBD1 2HWF3 4CTEA 2Z2SB 2XJSA 1VP6A 1AL23 2PHWA 1PHMA 2CV6A 1XNDA 1WLTA 3FLPA 3RMXA 2D43A 3IT8A 1H30A 2AUYA 2BYVE 3IM0A 1NQJA 2XVLA 3EO6A 3VKFC 4IEXA 2LCQA 1ND3A 1V70A 1BEV2 1R1ZA 3BB6A 1ALYA 3PVBB 1ZX5A 4RS5A 5AI2A 1RUH1 4YVSA 3S7IA 2GALA 3PWFA 1RMU3 2WKKA 1AR61 2AZ5A 1YUDA 2YC0A 3SCFA 4Q4X2 1NLSA 2GC3A 5FPXA 3Q9OA 4MVTA 3ZFGC 1A8DA 2OVUA 4S2FA 1FPN1 4N9IA 3QCWA 1I9RA 5IK7A 4RA0A 1AVBA 4M3CA 3H50A 5DG2A 4KH9A 4MX3A 1O3RA 4GQ7A 4FTEA 1U5IA 2ZGSA 1QJX3 1QXRA 1F31A 4JGYA 4U36A 5ABJB 2R6QA 1HV0A 1WCDJ 2Q1ZB 2R1DA 3AFKA 5JIAA 2VW2A 1EAH2 2R043 4L99A 4FOVA 1KFUL 1BE7A 5BUVA 4NHLA 4H14A 1MR5A 2MNGA 2ATFA 2RR13 4FPKA 1ZRRA 5JIUA 4EWEA 1I3HA 1EPZA 5EIOC 1RJ8A 1GQGA 1W6QA 3AMPA 2Z3QB 2A71A 4WBBA 3CJIC 3V64A 4D3WA 4DPNA 5CB7A 5BYNA 4R9AA 3VZOA 3JD71 4AHWA 2HWE1 3GHMA 3TWIA 4PDWC 1VJ2A 3VDDC 3O7OA 4OZXA 2RS52 1YIPA 4OULA 5DUXA 5H9SA 1TNRA 2A7AA 3N3HA 4OLLA 1MQTA 3GHNA 5JAXA 2PLV1 4GH4C 4HFSA 4M3CE 2RJLA 1ZRCA 4JAEA 4LUMA 3WV6A 2DFBA 1N47A 4ATEA 2NZ9A 1AHSA 3WG2A 3FC0A 5C33A 1SBEA 4FPYA 3WHUA 1CADA 1XYOA 1O4TA 4AR5A 4W6WA 3RPQA 2M4YA 1LEDA 2ET7A 3WQ1A 3D8CA 2D3SA 1OOPC 1GICA 3O5SA 1DIWA 1COV2 2NP0A 1IU5A 2RMU3 2BNOA 2JG9B 2RJKA 1H8TB 3NV2A 1ZA4A 4P9LA 1YO8A 2ERSA 1PK6B 1PO13 4R8HA 5JI7A 4RQPA 1G9FA 3P2AA 4DZGA 3HQXA 2IFWA 3EJKA 4BCUA 4MYEA 5EXOA 3POSA 3MPSA 1UX6A 4LE3A 4IV1A 5IK8A 5LRRA 1RUG1 5CADA 4SLIA 3AP7A 3HWJA 5C4WA 1J58A 1QXPA 4PQ9A 4GXLA 1UU6A 5GZGA 4CDXA 4AEDA 2IXHA 5L7OC 2C6AA 4LBQA 2YXSA 2BBVA 4UBHA 3RYGA 2ZTNA 1R0IA 2E63A 2CAUA 3PIP1 2JE7A 4P9XA 4CZSA 2B46X 2XJQA 1H9WA 2D3PA 1NXEA 1ODHA 4RSUA 1AR73 5J3UA 2WA3A 1X8EA 5DDJ2 3WDTA 5BNOB 3CU7A 4Q0VA 3MIHA 5J36A 4YZ1A 2QUOA 1R083 5DM61 1BEV3 1YRZA 3WP6A 3ZMNA 4NR1A 4AE2A 2QZ3A 1HX6A 5GZCA 1ENSA 1UZZA 4AQSA 4DOUA 1YNAA 1MVQA 4C0BA 4LR4A 4CEWA 2A6XA 2JD4A 4NPRA 5K0UB 3NAPC 1D0GA 1B35B 3AJYA 4XTMA 4K1YA 1LOEA 3USSA 4K3UA 1NCRC 2RS33 1ENXA 4R4XA 4HSJA 2ZZJA 4QGNA 1PGW1 3A44A 1Z78A 5KHHA 1A78A 4WVZA 2IXLA 4QPIB 1ZZCA 3WDUA 4YARA 2WLPA 1VBE1 4FPEA 4Q27A 1HQWA 4RS5C 1J1LA 4XF9A 4Q0SA 1OPMA 4YVSC 4JRLA 1RUC1 4DB5A 1JOJA 4AQTA 1RIRA 2Q4SA 1CGPA 1REEA 1ULFA 1VBB2 1E57A 4AFAA 1F5FA 1V9U3 2HWD1 2XWBB 3N35A 1YFXA 4I02A 3EHKA 3ETQA 1ENQA 1LTLA 3AJZA 3H3UA 4N90A 3BODA 3QVDA 2ZX4A 1ZRDA 3KYWA 1B2OA 3MDPA 4CP1A 1X8MA 1QDCA 4MV2A 4L2NA 1B09A 4FAGA 4IEOA 2DF7A 5JSPA 1DGRN 3OYWB 1APNA 1FMD3 4OHYA 5ABJA 3R4DB 4BWOA 4RD7A 5KXDA 4Y26A 1RUF2 2K0GA 1RUOA 4KWKA 5T5OA 1KRIA 3TBDA 5F1RA 1RVF1 4AVBA 3R05A 4HMZA 3MIEA 4HVRA 4Z1VA 2JE9A 3ZFEB 1ZBE1 1HIXA 4HT1T 5IUQA 2WFF3 2W08A 2ZGTA 4FCAA 4QPGB 4LHNA 2CKCA 1D4M1 2JG8B 3AX4A 2VMIA 4N7IA 5A32B 1GYKA 2RHPA 1LECA 4POGA 1N1VA 1OQ1A 1V6LA 2UWCA 3KCXA 1MQTC 2DVGA 3LPEB 1LB2A 2YY1A 4QQOA 1YHFA 1Y9QA 4U671 5KHJA 2WT2A 4IEYA 2CNAA 4K1ZA 3UJQA 3IN9A 3D6EA 1LKNA 1TME1 2VMHA 3DF0A 3MW4A 4I0AA 3X29B 4ES9A 2DU1A 2C1FA 2XLGA 5FREA 4XMAA 3AYEA 3CL1A 4YGDA 1WMFA 4J6GA 2R16A 1GZWB 1RUNA 4H55A 1OFSA 1SACA 3RS6A 3UK9A 4MUVA 4E6YA 1MS3A 1AR92 2EIGA 3ZFGB 1N1TA 1MS9A 1KFXL 1X33A 3IDCB 1YUZA 3QH7A 2JG9A 2TUNA 1M4WA 1H8TA 1UU5A 1W6NB 2HWB2 2P34A 2V5YA 4GS7D 1DZTA 1PK6A 4X6RB 1IGOA 2CGPA 2JI2A 4DFSA 1PVC2 2YROA 3LNLA 4N43C 1DGWA 1LODA 4UXAA 2VVFA 1O4ZA 3T1MA 3AKQA 1YV1A 1HXS2 4OHWA 1SCRA 5C4WC 2BE5D 2PYAA 2R072 1VAVA 5FRAA 4GIQA 1BYHA 2CWSA 4CDXC 3WX5A 2VH9A 4KU8A 4AEDC 2A6ED 1LTEA 1YXWA 1QJU3 4Q4X1 5GZEA 1QJY1 2JECA 4E4ZA 1SMWA 3INAA 2V09A 4KWLA 3CJIB 4LBJA 3TAYA 4RGGA 5BNOA 1YK5A 3VDDB 1RUI3 2XH6A 1EV13 3M3OA 2QDRA 4LEJA 4YGBA 5GLUA 1J3QA 1H1AA 5H1Sc 2BNNA 3ZVXA 2BWCA 2NMOA 4E2GA 2W68A 1EAH1 1YCIA 1C5IA 1BKZA 4GH4B 3NJZA 4MSVA 5E1RA 5FO8B 2M6OA 1DQ1A 5BNNC 2A3YA 1RUH2 3FZ3A 3RZTA 2O0OA 4GB33 1LENA 1K5MA 1PM7A 1U12A 1RUJ3 1VBB3 1OMIA 4CEWC 4YSFA 5JI9A 2C0ZA 2PAKA 1B35A 5FOJB 1AYM3 1SBFA 1FPN2 4RGAA 4FXGB 5LEJA 1RUE3 3NO8A 2YPJA 2RS51 1XU2A 1OOPB 1Y3TA 1X50A 1OLRA 4MGIE 4P9WA 4Y5Z0 2CKAA 3JQWA 4XJZA 4QPIA 2DUPA 2IC1A 3J7Z1 3NVCA 3H9AA 4XYXA 3WWLA 1TE1B 4LA2A 5K2ME 3C3VA 4LO5B 4L92A 1QU0A 3VGIA 5BY5A 2V73A 2MPFA 4QQPA 4EN7B 4FPGA 1ULGA 5L7OB 1CAXB 1POV3 4B8EA 3U10A 3JD72 2CGNA 1LGNA 1COV1 2ZJCA 3OYWA 1TNFA 2EXJA 2SLIA 3RG0A 1ULEA 4HVOA 5GZFA 4RHV2 4JAGA 2PLV2 4BE3A 2WS93 4F8AA 4YNIA 1H2NA 2B39A 1PO23 1XXNA 4E4DX 4GMP0 2A68D 3ZFEA 3QQCE 3A0NA 1ASJ2 1MZ6A 5KBFA 4P9GA 3PHMA 1HLCA 4DS0A 1DFQA 4QPGA 4WM8C 1UKRA 3UJOA 4LO8A 2JG8A 2AR6A 1DLLA 4ASLA 2BPA2 1H9PA 2R063 5FBZA 3RI8A 3WUDA 3ES4A 4M0HA 2V0FA 3FFZA 2XLAA 2ETEA 3KT1A 4IL7A 3U11A 3UKNA 5A32A 1VAMA 2HWB3 2ZABA 4IEQA 1NCRB 4COYA 4HN1A 3AMHA 1U5XA 1EP0A 3NV4A 5DDJ1 5LEKA 1PVC3 4M00A 2VOKA 1BBT2 2RS12 1GZCA 2QDNA 1RITA 3RQ0A 3ILNA 3LGRA 1GZWA 4N53C 2R073 1AR83 4YVSB 3SNMA 3JU9A 3IU3I 4B4QA 4HPKB 5EWSA 1QOSA 1QCVA 1S0BA 2DFCA 2X29A 5F5QA 2YHJA 2OZ6A 5GLTA 1VBD3 1W0OA 3ZFGA 1WJVA 1NE6A 2WFPA 1XE7A 4Q4Y2 1W6NA 3ZYJB 3JB4C 2QQPA 4V196 1H8TC 1UW8A 4RR3C 2NMNA 1O3TA 2B7YA 1OQEA 4COZA 1S2ZA 3JQXA 1PK6C 5FMOS 4AK3A 5FO7B 3IDEA 3NV1A 4H3WA 5EZWA 3THTA 1FI2A 3ZYPA 4UW5A