2XJVA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae with mutation d201t in complex with calcium and glucose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPTNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 60
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjvA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjvA01
2XJQA 2XJRA 4CP2A 4AHZA 4CP0A 4GQ7A 5A3LA 4ASLA 4COWA 4COZA 4AHYA 4LHNA 4COUA 4AI0A 4LHKA 4AFBA 2XJVA 2XJSA 4AI2A 4AHWA 2XJPA 4AHXA 4AI3A 4COVA 4COYA 4AF9A 4AI1A 5A3MA 4AFAA 4D3WA 4LHLA 4CP1A 4AFCA 2XJUA 2XJTA 4A3XA
chains in the Genus database with same CATH superfamily
2WNEA 1VR3A 3EXUA 1Y9GA 2QNKA 1JYWA 1W6QB 2FBEA 5FZDA 4HBNA 4SLIA 4M3CF 4A7YA 1IU6A 3LFMA 2VG9A 3VBSC 1W06A 2HR5A 5M5YL 1QEXA 3GF6A 3T3YA 1E5IA 2BWCA 5EHDA 2HYKA 1LTLA 2JDNA 8RXNA 4GWIA 5C5TA 1VBC1 5FAXA 1MPXA 3R05A 4NRMA 4AHXA 4BQ2A 3OUJA 2DBIA 1DG6A 4AR4A 2A73B 1AR63 4CCNA 4LKEA 4DRRA 5FOBB 2VBDA 2K0GA 3ZYBA 3N7JA 3S15L 5BNQA 4WVVA 1SMWA 1LU2A 4FXGB 4HMZA 4Q4X1 2DBNA 1VZHA 4H3WA 1LHVA 1WWYA 4Q2FA 4R52A 1QDOA 2HJIA 2VVDA 1ZBE2 3H1YA 1EAH2 1ULDA 3A21A 4GALA 1VBE3 2ERFA 1V0AA 4X6RB 1RUD3 3WP3A 5EWSA 1G86A 1QY4A 1FHHA 3OF1A 4RHV1 3S5QA 4AEDC 4E8CA 2PYAA 2WAQP 4HK8A 3U07A 5FQ0A 2A3WA 4Y20A 3AP4A 3Q8AA 2BOIA 2VZRA 2VMDA 3K48A 4LE4A 4WM7A 3WNOA 4XF9A 2WQ8A 2C9AA 1KJRA 1EV12 1S0GA 3EB7A 5C4WA 5DZEA 2JD4A 5FLJA 2Y0SP 1Q43A 1XYNA 4CCDA 1BVP1 3FC0A 2BTVC 1SLAA 5LY2A 5C44L 3GJBA 1W03A 4ITCA 3POBA 3FZ3A 3VBFA 5FZ8A 3MV01 3J9SA 2JG9A 2RM21 4JDMA 2XKPA 3ZG6A 3N36A 1QJY2 5A3TA 1QXJA 1SG3A 3OUIA 4XMIA 3KV9A 3TNPB 4Y4RA 4W6WA 3KVAA 3H50A 4YGEA 5ABJB 2IXHA 4AHWA 1I6XA 4MZUA 5A6QA 1SFPA 2ZGRA 3A0KA 2QZ2A 3KF3A 1PZ8A 1OLMA 1CAWA 1YHFA 5FPVA 1DYPA 2XUMA 4AEDA 1JI6A 3VZMA 3KQRA 1IPJA 2DU0A 5I8YA 2KKDA 3GTLL 1YQ6A 4UW3A 5I0TA 4CDXC 1RUI1 3NNGA 3WHUA 4XOGA 1DQ0A 4R4ZA 2RS33 3A44A 2RDQA 3BUCA 5CB7A 5IVYA 1C1LA 1UU5A 4JKKA 2QBXA 1YK4A 4M4RA 5FZCA 4N53B 5LATA 4AR3A 1VBD2 1LU1A 2W1UA 2RDVA 2XHNA 1S55A 1XE8A 1KQRA 4DEQA 4W6YA 2XJVA 5H1Sc 2GSYA 2R1DA 3EBRA 3LPFA 2IVIB 3GTKL 4GWJA 1XQNA 3R4UA 5GLZA 1CZTA 1YC61 2WZR3 2UWBA 4XUNA 4WVMB 5FMDA 4KU8A 1OWCA 3PL0A 4OHZA 4K3UA 1RUJ3 2JDPA 2VOWA 1JOBA 2X29A 1W6PA 2ARCA 2VZPA 3U4SA 3LOBA 1MZFA 2ADEA 4ZKTB 3I3DA 3ZFEA 4GB33 2ZX2A 4BCUA 1VE0A 1VAKA 2WNUA 1W6OA 1W05A 5CKNA 4JGYB 4CDXA 1DGWX 2BNOA 3L2YA 1PZXA 5JOWA 2ZX4A 5A7NA 4QM9A 4UFIA 3ZXGA 2JI2A 2PFWA 3AZVA 3PIJA 2GN7A 1Y7BA 3AB0A 4HG6B 5FCCA 3DKQA 4K20A 2ZKLA 5DDJ1 1NCRB 4YVWC 1GICA 4E2QA 2WB1P 4JGZA 5CG9A 2G9FA 3I3BA 4IERA 3RG0A 4E6YA 1WW7A 2RS52 3H7JA 3HEIA 1PGL1 5K8SA 2XVGA 4QPYA 1O91A 2XH6A 1WD3A 4TN7A 2IXJA 4WVWA 5A7OA 3M70A 4IEYA 2XWJB 4ZS2A 2NLRA 1YI9A 4LO7A 3P2AA 1PO11 2TBVA 4YPJA 1SCRA 2E26A 4CDUC 2WNVB 4QQPA 2VZVA 4K8FA 1HRV1 2D7FA 3H3LA 4YGDA 1U5XA 1EYBA 1ZZCA 1RJ8A 3I2IA 4COZA 2MPFA 3OEBA 3GDBA 5GZGA 1N1TA 2JA7L 3P1IA 1WMEA 3M3OA 5CFCC 2AEYA 2ZAHA 4V1PA 2WFPA 3PTRB 2YGLA 1T6BX 3LCPA 3SEEA 4JC1A 4AYUA 4HXCA 2R041 3CJIA 1AYM3 2VMIA 2WQZC 4S2DA 5A3MA 1SFNA 1WCDJ 3PVBB 5GJ6A 3M8LA 4JRAA 1V6KA 5BNOB 4QPGB 5L7OA 2HWD1 2QUOA 2W91A 2JXAA 3FBMA 4LBQB 5KBFA 1G8WA 1OLME 3I49A 1XOYA 3J8F2 1MS1A 4FP3A 3VBRC 1LKOA 1HB4A 2ENRA 4OUEA 1H2LA 4QHZA 3NKGA 3OOXA 4XJWA 4IGPA 4PIYA 1WCQA 5HCHA 3OG2A 3LDKA 1RDGA 2P34A 3DV8A 4NAOA 4NN0A 1ENRA 5JUVA 1K5MB 3RZJA 2Y8KA 5AI3A 2AACA 2R063 3WZ1A 1UN1A 1RMU1 1V9U3 1YFWA 3DXTA 4QU2A 4IL7A 2KR2A 1TE1B 1VRH1 2VAUA 2Y26A 3GCXA 3BU0A 3F2ZA 4Y1XA 3AKQA 4IEQA 3POSA 3W21A 4NIIA 1D0GA 4A3ML 1LGNA 3JD71 3WF4A 1FNYA 1YYNA 4CYDA 5CFCA 1XNDA 2UY8A 4I0AA 4JTOA 1MZ5A 1W6QA 2ZA9A 3S30A 2I45A 2AENA 5IK8A 2I2SA 2J1RA 2EF6A 3M2MA 1PZ9A 2O0OA 4YZ4A 2HWF2 2W1WA 3ZSEA 1DP0A 2VJXA 3M3YL 4XIOA 1ASJ1 4JRLA 4NOTA 3WUDA 5FYZA 1MVEA 3AXEA 5F5AA 4XFCA 1LNSA 5FZ3A 5IVEA 3INAA 3VZNA 3KT7A 5KWRA 2XJSA 2RV9A 1SFOL 4F83A 4YW4A 4YM0A 4QPWA 4AVCA 3KT1A 1GR3A 4E4ZA 5A3NA 5IT6A 4QGLA 4W50A 4MGZE 4AI9A 3X29B 1PHMA 2GNDA 2ZHNA 5LB6A 3WSOA 4V196 3FMGA 3NKTA 4LQRA 2FD8A 3V0AB 4OQ8A 5F3GA 3U78A 3I2OA 4OUMA 4UY81 2XL7A 1POV3 2XL9A 5FYSA 1W8HA 3THPA 5ABJC 3O1PA 4MG2A 4UFLA 1OVPA 3RS6A 3POIA 2B39A 3AZZA 1UZ0A 2VTFA 2FDIA 1R64A 1ZRIA 3FE5A 1BEV1 5F39A 5BYNA 3H9AA 4Y24A 5IW0A 3T08A 5IAXA 5FMOS 5K9YA 4C90A 2JI3A 4YFZA 1SLCA 2XUEA 4Y3OA 3DEMA 3ETPA 5A7WA 3CZJA 3MV11 2XBO2 1C4RA 1Z7S1 2XQRA 4UF0A 3A23A 5A3PA 1K83L 3ALQA 3LEKA 5LRSA 1OA3A 4FPLA 1QIQA 2ZGLA 5F5IA 3OEAA 3GTML 3ZYPA 3S2DL 5FKBA 1LB2A 3DPRB 4CCLA 2ZOEB 1PGW1 1MEC3 1RTVA 4MYEA 2PAEA 4N53C 4XZUG 3J7NA 3WP6A 3T0DA 2PSMC 5FBJA 3MPSA 2A3YA 2D6PA 5CYYA 2MEV2 4L11A 2YU9L 3TOJA 1DGWA 3IAQA 4ISRA 3GZUC 4ES9A 3AZYA 5JVG1 1UOFA 4I09A 1S4CA 1X9PA 5ABJA 2I07B 2VTXJ 2PVXA 1W8NA 1OQDA 4WM8B 2CGNA 4Q8LA 2DTYA 1U12A 3FHAA 2E2JL 4FFHA 1PVC3 1WLDA 2WZ8A 5AC93 5CVRA 1O3TA 3BKZA 3IT8A 1LHWA 1O5LA 1OQEA 1WLTA 4LK7A 5E16A 5B4XA 4EZ4A 1RUNA 4G9SB 2WBKA 3H9CA 4JGYC 2QQIA 3D0SA 2OZ6A 4B29A 3AP9A 3HNBM 3UGHA 1X8EA 3RMYA 5LBCA 1AXZA 4RHV2 2E2IL 3S1ML 5JXJA 4KG0A 3PO2L 1PMJX 4BBSL 5F32A 3SC7X 5KR7A 4AYBP 4PCRA 3RFRA 5C3OA 4N53A 5HXMA 2GMMA 2JE7A 4PBPA 5LRRA 3CDZB 1M4WA 2IXKA 1OLRA 1S2BA 2TEPA 2BZDA 3ON7A 1C8M3 4PDWA 4QQ2A 5G05L 1ND2B 1RUC3 2GMGA 3GBWA 1UY0A 3LDBA 4P9YA 4EYUA 4URAA 5HXVA 2R92L 2ES3A 3J7LA 4LO6B 2ID4A 4PLOA 1WMFA 4XUPA 1GP6A 1UIKA 1R1A2 4EZHA 2M6PA 2Z3RB 2RDSA 2WNVC 4BY1L 4IUGA 2HLEA 4M00A 2RM22 1COV3 4BE3A 3PU8A 1LTEA 2WO3A 5C7GA 4BH9A 1G9AA 2B42B 5IVVA 2Q30A 4NIHA 1UPSA 4HT1T 1QQP2 4IETA 2V73A 3WQ0A 2AYJA 2RMU3 3LPEB 1WZXA 4JGYA 3Q8BA 2FZ1A 1RVF3 2A5ZA 3NQHA 1W39A 4XCBA 1C09A 3T2TA 1KITA 2QDNA 5C6CA 3IBMA 3AVSA 3ZFFA 4QPGC 4EJRA 1J3QA 3DXUA 1VLNA 1NCRA 2WSVA 3WNXA 4OMCA 5EJZB 4OULA 1X50A 4FP2A 1JOJA 3O5SA 5KC5A 5IY0A 1ZYBA 2C6AA 1IKPA 1VZIA 3GNEA 1AR93 1SDDB 2VD7A 3NJZA 1F4LA 1FMD3 5JPMB 2DSXA 2DF7A 1UQXA 2WNVA 4K6BA 5F2WA 1US2A 1LULA 3BIWE 4Q29A 3RZOL 3KM5A 1ZREA 5FPXA 1AX2A 1L7LA 2ZMNA 2CU5A 2PAKA 1A78A 3VDDB 3WNLA 3RZZA 4NIDA 2RR13 2WINB 4A93L 5EJ3A 1KEXA 1WBFA 3EMRA 3GGLA 1AX1A 3C7EA 4MH0E 2QQPA 4A3JL 1IPSA 3FFZA 4XAEA 1VBE1 3P8BA 3M3EA 5DUWA 5AVAA 3BPSA 1AYN2 4QQOA 3FKIL 4ASMB 5LA0A 1RUD1 3LD8A 5ERLA 3VBOB 3L2HA 3WQBA 4IQPA 5BNOA 4O65A 4LBQA 3H8RA 3WDYA 1OLQA 4AI1A 3JBG3 1VALA 4C3JL 5E8AA 1Q8PA 4X8PA 4JAGA 1FNZA 1ULGA 2E9QA 3VHNA 4OHWA 3WD5A 4UFHA 1AR73 1DGLA 3HJRA 4JHZA 4RYDA 3S2HL 1DQ2A 1B2JA 1SMVA 1YNAA 2F4PA 2QCSB 5A80A 1MQTB 3W58A 4EN8B 3VZJA 1RUH2 2VL4A 1W6NB 1W9SA 3FX3A 4CCOA 4D69A 3RQ0A 4NRQA 1AUYA 1K5MA 1SLLA 2CGPA 2A7AA 4P08A 3MIGA 3LB9A 3MUZ1 1GV9A 4PBOA 5FZOA 4QB6A 1AL22 4Y52L 1B35B 2A6VA 4LBQD 3E5XA 3B02A 2X5IC 4L92A 1F2NA 1A34A 5E1RA 2HYXA 4LOTA 3THDA 3VKLA 1AR83 1F5FA 1PO12 1ZNPA 3MW2A 4ZONA 2GU9A 5D1IA 4BK5A 3MO4A 4CDWB 2ZEWA 5LBBA 2UWCA 1HQNA 1HRV2 3VV1A 2BGCA 2XG3A 1ZA7A 1D4M1 2WLPA 2ZGPA 3MIEA 4NJ4A 3SHRA 3T4VA 2WSUA 1PFVA 2BNNA 2GNTA 1CJDA 1N1YA 1UF2C 1VMHA 1RHI3 3CLPA 3IDBB 5LW9A 3DYOA 1WCSA 2J1AA 4N9IA 2ZABA 5FYTA 1UOBA 5F5CA 3GHMA 2Y34A 3GXUA 5BNPB 4QAWA 4GMP0 1BBT3 2DUQA 4DFSA 2WL1A 2J1EA 4DNYA 4KBZA 5ISLA 5I8SA 2OXBA 3NAPB 4AW7A 1ZX5A 5FR3A 2RS31 3ACFA 1M06G 4YM3A 1SDWA 2HWD2 5KHHA 4EN7B 1DZRA 3BU7A 2LCQA 1X8MA 4Q4V2 3VBUB 4COUA 2RFKB 4YLZA 2WJSA 1LKNA 4LA2A 5FO7B 4OHYA 2VPVA 4DEVA 1YXWA 1MS4A 2JA5L 2HEVF 1CZSA 1URXA 3H1MA 2ZEZA 4QX7A 3C7GA 4Z2WA 3WR0A 3ZXDA 4YW1A 4WM8C 4IESA 2FMDA 4K9SA 1I3HA 1O5UA 3UETA 1RC6A 1RMU2 1FPN3 3K3OA 1PFWA 1RUJ1 1VRH2 1TNFA 4UXAA 4POFA 4LULA 2BE5D 1TME2 2WYFA 4RL7A 3MPBA 4Y26A 1PO23 4XE9A 4UW6A 2ZMLA 2O8QA 3B0AB 1GMMA 1YCIA 3H0OA 4GB31 4MXVA 2VMCA 3HBZA 3VZOA 4D0QA 2YBPA 3ZR5A 4LIVA 1WA6X 2RJLA 1NNQA 1DZTA 3DPRA 4FOVA 4JVAA 3KVBA 2CHHA 1ONAA 4Q8KA 4LPLA 2QL0A 4IE4A 4IE7A 1ND2C 1PNFA 3RWKX 3GM8A 2ZPXA 2M4VA 1LRHA 5C8WA 1IRNA 2VUDA 1C5HA 3NNJA 1FV3A 4A7ZA 2ZMKA 3ZIXA 2OQ6A 3NW4A 6RXNA 3MUY1 1LENA 5FY5A 3VLBB 2XJUA 1AVBA 2FDJA 2SBAA 3EHKA 4U2AA 4DZGA 1WGPA 4KQ7A 3UT0A 4CP0A 3AMNA 5FK8A 3SITA 3ZKYA 1NYWA 3OGSA 4MXWB 1MS8A 1SMUA 1EPWA 1NQDA 3N9PA 3E6BA 3PIO1 3EYPA 5EPAA 5A7QA 3ZXFA 4B3NA 2BV4A 3OGVA 4NIAA 2HWE3 4FCAA 1TWFL 1W8ZA 2ZGUA 4XDPA 1QQTA 1N47A 4NMIA 5FLIA 3LF7A 2GC3A 3TEWA 1CADA 1BQ9A 5MLC3 4QKBA 1LESA 2VUAA 3WHTA 3H7YA 4NHXA 4OCTA 2FDGA 1GWLA 5EIOC 1VCXA 2A6XA 5FWEA 1KS4A 5BPXA 5JSPA 1AYM1 1WW4A 5FY1A 1QF3A 1YQCA 5CFDA 5C33A 2D6LX 2VUJA 4U36A 3SXWA 1XJAA 3WF3A 5CA6A 5CNAA 4DY5A 3IIIA 2JE9A 2A6ED 3PUIA 4GH4B 1W04A 3E97A 2Y0OA 3IDCB 4P9JA 3OSDA 5FO9B 2P6CA 4ZXEA 1HV1A 3ZXJA 1FOD1 2NVTL 1QDCA 1BK1A 2X53S 5FZMA 2OQ7A 3VDDC 4A2UA 2OZJA 1AX0A 1XNCA 3O0XA 4RFT0 2R061 4RS5C 4CEYB 4LBNA 1V9U1 1W8FA 2VZSA 4V2WA 4AF9A 3KLSA 3POWA 1CR7A 1N3QA 5C4JL 1DIWA 1WCKA 1JZ4A 1UY3A 5FZ6A 1DCSA 4XTMA 3VB9A 1ODMA 1VAVA 4B7KA 1REFA 4D7YA 2JKXA 3VBOC 5JDBA 4MGSA 4E2SA 2GAUA 3C7OA 4H7MA 3Q9OA 4HETA 1NXD1 3MI8A 5GLTA 1NLSA 5KC6A 3POJA 4Q4Y3 2B5ID 2NVQL 3NV2A 4OI2A 5E88A 1QKQA 1LHUA 5HCAA 1CAVA 1RYQA 1E8JA 5FYCA 3KHCA 3JXSA 3OPTA 4ZS3A 5FPZA 2WA3A 1X7NA 1MQTC 3VKMA 4OQ9A 2APOB 2YU2A 4S2HA 4A3EL 3SS2A 5T50A 4TXWA 4YW5A 2EA7A 1VBB3 4CCKA 5FRAA 2EIGA 1YUDA 1ULCA 5T5OA 2NM1A 4RQPB 3VDDA 5DZGA 2GDFA 2PLV3 1B35C 3KQ4B 4JAEA 2FQPA 1UMHA 1UWWA 3LZZA 2ADDA 4IV3B 4E8DA 4IEUA 3VBHC 2ERSA 1QMJA 2BFUS 4Y1YA 4CDWC 3I8TA 2PN5A 3MHZA 1CGPA 3NMBA 1DYOA 3OBAA 1OFNA 3UESA 2Y6KA 5F6LB 2KN9A 2WS92 5GM0A 1UNBA 4DQAA 1UYYA 1V6MA 3BI3A 3KCYA 3KD4A 1TWAL 3WINE 2RHPA 3ZXLA 2K46A 4BA6A 1CD3G 1R0JA 1RL3A 5BNPC 1F5JA 1H1MA 3S16L 5T52A 4XAAA 1WW6A 1O4ZA 5SV8A 2D3SA 2WAOA 3NAPC 1RXGA 3I3EA 3PUHA 1O59A 1S30A 1DVBA 3WW3A 1KFXL 3VBUC 4A42A 1GFF2 3HKZP 2XLFA 4M3CB 1T9PA 4Q0UA 4XW3A 3BTXA 3VPBE 2E2HL 1MEC1 1NZCA 2VGDA 3HMYA 3O0VA 4JTNA 5AVPA 3U4XA 1Z0HA 3WW4A 1H4HA 5EYYA 3K51A 5KXDA 2ZHMA 4OI4A 2HVYC 1IU5A 2ZHLA 3VZLA 1QJZA 1NLRA 3ACIA 3AZWA 3SH4A 2X09A 2NQYA 2VZOA 3DCQA 2JDKA 1UOJA 4KNCA 5MFZA 1RINA 2PXJA 3NRUA 1GP4A 4AI3A 2ETEA 4Y7NL 1Y4WA 3CMGA 2A71A 3MDPA 4GULA 4NO4A 3MQKB 4BY7L 1E5HA 1UZWA 2XOMA 3MF9A 2AREA 3WV6A 5BNPA 2E7TA 3BODA 3N35A 3KV5A 2EXHA 2JDMA 5A1LA 4YW3A 4XXBB 1EY2A 2QQNA 2HWB2 4NIGA 1W8OA 4MHUA 1R093 2Q8DA 2VZUA 4ARXA 3MPPG 4E4DX 4KWLA 3H42B 4QX5A 4OYUA 4CUCA 2JA8L 2JDAA 1CWPA 4UFMA 2JDHA 2IFRA 3JZVA 4GQ7A 5FYUA 3HVDA 4J1XA 1J3PA 3PUAA 2A1XA 3WG1A 1GP5A 4H7LA 4E2GA 3ENRA 1Y1WL 4AHYA 5L19A 3U0ZA 3RZMA 3JR7A 4X6AL 3MIHA 1R083 1C8M1 2QQLA 1RUC1 1FATA 5DPNA 2DCKA 2HWC3 2WZPP 2P3JA 2VBPA 3VBRB 1T2XA 1U5IA 4K8RB 2W94A 5HCBA 4A7KA 4TLGA 2E32A 2AUYA 4A3LL 2WAAA 3CEWA 3M1HA 2R0FA 4META 1BXHA 4NPRA 4O9GA 1JYVA 1JUHA 1QJU3 1RUG2 4OLLA 1ZBA3 2P5BA 3HN1A 3IPVB 2ZGMA 4NHKA 2BERA 1SBFA 2EAKA 2RMU1 2Z69A 1D4M2 2CDPA 3W5MA 5KHJA 1CIWA 1RVF1 2BP6A 1FX5A 4AWDA 5C8CB 5KXBA 2Z4FA 2XDVA 1QWRA 2VZQA 3MIBA 3OTFA 4IGQA 4TTGA 2OYZA 3VBSA 1DU3D 4BB3A 3S1RL 3D3AA 3WWLA 4GZ9A 4RN5A 4QPIC 4GH4C 4RGKA 4FI9A 3RJ2X 1OKQA 2JJ6A 3HN3A 4AQSA 1XPWA 4A3BL 3HOYL 5EIYB 3KB5A 4IE0A 3TEZA 1AR91 3GYDA 1W8UA 4K1ZA 2D5FA 2YFUA 3QCWA 5A32B 1FMD1 3C7FA 3PJQA 1JODA 1GNYA 1TMF2 3KT4A 1QYBA 2VW2A 2JICA 4I30A 2J22A 3FFQA 5F3IA 4G3YC 2ET1A 2C6BA 3MFAA 1ZRDA 4HSJA 3POFA 4JDOA 2DVAA 4PLNA 3WW2A 3O1SA 2RR11 3MEPA 1CQ9A 4FPYA 5FY8A 3CNAA 5FXWA 3HD8B 1PX3A 5DQ0A 5C5UA 4OI1A 2ZHKA 4Z2AA 3VD5A 3LKJA 4YWAA 4XJAA 2VMEA 4NR1A 1ZRRA 4N7IA 3S17L 4AI8A 5C3RA 3NV4A 2FDKA 2ZGNA 5A3UA 1NT0A 2ZXQA 3U37A 1BYHA 5K2ME 1QXRA 3E1F1 3BTAA 1UY2A 3JBG1 3WT3A 3VHOA 3O7OA 2OS2A 4PI2A 3OYWB 3ZLIA 1WLWA 3AKRA 3BALA 4Y1UA 1NAEA 3K77A 3OGRA 1TWHL 3CBNA 5H9SA 2EY4E 3OPWA 3WUCA 4RQPC 5JSRA 2YPDA 4IV3C 3T4HB 2GC1A 2BDRA 4IE6A 1ZBE3 2P4EA 5FZFA 1HJGA 3KYXA 3LOIA 2ZJCA 3H9BA 2D93A 3WCSA 4QHBA 2JDYA 4BXSV 1BKZA 3B9IA 3WDXA 4ZXKA 1PK6C 1UXXX 4N90A 2V72A 4Q26A 4YG3A 2ZEXA 1KD7A 3SLIA 4DS0A 1AR81 1R0FA 2ZTNA 3K4ZA 4AFAA 2R7ZL 2Z5WA 5MF6A 3VL8A 4L8QA 2R32A 5IUQA 2NP0A 2ET7A 2A3XA 1EV13 4LO4B 4XF4A 1RHI1 2VMFA 3I2DA 3ACHA 4FPGA 4H55A 1YLLA 4MGKE 5EYXA 3U1XA 5T55A 3I97A 5A7SA 1X36A 1W0OA 1RYYA 4ATFA 2CYFA 4IV1B 4LT5A 4CDQB 5I0DA 2R6QA 1BBT1 2JECA 1AYM2 3WX5A 5BV6A 1OA4A 1UZVA 2Y38A 2W3JA 3WNPA 3H3UA 5FDBA 3I7DA 3FUQA 1ZA4A 1QJY3 4B8EA 1EUTA 2A75A 2JIGA 4IV3A 5C4XL 2GN3A 1HLCA 1WCML 2Z3QB 1QXPA 1DGRN 4YZ5A 3MYXA 3HOZL 3OBRA 3B5LB 4BXFA 4LK6A 4BDVB 2NMOA 2C5DA 4QX8A 3OY8A 5GADc 1HRI2 4QXCA 4XUOA 1FOD2 3ZXKA 4L9BA 4N43B 4UBGA 1RXFA 1IHMA 1REEA 2EICA 2WYSA 1SHWB 2FCTA 3NNFA 4LLOA 4LKFA 4NWWA 1IW7D 1GYKA 3I2FA 2R1BA 1NOVA 4FOWA 2R062 5I0SA 1ULOA 1LR5A 4XJUA 1UY1A 4TVMA 1V9U2 3K35A 3LNLA 1FPN1 3ACGA 3AMPA 5DM71 3VGIA 4RGGA 2GH8A 5IAVA 4K7JA 4URTA 1PO21 4LHKA 2EIDA 4PJYA 1ZM1A 3OGJA 3IB3A 3NWKA 3WVJA 1NY71 2R072 2UURA 5CKQA 4ZPIA 5C70A 5IYCL 5JR2A 1VBD3 4IEZA 4YYOA 3LAGA 4AGGA 5IYYA 3HJWB 5GAGc 2DCYA 2YHJA 3BTYA 1XE0A 2VZ1A 3C2UA 1OUXA 1ACCA 3MW4A 2Q8OA 2R0HA 4FT8A 3K2OA 1KDKA 1RGSA 4YVWA 1AHSA 1VBA2 1W2UA 2VXJA 4JQRA 4C0HA 5JLVA 1GZTA 5M5WL 4UFJA 2ERJA 5F3CA 4AHZA 5RXNA 2RDNA 2JE8A 4AEMA 1UAIA 4MUVA 4Y5SA 2NMNA 5FOJB 5FPBA 2A6YA 2GALA 3J4UH 4CDUA 4EN6B 2L0ZA 3IMNA 1QH7A 5HBAA 3GZTB 2A6WA 4C3HL 5BUVA 2VZTA 3IDEA 2CR8A 2HWE1 2OPKA 4QXBA 3HAGA 1LOFC 4JDNA 4XQWA 2YC0A 3HOVL 5MGNA 5CZKA 1H2KA 3I2JA 1SACA 1QH6A 2DVBA 3LA7A 4LO5B 4LNVA 4CTEA 5C8CC 4HN1A 5EV7A 2V0EA 1GOGA 4IEWA 3BOWA 3TBDA 4BQ3A 4CP1A 3FHQA 2VE1A 1VJ2A 4FPOB 2VQUA 1B13A 1G9FA 2RS53 1OMIA 3PNAA 2R30A 5DAPA 3URFA 4IEOA 2VH9A 3OUHA 4DMIA 1TWGL 5LBEA 4NVPA 4BWOA 2VCMA 2X05A 3J7Z1 4LMFA 2K2DA 3JUUA 3RYGA 4AG4A 5AN9H 3IN9A 3KHBA 5FYIA 2E7AA 1ALYA 3DL3A 1O8PA 3VBRA 1UYXA 1ZZ7A 3AKSA 5ACA2 5F7UA 3KCXA 4FTSA 1W2NA 1HJFA 4A3FL 4BISA 5DXDA 5JZGC 1CAAA 2XR4A 3HOXL 3PDQA 2DUOA 4CP9B 3ZXEA 4CE8A 3I3MA 1UL9A 1K42A 4JZRA 3IPVA 5APAA 1DYKA 1LOFA 5A33B 2R49A 1IQDC 4OUSA 1GOHA 2YC4A 2OT7A 2X5IB 3A0NA 4Y22B 4AGVA 3S5AA 1J1TA 5C8CA 1GZCA 4P9IA 2PHTA 1YJLA 1SMMA 2A69D 3C7HA 5FY7A 5GLVA 2D6NA 1I6HL 1D0HA 1JYTA 5KHGA 2GMPA 4AGRA 1RB9A 3B93A 1QU0A 4COWA 4Q4Y1 1HIXA 2D6OX 4UYBA 3K75B 3DYPA 3U14A 2P37A 1W9WA 4HPKB 2VNRA 2AGSA 1AZDA 1Y9MA 4UOJA 2IXIA 1O4YA 1I50L 3H3VM 5I91A 4XCAA 4I0BA 4QX0A 2WUHA 1TZOA 2QQWA 3CKHA 4QX1A 5J1XA 1S0DA 4YWMA 2AUSB 3CO2A 3OJBA 2D43A 2LRPA 2WWUA 5FV3A 1VBB1 3RRDA 1C8M2 4LJHA 4AFCA 4M3CE 1PVXA 4XDOA 4LBOA 2ARAA 2PLV1 4Q0PA 1VBC2 4SBVA 5FY4A 3RMXA 3SEPA 5K4LA 4A3XA 2JIJA 1CPMA 4MADA 4I3GA 2GNBA 2D40A 1I5ZA 1UKRA 3EQEA 5DUVA 2XONA 5CISA 1GSLA 2B9UA 1ENXA 2DTWA 4FPHA 3ZYGA 3T1LA 3RJRA 3GTOL 3QH6A 4PIXA 5A7PA 3UL2A 2VC9A 4Q4X2 2PAMA 3GZAA 2DUPA 2OPWA 3HOBA 1C5IA 5M3ML 5IK5A 1V70A 4IV1C 4COYA 2H0BA 1S24A 1IGOA 4FAHA 1CX1A 3AYCA 1OF3A 4CDQC 5JI9A 4QMAA 1J3RA 3OYWA 5JI7A 4ZZ8A 4CEWB 1DQ5A 4XIKA 1V6LA 1RUF1 2GP5A 2OUHA 4D3WA 1BCXA 4LIUA 4M01A 3T30A 5JCTA 3KV4A 3VD9A 4GMP3 2O14A 4A3KL 2D6KA 4LOSA 2BWAA 2YZ4A 2EIEA 5JMCA 1GZ9A 3NV1A 4FFGA 5J3UA 4Z92B 3PIGA 2J9UB 1IS6A 3ZN4A 1W0NA 3ZSJA 1DFQA 2VULA 1AR92 5J37A 1RUE1 4HVRA 4N43C 1E57A 4JQTA 4P02B 1DZQA 5FJKA 4RGAA 1ZZBA 4WVMA 2VUCA 1ND3B 4BYYA 1PIV1 3AK0A 3HBKA 3MFCA 3U10A 1OC1A 2XBO3 3FLTA 2LUWA 4Q1RA 2RR12 2VW0A 1LGBA 3ECQA 2VBBA 3KMHA 1GOFA 2NVYL 1PGSA 2X8KA 1JYXA 3R6SA 1FV2A 2YDEA 3HQXA 2YY1A 4LXLA 4F7ZA 1SBDA 5KXCA 1NCQB 1H4GA 4P9LA 2PHWA 2QQJA 4QM8A 2BGOA 4Q5OA 1R091 1KRIA 3H3ZA 3B7MA 3D5OA 4E4SA 2MEV3 3RYPA 1H7VA 1XYOA 3ILNA 5FBZA 3THTA 2X10A 4KGGA 1WD4A 4BXXL 3UNPA 1JZ7A 2NZ9A 2P3YA 1UMIA 3QVDA 1XXNA 2NN8A 2QQMA 1RUI2 5I0UA 5JXHA 1BMV1 1HB3A 4C1XA 2E63A 3VKNA 1HKDA 1R081 3A22A 3O1OA 2ZGOA 4WZFA 5HCFA 5JMOA 2VVEA 2YU1A 5BY5A 2HWC1 4OHVA 2ZX3A 1APNA 2QQVA 5M5XL 1L7QA 1X33A 5FXZA 4D7TA 1IROA 1OOPB 2HBTA 3AJYA 4CVUA 4B7EA 1PFYA 5M3FL 1AR61 4ZHNA 2EXIA 1W28A 1WMXA 1V6NA 1V6OA 4OMDA 1NZIA 2CV6A 2Q0AA 4PF5A 1W0PA 1BZWA 2J1VA 3IAPA 4RS5B 1ZBA1 4HVQA 2OUJA 4RR3B 3FJSA 3BVCA 4JCKA 4KH9A 1OSGA 2SLIA 1JU3A 1Q8OA 4HONA 5DAWA 3LEMA 1STMA 1NXEA 3CHXA 2ARXA 4CXWA 2ARBA 2NPIA 1H8TB 2CSGA 2O1QA 4DIQA 5J7MA 1I9RA 3RDIA 4QPGA 1QNYA 4Y4YA 4F3JA 4J25A 1LJ7A 4CA9A 2ZGTA 4DXRA 1R1A3 3AC0A 2W2IA 4NHMA 2VMGA 3T2OA 5M0TA 1AF9A 2RJKA 1W2TA 1HB1A 3BN6A 2RM23 1VIWB 1UZYA 4O61A 2DVFA 2Q8CA 2WFF3 4CU9A 3BIEA 1BLZA 3O1TA 4O9EA 3JU9A 4XJZA 2VOTA 5DDJ2 2VOXA 1QQP3 3KV6A 4GA9A 1PMIA 3B08B 4ISQA 4CXXA 2C24A 4A3IL 4LUMA 2C26A 2O5JD 4A6OA 1PGL2 2CWMA 2AEZA 3RZDL 2WO2A 4BQYA 2RDRA 3BB6A 1L3JA 3MBWA 1HQWA 2KM2A 2PHRA 2PQQA 2JB8A 2UY9A 2VY0A 4JX0A 3V65A 1POQA 3AMMA 1H8VA 3B00A 1NX9A 1UW8A 2V5DA 3P5BA 3VBHB 4QB1A 1L7RA 2Y64A 1VPHA 3ZMOA 2DDUA 1XBFA 3GBFA 2B63L 4NAMA 3W59A 1B71A 4CU7A 1IS4A 1UU4A 1QJX3 2MNGA 5FLML 4BHPA 1UD1A 2KXLA 1A6CA 3L9JT 3ZSMA 5FP7A 3ZIWA 3VKFC 2O8OA 2BUKA 2QZ3A 2KA3A 4XBLA 3U75A 5BXXA 1NY72 3ZN6B 1H1IA 3WNNA 1P7PA 2C1FA 2ZEYA 3G7DA 3HIFA 3FLRA 3OBTA 4LITA 3TN93 5JOYA 4FTBA 2W5FA 3VHPA 2R042 3QQCE 2P2KA 3S7IA 2VOKA 1YEWA 2QE3A 2VW1A 3K4DA 1BVVA 2Q1ZB 3C8XA 1ZRPA 2WDBA 3QH7A 5FZ7A 4CP9A 2OIIA 1QOOA 3QLQA 4I01A 4S2GA 5DABA 1ZBE1 1XE7A 3M4FA 4W8JA 3VN4A 1YQ8A 2DCZA 4UFKA 5F3EA 1I1EA 3HWJA 2IXLA 2FCVA 1AYN3 4NUBA 4AEKA 4WVZA 3AM2A 2EVXA 2BVVA 2X5IA 3I3QA 4Y22A 3BOPA 4FO9A 3ST7A 2VQ0A 3TNQA 3J26N 4UWDA 3PL5A 1NLQA 3KF5A 2WZR1 4KWJA 1J83A 1V00A 5FZ9A 3EO6A 2HWE2 4JKLA 3S0MA 1A8MA 3O1MA 2C4XA 1LOGA 2FCUA 1CPNA 1H9WA 3AXDA 1EV11 4GIQA 5FK7A 4Y1VA 4CEWC 3JD72 1VAMA 4Q1PA 1RUH3 4XZPA 5TSWA 5FZBA 3B01A 4BJ0A 1EUUA 5K0UC 3WG2A 1YRZA 3HQUA 3KS7A 3PMEA 4LBLA 4W6XA 3CQZL 1HN1A 2F6BA 3IIAA 3ITQA 1H0BA 1PZ7A 2W08A 1GU3A 4MOAA 4XHXA 1AL23 2G1MA 5EJ1B 1W2AX 2ZIXA 4CUAA 3O1VA 2YUEA 4OFGA 4AVAA 1PX4A 1QJY1 1SBEA 1W9TA 5LA9A 4MVTA 2J1TA 1ASJ2 2B9VA 2P17A 2YYOA 3O14A 4IGOA 4WZCA 3AYAA 4E4HA 1MZEA 5T54A 1HRV3 2CL2A 1UPIA 4AVVA 3D0JA 2XJTA 1ND3C 1W3VA 3U11A 5GLWA 3Q8FA 4WM8A 2WO7A 4XF1A 3HAXC 3ZKUA 3I59B 3HPNA 1UX7A 3ASIA 4P5HA 4ZY9A 4Q0VA 4AI0A 2D44A 4QX2A 4AVSA 2GH2A 1R9TL 4R4XA 1S0FA 2VR4A 4IEPA 1NCQC 1UYZA 5IK4A 2HWD3 4GAZA 2UYBA 3RNSA 3T0AA 3TYJA 4Q4V3 5FQ0B 5FYBA 3LWVB 4Q0QA 1KJLA 3KZ4C 3V0BB 1BEV2 2DCJA 5JWPA 2QQOA 1SLTA 4MHRA 5FZLA 5HPOA 4DOUA 3EJKA 1VBD1 4B1MA 4ZU7A 3HT1A 2G19A 1T9OA 5FZAA 5C4WB 2ZX0A 1Q8SA 2WN2A 4C0BA 3J7MA 1Z7S2 1O7FA 1JZ2A 1ND2A 4K21A 5FXXA 1N1SA 3PUSA 5KHKA 4ZN1B 1C57A 1QOSA 3I4ML 1R1ZA 3D82A 1FI2A 2IC1A 3I2HA 4QPIB 4J1WA 1WCUA 4B1LA 5C3PA 1PGW2 1ND3A 1SFYA 1VRH3 1OOPC 2C6SA 4KG8A 3VBFB 5FO8B 2JG9B 2VNOA 5LY1A 1TME3 1JHJA 3S1NL 4JADA 3H8XA 1K3IA 1OQ1A 1NA1B 3I54A 1IZ3A 4R9CA 5IHRA 4YARA 4CXYA 1OWBA 3WDUA 4EROA 2TNFA 1TWCL 2BYVE 4RR3C 1ZZ6A 2RJ2A 3DECA 1WUVA 4GWNA 4BQ5A 4BMEA 2RS13 3PWFA 2WNOA 5DMYA 5A1FA 1H8TC 3B94A 3RZ6A 4AFDA 3HR9A 1WLCA 3DKWA 3MF6A 1HXS3 2BU9A 1B09A 2YPJA 3N9LA 2EAAA 1I5PA 3ZDSA 2Z2SB 2RS51 3WF1A 3WLUA 1Q5OA 3A7QA 1J58A 2A68D 4LA3A 1RUF2 3LDRA 4NWVA 1GQPA 3WEZA 2VU9A 4EQVA 1F4AA 3ZXAC 4R9DA 5A3OA 3S14L 4Y5TA 2VM9A 2CKCA 3I4IA 3CJXA 4XEZA 4UBHA 3ZSKA 3KCCA 5KHIA 3GTQL 1YFXA 1RWDA 2GMEA 1KXGA 4YVSC 2H12A 5DG2A 1LEMA 1RUE2 1W90A 1YIPA 1GWKA 4XGHA 4IXLA 5J36A 2LS6A 4RS5A 1O4TA 4FXKB 4I02A 1W6PB 1HW5A 1PIV2 2R16A 2QJVA 4YM2A 1PK6B 5IATA 2VCBA 1POV1 2WIIB 5FY9A 3ZFEB 3S1QL 1LHNA 2WNUB 3O0WA 4YWLA 1BJQA 3VBOA 4XDQA 1OH3A 1YUXA 2DU1A 1Q8QA 2VUML 4XUQA 5FZ4A 5L9RA 3QBQA 4YM1A 1GKBA 2VVFA 3WNMA 4HKOA 2V3BB 2C9KA 1W8TA 4Q4W3 3UKVA 1D7PM 1S0IA 4AQ2A 4FPEA 2LTNA 1G7YA 5FPLA 3HJYB 4KL1A 5HV4A 2PHXA 5IVCA 5FYVA 1MQTA 1H9PA 1VB2A 4JGZB 1W6NA 4DY3A 1PM7A 4YSFA 4ME3A 4WFN1 1OBNA 1FHMA 2B46X 2CNAA 3B69A 3IDAA 5FJHA 1CESA 5FZKA 3ATGA 4NPMA 1W2OA 4ZU4A 4OZOA 4BLIA 5LCWL 5J48A 1IG0A 1B35A 1O8SA 4CEYC 2XVKA 2D3RA 4X8NA 3VBHA 1CAXB 3O12A 4PLMA 4LKSA 5CADA 4CDWA 3LGRA 4EWAA 4L2NA 4QXHA 1AR62 4QWNA 3POGA 5T5JA 5JIAA 1DDLA 3MLKA 4LBMA 1N3PA 2ZACA 4RD7A 1PVC1 1ZBA2 5AC91 1E5RA 4Z82A 5A6YA 3ZN6A 1GUIA 3JQWA 5JOXA 4MLOA 5F1RA 2WQ4A 3AP5A 3D4KA 4YZ1A 5JPNB 5GAEc 5CU1A 5H9RA 1MACA 1VBE2 3E6DA 3MGUA 3NAPA 5L7OB 2WWJA 1RUD2 2XJQA 5I8TA 3POEA 2XJRA 3VZKA 1JN2P 1OKOA 2YMZA 4GMP1 2WO1A 3VBUA 4HSLA 3WF0A 3AVRA 4RXNA 3PHMA 2D6MA 3MW3A 2JG8B 4LTAA 4BIFA 4D6QA 3LIHA 2A70A 5BNNB 4HVOA 5GAHc 2WS93 4CPBA 1ULFA 3JQXA 4K9FA 2LW8A 4XF3A 4XMAA 5A3WA 3H97A 1Q8VA 3B3QE 5HV0A 4FFFA 5LEJA 4FOYA 1H1AA 5FYMA 2JDUA 4JAFA 4BZ4A 1SLBA 3PU3A 2XLAA 3H8OA 4EWEA 2YXSA 2XBO1 4ZU5A 4KWKA 1JTZX 5FMCA 1COV1 1WJVA 4XF0A 3RVHA 2HEWF 3IM0A 1ULPA 1Q56A 2AYHA 4CSWA 2QDRA 1P8JA 1ZVFA 3M3CA 3ORJA 4QDSA 4XFAA 5GALA 1WW5A 1UO9A 7RXNA 3NO8A 2H6CA 4QDRA 3SCGA 2QQKA 5FUNA 4D8MA 4PQQA 4WM7C 4CPBD 5A6XA 5CAZA 1HX6A 1PMHX 2A6HD 3SH5A 5FIXA 3WG3A 5C4WC 1YFUA 2MEV1 1YJKA 5CBLA 2XGXA 4RSUA 2PMZP 3MIFA 2XJPA 2AC1A 2ZX1A 3USSA 3AX4A 4BQ4A 1E5SA 2K2SA 1IOAA 1FAYA 1WKYA 2OX0A 3ZR6A 5ANQA 3CIHA 4P9GA 3VBFC 4XHBA 2RS32 1GZWB 2J1SA 2JG9C 3F95A 4N9HA 1C8NA 5DG1A 3N3HA 4TSVA 1MS0A 1NA1C 5FZGA 4MXWA 1G6NA 1W6MB 2JKBA 2HH9A 3I59A 5IP9L 5IVFA 4FOQA 3SNMA 3T2QA 5JZGB 3AFKA 2V4VA 2HWB3 3AYDA 3ZSLA 2BJSA 2G9GA 3KWVA 3UK9A 5L73A 4ASLA 1LECA 1G9BA 3BTZA 3KYWA 1A8DA 3VD7A 1BFYA 2WZR2 4XVHA 2PPTA 3V0BA 4W65A 2PTMA 5A7WB 4AZZA 5JVVA 3DF0A 1RUJ2 3NSTA 3ZX7A 3HOWL 1LGCA 1Y9QA 2JA6L 5FZEA 4UF0B 3KGZA 4E9KA 1DX8A 1MVQA 3GTGL 3LEGA 5LASA 1WA4A 3AL6A 1NXMA 3K46A 4GB32 4K40A 1MS9A 3K4AA 3PURA 4GKYA 4LHSA 3RI8A 4BOWA 1R1A1 5IK7A 4X6QB 3FWEA 4GH4A 4FPFA 4QPIA 4D7SA 4MV2A 3TEYA 3ZYFA 4YG6A 5FY0A 2E31A 1AR71 4A4AA 4Z8BA 1LKMA 2GC0A 1NA1A 1RUG3 2JD9A 2WFF1 3PVOA 4FVVA 4R9BA 3W20A 4R9AA 4AK3A 4ARYA 5EFUA 1QQP1 2VQAA 1D4M3 2YFZA 4L0PA 1EAH3 3ZMNA 3N9NA 2JX9A 1UOGA 5FUPA 4M0NA 3CF6E 4QKNA 3OCPA 4XACA 1ST8A 3LSDA 2Q5TA 5IVJA 4AOCA 2PHLA 2Y6HA 3LA3A 3ZFEC 1LOBA 2WNUC 3WW1A 2R93L 3UJQA 1QJX1 3SISA 2WWSA 1RYTA 3SCFA 5EINC 4ORFA 2GZWA 3N4MA 1PFUA 5JIUA 1SLIA 4C8DA 2Q1FA 3TEXA 2PELA 3KYVA 1N1VA 4KU7A 1TMF3 1XSRA 4HL0A 4JGZC 5DAQA 3TN91 3UKNA 5LA1A 2Y6JA 4PDWB 1GANA 2QKDA 3RYRA 4BBRL 3T2PA 4KI5M 3SKJE 3Q8CA 2XMLA 4GJZA 4FBFA 1YUZA 4RQPA 5F8PA 2BFUL 5C71A 4PT6A 4UI9L 2JWPA 5FP3A 2B5HA 5AI2A 1FXZA 2NYDA 2EXKA 2EIBA 2YBKA 1CONA 3LIGA 2HEYF 4CCCA 5C9AA 5T3NA 3RZKA 1AYN1 1PK6A 1J1LA 2DCTA 2P3IA 2XVLA 3DGTA 3P3PA 3PMSA 3RPQA 3WDWA 4A45A 3W5NA 1RUOA 2JEMA 2DURA 1S0JA 5GZCA 5F6KA 4PQ9A 3TAYA 5MFPA 1Z78A 1GNHA 2R7EB 3ABZA 5CKMA 4YGBA 3AJZA 3TWIA 3CJIC 3UGGA 3O1RA 1DBNA 2KD7A 2H0VA 1C1FA 1OT5A 4XFIA 5T5PA 3N9QA 4RFRB 3ZFFB 1QNWA 1LAJA 5L7OC 1RUH1 4PIZA 5JAXA 2EALA 4M3CA 2XQXA 4MX3A 5IYBL 1HN0A 1AL21 4XURA 4LBKA 2JG8C 3MLJA 3SMHA 1DQ6A 1Q3EA 5F37A 3N7MA 2BPA2 5BNNC 2W95A 4NHYA 4L97A 2V5YA 1IPKA 1CAXA 4XETA 5F9TA 3P3NA 1JS9A 3LWRB 1S2KA 2H6BA 2MHFA 3ZFGB 5A3LA 3E6CC 2ZZQA 3ZYHA 2VNVA 5L9VA 2CWSA 1RJ7A 1XNTA 5I93A 3MLLA 3ZYIB 4AR5A 1JHNA 4CU8A 2W0XA 2E6VA 4JV4A 4I3PA 5DZFA 1T9QA 2W9XA 4COVA 3NNMA 1XNAA 1W9YA 1PNGA 4XBQA 5GLUA 4FFIA 4XQ4A 4B8CD 2UU8A 1JYIA 1YO8A 5CG8A 5FJ8L 4XQDA 1NE6A 4Z07A 3WNKA 4Q4V1 1UIJA 2VZ3A 1C3HA 4QDQA 2JB4A 3R0RA 4XILA 5JR7B 5I0RA 4TWTA 1HQLA 2JG8A 3MICA 1HRI3 1YQ2A 1HB2A 1YFYA 2OA2A 1FOD3 4CRQA 5BNNA 2DVGA 1W9FA 2CAVA 3LWPB 4R8HA 3VDBA 4LUKA 1OF4A 1TQ5A 5LEKA 5FPAA 5FZOB 3MZHA 1MEC2 3ZYJB 1R0GA 2OVUA 1TME1 2Y0IA 3LPGA 5GKAC 4DB5A 4OI0A 3USUB 4XXPA 2BBVA 1DHKB 2QQUA 2R073 2YGMA 3FLPA 4K1YA 4QX3A 3LA2A 5C9AB 1DLLA 2OW4A 3BYWA 2AQCA 3RGBA 1XNKA 1JUIA 3AKPA 3SH3A 1H6YA 2C0ZA 1S0CA 4LORA 2FDFA 2VQTA 2RS11 1UKGA 4CP2A 2PA7A 4C91A 1CN1A 1FYUA 1PVC2 5AC92 3J8F3 2WKKA 1NKGA 1VBA3 4MGTA 4LBJA 1KS5A 1XU1A 1HXS1 1TEIA 1VB4A 3DN7A 3VHRA 1KGYA 3WDVA 3WP4A 1SEFA 2CY6A 4GWMA 4YG0A 5CIRA 2BGPA 4QKDA 1CX4A 3KYYA 4HOOA 1GZWA 2VCCA 2WT2A 3IKWA 5G04L 3ILRA 5KXEA 5A32A 2YG0A 2CGOA 1W6MA 3WP5A 3I2KA 3CQOA 4HFSA 1H6XA 4XJ8A 1RIRA 3DUIA 3NL1A 1QJEA 1OHFA 2DV9A 1DQ4A 3NNLA 3UV9A 4BPZA 5JZGA 3AP6A 3ZPYA 3AMQA 4TZDA 1AXYA 1RUC2 3VL9A 3AFGA 2L9LA 5K7PA 4HLTA 4QU1A 1JW6A 5SV5A 4F8AA 2DVDA 2D3PA 5L9BA 4OVEA 3CZUA 3ME2A 4LR4A 1YQ5A 4DUXA 1EPZA 3OBZA 5DAXA 1O3RA 5C3QA 4LHNA 2M6OA 5GZEA 1COV2 2AH2A 2HWF3 5EP9A 4C2M1 4L99A 1GQGA 5D8AB 3VDCA 2GP3A 4M4PA 1SZBA 3IZOA 2VOVA 2K9ZA 2Q4SA 2RMU2 4MSVA 3H99A 3RYKA 5ACA3 3ZYRA 1RVF2 2ZZJA 4Q4W1 4LHLA 4AE2A 1ZZ8A 4PDWC 2B7YA 4QD2A 3H0GL 4GXLA 3KYUA 5K0UB 4BU2A 1O6UA 4QQLA 1K12A 1OPMA 4OHXA 5FLHA 5A1AA 3AZXA 5IYDL 3BCWA 3ZDVA 3RZHA 3GALA 2YB7A 3OD4A 1SPPB 2Y33A 4DXZA 2Q8EA 4ASKA 4V2VA 1CZVA 4AFBA 1S2ZA 4YGCA 1Z92B 4EWDA 4JKMA 1FMD2 1UU6A 2IXCA 3NJXA 3R4SA 4H2AA 4FQZA 4CCJA 1J84A 1LHOA 4C3IL 3ZOIA 1IS3A 3IMMA 5D21A 3GTJL 1CAUB 4AR6A 2B4KA 3LWOB 2XWBB 4Y1ZA 2PYTA 2ZBJA 2P3KA 3ZFFC 1G9DA 3A4UA 4IV1A 5GZFA 1NCRC 1OFSA 4CDQA 4IE5A 3T0BA 4LKDA 4CUBA 5FP9A 5CFDB 5FPUA 4A41A 2JI1A 2E33A 4OZXA 4AQ6A 1U5YA 3T1MA 4Q27A 5LK5A 1VBC3 2WABA 2PMWB 3FUOA 4UAPA 4UT5A 5FFOC 3HNYM 2WRAA 2BRTA 3JBG2 2D98A 4A3ZA 1LKPA 2E7QA 3NFPI 3V0AA 5E6HA 1WMDA 4HKWA 1AR72 1DGRA 2XXZA 3HQRA 1A3KA 2UWAA 4ONUA 3WQ1A 2WS91 3ZFGC 4FTEA 3PVEA 3DYMA 2BBAA 2WFF2 4Q4X3 4XFGA 4N43A 1W3XA 4LE3A 1XNBA 4QXKA 3AMHA 2LALA 3PUQA 1XYPA 2W1SA 3JB4C 3LQCA 4ET7A 1YI7A 2J42A 3OGGA 4WBBA 2Q1MA 3MIDA 1JXNA 3PZAA 1JZ3A 4BQXA 3KGLA 4CUGA 2DWRA 4Z1VA 4XFBA 2RE9A 4AFMA 3J7HA 4FAGA 4RHV3 1IQAA 4JHTA 1YK5A 5BNOC 2Z42A 1BQ8A 1QJU1 2A6ZA 2I74A 1AR82 2ZCWA 3HNMA 3E5UA 3WOGA 1ENQA 1MR5A 1KFUL 3AYEA 3D8CA 3ILFA 3N9MA 1CAVB 1YWKA 4QQHA 5JSOA 1QJX2 3RWNA 2RVAA 4BM8A 4CZSA 3JCIA 2W68A 1RHI2 5EXOA 1U5ZA 2JENA 3O1UA 5IFPA 4N7UA 1CJPA 3OPZA 2IZWA 3P6BA 4MGQA 4FPCA 4EV0A 3VUOA 1UMZA 4YZ2A 2ZGKA 1O3QA 1K5MC 1DF0A 4Y33A 3TN92 1BBT2 3RZTA 4JAAA 1XB9A 3AKTA 5DN2A 4S2FA 4A3DL 3PVNA 1W8WA 1F31A 3ZFGA 1RB8G 4YW2A 4XC9A 1VZGA 1POV0 3AL5A 4LEJA 4ZN3B 1SCSA 4NPLA 3D6EA 5FWJA 4AAPA 4C1WA 1OI6A 1UY4A 3PLQA 5JXGA 1T6GC 2HWB1 1CIYA 5C9AC 4YVSB 4M0HA 5H9QA 1TVGA 3ZPOA 1BK0A 2HBUA 4NROA 4BMBA 1X82A 1MZ6A 2UYAA 2ZAAA 1GWMA 1N3OA 1ODNA 4AL9A 3WCRA 5HI0A 4HK9A 3PKJA 1OA2A 1QCVA 2BQPA 1AJKA 1FPN2 5D2AA 4D6SA 1RUI3 2FZ2A 2IVJA 3QD6A 4XFHA 1NXGA 3THCA 3G6JB 4B4RA 2G4IA 1PO22 2W47A 4WV8A 5ANNA 4PHZA 1OH4A 4TPUA 4U671 2WZEA 3WG4A 3FBYA 4YNIA 2ZS6B 1GNZA 2YBSA 4QB2A 1XU2A 2BVBA 1C28A 3GJAA 5FP4A 4D6RA 5FZ0A 5IVBA 4XXAA 3WF2A 1BE7A 3USUA 1RUG1 3I4NL 2WA4A 3K7AL 1OURA 5H9PA 4IEXA 3LE0A 5L36A 1SQ4A 5E89A 1QOTA 1EAH1 3J7Y1 5FXVA 5EZWA 1MS3A 2FHRA 2ILMA 3FHIB 3ROUA 4QGNA 4QKFA 1OD5A 4B4PA 3S57A 2CDOA 3APBA 2W87A 4DPNA 3ELNA 1B2OA 1DQ1A 2G9ZA 2CTVA 4Q0SA 1XC6A 5D8AC 5FMOL 3UGFA 1ZRFA 5FYHA 4G4FA 3DPRC 3LWCA 5LZ6A 2VNGA 2VCAA 4GD4A 3R4DB 2VTXA 1R0HA 2BEOA 3HT2A 4HPKA 4MGYE 4MO3M 1UXZA 3C3VA 1NE4A 5DDJ3 2YROA 5FZIA 3GCWA 3VKOA 4FSJA 5IP7L 3JB8A 1TMF1 3ETQA 4A3CL 1D4VB 5FMBA 5J98B 2W52A 2D5HA 1UYPA 2BNMA 4O7XA 5F2SA 1LODA 1TNRA 4BK4A 3N9OA 4A44A 1D2QA 4QIWP 5C3EL 2NYYA 3AP7A 1F15A 2V4AA 2JDZA 2Z79A 3M3QA 5FREA 2V0FA 1H2NA 1KDMA 4MGIE 1PO13 4QHOA 4EN9B 1IKQA 4B4QA 3ES4A 5J96B 2PQSA 1REDA 4NE9A 2WN3A 3UKTA 2F4LA 3HOUL 2VMHA 5IJRA 2E51A 4NHLA 1R0IA 2AZ5A 5JVH1 2HKXA 1LOAA 1WBLA 4AEJA 5FP8A 5D8AA 4PI0A 4IEVA 3GTPL 4KGQA 2W92A 5IFTA 4DINB 2R043 4AI2A 2N7GA 3ZM8A 1IS5A 2CKAA 1XRUA 2AR6A 2RS12 1AJOA 1NG0A 4CEWA 5CFDC 2YC2A 5LK7B 5F5QA 1F35A 5CEHA 5K0UA 3VBSB 2DFBA 5GZDA 2Y6FA 2W1QA 2GC2A 4NRPA 4Y20B 1JZ5A 1HXS2 1HDKA 1LCLA 4WM7B 4Q4Y2 1S0BA 1BHGA 1G9CA 3IWZA 2IFWA 4DO0A 4QT6A 3BGAA 1ENSA 2LM3A 2ZKNA 1JBCA 1OD3A 4BQWA 1US3A 5FZHA 1SPPA 2DFCA 4HZFA 4ATEA 3PO3L 2QFEA 4DUVA 4XYXA 1GBGA 1D2SA 3KSCA 1RMU3 4GKXA 4P9WA 2B8MA 4YW7A 1OXCA 2Y60A 4EE2A 3M4OL 1YV1A 1AL0G 3NJVA 1H2MA 2CAUA 3K3NA 1VBB2 5DM61 5LBFA 1JOPA 4POGA 1V6IA 2ZGQA 3JD73 3PKIA 1CAUA 2E53A 2IWGB 2PLV2 2VL6A 3PTYA 3N7KA 3NV3A 1U0AA 3PJYA 3ZO0B 3ES1A 4CCEA 3B9CA 1JYCA 1QJFA 2XPJA 2P1BA 2OKXA 1CAWB 3M3IA 4GS7D 1NCQA 1JZ6A 4AEDB 2RG4A 3CL1A 1EP0A 4P14A 4DRVA 2IUWA 2J1UA 3VDAA 4W4ZA 1ASJ3 1YIFA 1UX6A 4ES8A 1GQHA 4LO8A 2VECA 4UW5A 1S0EA 1TG7A 4XFFA 3TRSB 3RZLA 3FL7A 4RA0A 4Q4W2 4FPKA 1HRI1 2D97A 1S2EA 2V09A 4A3GL 5DUUA 4DXSA 2Y6LA 2QVSB 1VRBA 1H30A 2FMYA 1V6JA 2WT1A 3SQOA 1OOPA 3OB8A 3SCHA 4CCMA 1S1AA 3QOPA 4YZ3A 5EQUA 2BW8A 1ULEA 4DXTA 1JYNA 1RDVA 3TB0A 2QTWB 2VXRA 3SKVA 3LSEA 1LEDA 3ZN5A 4BLJA 4GJYA 1BEV3 4D94A 4AAXA 2W39A 2R071 4E27A 3ZVXA 4RR3A 2VO5A 1OPOA 1JH5A 4Y5Z0 4LLFA 4INDA 3S6PA 5A6ZA 1Z7S3 5JXIA 1JYBA 1H8TA 5AFEA 1ZZ9A 3WXPA 4AR2A 3WY6A 1W6OB 3J8F1 1VBA1 4H14A 4YRDA 4CDXB 1J59A 1VP6A 3ACLA 1K5JA 1QGLA 1AXKA 3FN9A 4XTPA 4PF1A 1R092 4BIOA 2DYCA 1RITA 3GZEA 5DUXA 4AQTA 1JU4A 1F8VA 2WR9A 1ZRCA 1NUKA 4IDZA 2Y6GA 4J6GA 1BRFA 1LOEA 2BOJA 2ZGSA 3V56A 3OY8B 5C3SA 1X9TA 4I2OA 4YW6A 1BMV2 3RI9A 1Y1VL 3PIP1 1LOCA 3LEIA 4A6SA 4CU6A 4YVSA 1R082 2YV8A 4TYSA 1OVSA 4XABA 5A33A 3BPZA 4P5YA 3S7EA 1VMFA 4DUWA 4P00B 3LWQB 5AFBA 1UCXA 2HWC2 3VD4A 1PM4A 1F9KA 3V64A 3H1WA 5LA2A 1CVNA 2WLQA 3VD3A 3FDJA 2GNMA 1K45A 1VMJA 2F17A 1GLHA 2NVXL 1RUF3 4FQ4A 4KMQA 4TLFA 4XJ9A 1UZZA 2HWF1 2W46A 4XUTA 3WDTA 1ODHA 1QJU2 1HV0A 2FDHA 3MSUA 4QGMA 2P6HA 2XLGA 1JMUB 2PVEA 1BQPA 1XSQA 1MS5A 2ORXA 2PHFA 3N7LA 5T5LA 3WQ7A 3CJIB 3UYJA 4EN0A 2J7MA 3WWNB 5ACA1 2LROA 4HN0A 5J09A 1Y43B 5FTTC 1JZ8A 2ATFA 3UJOA 1RUE3 3RSJA 3GBGA 3I2GA 4YVWB 4AVTA 2TUNA 1DLCA 1QHDA 5FZ1A 4AXOA 5JOZA 4P9XA 1FT9A 2EXJA 5FYYA 2PHDA 5FUIA 2WC2A 3NVCA 1PIV3 2WT0A 4I0WB 4IW3A 5LWBA 2M4YA 3LFIA 2MS3A 3M7AA 4KBBA 4UW4A 3T09A 4AVBA 3QACA 4KWUA 5FKCA 1F4HA 4HKLA 4HANA 3GHNA 4XPVA 4CEYA 4CDUB 3W9AA 3E5QA 3CU7A 1I3QL 4XBNA 1IG3A 2ORZA 1O3SA 5IWFA 5B4NA 4G6BA 2B45X 3POYA 3Q8EA 4YFWA 2XHKA 2PHUA 3OD0A 4ZZ5A 3IU3I 4BQ1A 4N8MA 1NQJA 4FPJA 5A70A 5B2GB 3RZGA 1OUSA 1W99A 1Y3TA 2XB6C 5CFCB 3H8UA 3NJYA 5DAVA 2XKOA
chains in the Genus database with same CATH topology
2WNEA 1VR3A 3EXUA 2QNKA 1W6QB 2FBEA 4HBNA 4SLIA 4M3CF 4A7YA 1IU6A 2VG9A 3VBSC 2HR5A 3GF6A 2BWCA 2HYKA 1LTLA 8RXNA 1VBC1 5FAXA 3R05A 4AHXA 1DG6A 4AR4A 2A73B 1AR63 5FOBB 4DRRA 2K0GA 3N7JA 5BNQA 4WVVA 1SMWA 1LU2A 4FXGB 4HMZA 4Q4X1 1VZHA 4H3WA 1LHVA 4R52A 4Q2FA 1QDOA 2HJIA 2VVDA 1ZBE2 3H1YA 1EAH2 1ULDA 4GALA 1VBE3 2ERFA 4X6RB 1RUD3 3WP3A 5EWSA 1G86A 1QY4A 1FHHA 3OF1A 4RHV1 4AEDC 2PYAA 3U07A 4HK8A 5FQ0A 2A3WA 4Y20A 3AP4A 4LE4A 3K48A 4WM7A 4XF9A 2C9AA 1KJRA 1EV12 1S0GA 5C4WA 5DZEA 2JD4A 5FLJA 1Q43A 1XYNA 1BVP1 3FC0A 2BTVC 1SLAA 4ITCA 3FZ3A 3VBFA 3J9SA 2JG9A 2RM21 4JDMA 2XKPA 3ZG6A 3N36A 1QJY2 1QXJA 4XMIA 3TNPB 4W6WA 3H50A 4YGEA 5ABJB 2IXHA 4AHWA 1I6XA 4MZUA 2ZGRA 3A0KA 2QZ2A 1PZ8A 1YHFA 1CAWA 1DYPA 2XUMA 4AEDA 3VZMA 3KQRA 1IPJA 2DU0A 5I8YA 2KKDA 4UW3A 5I0TA 4CDXC 1RUI1 3WHUA 4XOGA 1DQ0A 4R4ZA 2RS33 3A44A 5CB7A 1C1LA 1UU5A 1YK4A 4N53B 4AR3A 1VBD2 1LU1A 2RDVA 1S55A 1XE8A 1KQRA 4W6YA 2XJVA 5H1Sc 2GSYA 2R1DA 3EBRA 1XQNA 3R4UA 5GLZA 2WZR3 2UWBA 4WVMB 4KU8A 1OWCA 4OHZA 4K3UA 1RUJ3 2VOWA 2X29A 1W6PA 3LOBA 1MZFA 4ZKTB 3ZFEA 4GB33 2ZX2A 4BCUA 1VAKA 2WNUA 1W6OA 4JGYB 4CDXA 1DGWX 2BNOA 3L2YA 5JOWA 2ZX4A 4QM9A 3ZXGA 2JI2A 2PFWA 3AZVA 5FCCA 2GN7A 1Y7BA 3AB0A 4K20A 2ZKLA 5DDJ1 1NCRB 4YVWC 1GICA 4E2QA 4JGZA 5CG9A 2G9FA 4IERA 3RG0A 4E6YA 1WW7A 2RS52 3H7JA 1PGL1 5K8SA 2XVGA 4QPYA 1O91A 2XH6A 1WD3A 2IXJA 4WVWA 3M70A 4IEYA 2XWJB 2NLRA 1YI9A 4LO7A 3P2AA 1PO11 2TBVA 4CDUC 1SCRA 2WNVB 4QQPA 4K8FA 1HRV1 2D7FA 4YGDA 1U5XA 1EYBA 1ZZCA 1RJ8A 4COZA 2MPFA 1N1TA 1WMEA 3M3OA 5CFCC 2ZAHA 4V1PA 2WFPA 2YGLA 3LCPA 4AYUA 4JC1A 2R041 3CJIA 1AYM3 2VMIA 2WQZC 4S2DA 5A3MA 1SFNA 1WCDJ 3PVBB 5GJ6A 3M8LA 4JRAA 1V6KA 5BNOB 4QPGB 5L7OA 2HWD1 2QUOA 3FBMA 2JXAA 4LBQB 5KBFA 1G8WA 3J8F2 1MS1A 4FP3A 3VBRC 1LKOA 2ENRA 1H2LA 3NKGA 4XJWA 4PIYA 1RDGA 2P34A 3DV8A 4NN0A 1ENRA 1K5MB 5AI3A 2R063 3WZ1A 1UN1A 1RMU1 1V9U3 1YFWA 4QU2A 4IL7A 2Y26A 1TE1B 1VRH1 4Y1XA 3AKQA 4IEQA 3POSA 1D0GA 1LGNA 3JD71 4CYDA 1FNYA 1YYNA 5CFCA 1XNDA 2UY8A 4I0AA 4JTOA 1MZ5A 1W6QA 2ZA9A 2I45A 2AENA 5IK8A 2I2SA 2EF6A 3M2MA 1PZ9A 2O0OA 4YZ4A 2HWF2 3ZSEA 4XIOA 1ASJ1 4JRLA 4NOTA 3WUDA 1MVEA 3AXEA 4XFCA 3INAA 3VZNA 3KT7A 5KWRA 2XJSA 4F83A 4YW4A 4YM0A 4AVCA 3KT1A 1GR3A 4E4ZA 5IT6A 4QGLA 4MGZE 3X29B 1PHMA 2GNDA 2ZHNA 4V196 3FMGA 3NKTA 3V0AB 4OUMA 4UY81 2XL7A 1POV3 2XL9A 3THPA 5ABJC 3RS6A 2B39A 3AZZA 3FE5A 1BEV1 5BYNA 3H9AA 4Y24A 5FMOS 5K9YA 4C90A 2JI3A 4YFZA 1SLCA 2XBO2 1C4RA 1Z7S1 3ALQA 5LRSA 1OA3A 4FPLA 3ZYPA 2ZGLA 1LB2A 3DPRB 2ZOEB 1PGW1 1MEC3 1RTVA 4MYEA 2PAEA 4N53C 3WP6A 2PSMC 3MPSA 2A3YA 2D6PA 2MEV2 4L11A 3TOJA 1DGWA 4ISRA 3GZUC 4ES9A 3AZYA 5JVG1 4I09A 5ABJA 2I07B 2PVXA 1OQDA 4WM8B 2CGNA 4Q8LA 2DTYA 1U12A 1PVC3 1WLDA 5AC93 1O3TA 5CVRA 3IT8A 1LHWA 1O5LA 1OQEA 1WLTA 5E16A 1RUNA 4G9SB 4JGYC 3D0SA 2OZ6A 4B29A 3AP9A 1X8EA 3RMYA 1AXZA 4RHV2 4KG0A 4PCRA 4N53A 2GMMA 2JE7A 4PBPA 5LRRA 1M4WA 2IXKA 1OLRA 1S2BA 2TEPA 4QQ2A 1C8M3 4PDWA 5GZGA 1ND2B 1RUC3 2GMGA 3GBWA 4P9YA 5HXVA 2ES3A 4LO6B 4PLOA 1WMFA 1UIKA 1R1A2 2M6PA 2Z3RB 2WNVC 4M00A 2RM22 1COV3 4BE3A 1G9AA 1LTEA 4BH9A 2B42B 2Q30A 1UPSA 4HT1T 1QQP2 4IETA 2V73A 3WQ0A 2AYJA 2RMU3 3LPEB 4JGYA 2FZ1A 1RVF3 2A5ZA 3T2TA 1W39A 1C09A 1KITA 2QDNA 5C6CA 3IBMA 3ZFFA 4QPGC 4EJRA 1J3QA 1VLNA 1NCRA 2WSVA 3WNXA 4OULA 1X50A 4FP2A 1JOJA 3O5SA 5KC5A 5IY0A 1ZYBA 2C6AA 1IKPA 1VZIA 3GNEA 1AR93 3NJZA 5JPMB 1FMD3 2DSXA 2DF7A 4K6BA 2WNVA 1LULA 3BIWE 4Q29A 3KM5A 1ZREA 5FPXA 1AX2A 2ZMNA 2PAKA 3VDDB 1A78A 3RZZA 2RR13 2WINB 5EJ3A 1WBFA 1AX1A 4MH0E 2QQPA 3FFZA 1VBE1 3P8BA 3M3EA 5DUWA 5AVAA 4ASMB 1AYN2 4QQOA 1RUD1 3VBOB 5BNOA 3L2HA 4IQPA 4LBQA 3WDYA 1OLQA 4AI1A 3JBG3 1VALA 5E8AA 1Q8PA 4X8PA 4JAGA 1FNZA 1ULGA 2E9QA 3VHNA 4OHWA 3WD5A 1AR73 1DGLA 1DQ2A 1SMVA 1B2JA 2F4PA 1YNAA 2QCSB 4F8AA 4EN8B 1MQTB 3W58A 5GZCA 3VZJA 1RUH2 3FX3A 1W6NB 4D69A 3U0ZA 3RQ0A 1AUYA 1K5MA 1SLLA 2CGPA 2A7AA 3MIGA 3LB9A 1GV9A 4PBOA 1AL22 1B35B 2A6VA 4LBQD 3E5XA 3B02A 2X5IC 4L92A 1F2NA 5E1RA 3VKLA 1AR83 1F5FA 1PO12 1ZNPA 3MW2A 5D1IA 2GU9A 4CDWB 2UWCA 1HQNA 1HRV2 3VV1A 2BGCA 2XG3A 2ZGPA 1D4M1 2WLPA 3SHRA 3MIEA 5C9AA 2WSUA 2BNNA 2GNTA 1CJDA 1N1YA 1UF2C 3IDBB 1RHI3 3CLPA 1WCSA 4N9IA 2ZABA 3GHMA 5BNPB 4GMP0 1BBT3 2DUQA 4DFSA 2WL1A 4DNYA 5I8SA 3NAPB 4AW7A 1ZX5A 2RS31 1M06G 4YM3A 1SDWA 2HWD2 5KHHA 4EN7B 1DZRA 3BU7A 2LCQA 1X8MA 4Q4V2 3VBUB 4COUA 4YLZA 2WJSA 1LKNA 4LA2A 5FO7B 4OHYA 2VPVA 1YXWA 1MS4A 2HEVF 1URXA 3H1MA 4Z2WA 3WR0A 3ZXDA 4YW1A 4WM8C 4IESA 2FMDA 4K9SA 1I3HA 1O5UA 1RC6A 1RMU2 1FPN3 1RUJ1 1VRH2 1TNFA 4UXAA 4POFA 4LULA 2BE5D 1TME2 4RL7A 3MPBA 4Y26A 1PO23 4XE9A 4UW6A 2ZMLA 2O8QA 3B0AB 1YCIA 3H0OA 4GB31 4MXVA 3HBZA 3VZOA 2RJLA 3DPRA 1NNQA 1DZTA 4FOVA 4JVAA 1ONAA 2QL0A 1ND2C 1PNFA 2ZPXA 2M4VA 1LRHA 5C8WA 1IRNA 1C5HA 1FV3A 4A7ZA 2ZMKA 3ZIXA 3NW4A 6RXNA 1LENA 3VLBB 2XJUA 1AVBA 2SBAA 3EHKA 4U2AA 4DZGA 1WGPA 4KQ7A 4CP0A 3AMNA 3SITA 1NYWA 4MXWB 1MS8A 1SMUA 1EPWA 1NQDA 3E6BA 3PIO1 3ZXFA 2HWE3 4FCAA 2ZGUA 1N47A 5FLIA 2GC3A 1CADA 1BQ9A 5MLC3 1LESA 2VUAA 3WHTA 3H7YA 5EIOC 1VCXA 2A6XA 1KS4A 5BPXA 5JSPA 1AYM1 1WW4A 1QF3A 5CFDA 5C33A 2D6LX 2VUJA 4U36A 3SXWA 5CA6A 5CNAA 4DY5A 2JE9A 2A6ED 4GH4B 3E97A 2Y0OA 3IDCB 4P9JA 5FO9B 1HV1A 3ZXJA 1FOD1 1QDCA 1BK1A 2X53S 3VDDC 4A2UA 2OZJA 1AX0A 1XNCA 3O0XA 4RFT0 2R061 4RS5C 4LBNA 1V9U1 4AF9A 3KLSA 3POWA 1CR7A 1N3QA 1DIWA 1WCKA 4XTMA 4B7KA 1VAVA 1REFA 4D7YA 3VBOC 4E2SA 2GAUA 4H7MA 4HETA 3Q9OA 5GLTA 1NXD1 3MI8A 1NLSA 5KC6A 4Q4Y3 2B5ID 3NV2A 4OI2A 5E88A 1QKQA 1LHUA 5HCAA 1CAVA 1RYQA 1E8JA 5FPZA 2WA3A 1X7NA 1MQTC 3VKMA 4S2HA 3SS2A 5T50A 4YW5A 2EA7A 1VBB3 5FRAA 2EIGA 1YUDA 1ULCA 5T5OA 2NM1A 4RQPB 3VDDA 5DZGA 2GDFA 2PLV3 1B35C 4IV3B 4JAEA 2FQPA 3LZZA 4IEUA 3VBHC 2ERSA 1QMJA 2BFUS 4Y1YA 4CDWC 3I8TA 2PN5A 1CGPA 1OFNA 5F6LB 2KN9A 2WS92 5GM0A 4DQAA 1V6MA 3KCYA 3KD4A 4BA6A 3WINE 2RHPA 3ZXLA 1CD3G 1R0JA 1RL3A 5BNPC 1F5JA 1H1MA 5T52A 1WW6A 1O4ZA 5SV8A 2D3SA 3NAPC 1S30A 1DVBA 3WW3A 1KFXL 3VBUC 1GFF2 2XLFA 4M3CB 4Q0UA 1T9PA 4XW3A 3VPBE 1MEC1 1NZCA 2VGDA 3HMYA 3O0VA 4JTNA 5AVPA 3U4XA 1Z0HA 3WW4A 1H4HA 5EYYA 3K51A 5KXDA 2ZHMA 4OI4A 1IU5A 2ZHLA 3VZLA 1QJZA 1NLRA 3AZWA 3SH4A 2NQYA 4KNCA 5MFZA 1RINA 4AI3A 2ETEA 3MDPA 4GULA 4NO4A 2A71A 3MF9A 2AREA 3WV6A 5BNPA 2E7TA 3BODA 3N35A 2EXHA 4YW3A 4XXBB 1EY2A 2HWB2 1R093 3MPPG 4E4DX 4KWLA 4QX5A 2IFRA 3JZVA 4GQ7A 4J1XA 1J3PA 3WG1A 4E2GA 4H7LA 5L19A 3ENRA 4AHYA 3MIHA 1R083 1C8M1 1RUC1 1FATA 2DCKA 2HWC3 2WZPP 2P3JA 3VBRB 1U5IA 5HCBA 4A7KA 2AUYA 3CEWA 4NPRA 3M1HA 2R0FA 4META 1BXHA 4O9GA 1JUHA 1QJU3 1RUG2 4OLLA 1ZBA3 3HN1A 3IPVB 2ZGMA 4NHKA 1SBFA 2EAKA 2RMU1 2Z69A 1D4M2 5KHJA 1CIWA 1RVF1 1FX5A 4AWDA 5C8CB 5KXBA 1QWRA 3MIBA 3OTFA 2OYZA 3VBSA 1DU3D 3WWLA 4QPIC 4GH4C 3RJ2X 1OKQA 2JJ6A 4AQSA 3KB5A 1AR91 3GYDA 4K1ZA 2D5FA 3QCWA 5A32B 1FMD1 3PJQA 1TMF2 3KT4A 1QYBA 2VW2A 2JICA 4I30A 3FFQA 4G3YC 2ET1A 2C6BA 3MFAA 1ZRDA 4HSJA 4PLNA 4JDOA 2DVAA 3WW2A 2RR11 3MEPA 1CQ9A 4FPYA 3CNAA 3HD8B 4OI1A 2ZHKA 3LKJA 4XJAA 4NR1A 1ZRRA 4N7IA 4AI8A 3NV4A 2ZGNA 1BYHA 5K2ME 1QXRA 3BTAA 3WT3A 3JBG1 3VHOA 3O7OA 3OYWB 1WLWA 3AKRA 3BALA 4Y1UA 5H9SA 3WUCA 4RQPC 5JSRA 4IV3C 2GC1A 1ZBE3 3KYXA 3LOIA 2ZJCA 3WCSA 2D93A 4QHBA 1BKZA 3B9IA 3WDXA 4ZXKA 1PK6C 4N90A 4Q26A 4YG3A 1KD7A 3SLIA 4DS0A 1AR81 1R0FA 2ZTNA 4AFAA 2Z5WA 3VL8A 5MF6A 4L8QA 2R32A 5IUQA 2NP0A 2ET7A 2A3XA 1EV13 4LO4B 4XF4A 1RHI1 4FPGA 3I2DA 4H55A 5EYXA 1YLLA 4MGKE 5T55A 1X36A 1W0OA 4ATFA 4LT5A 2CYFA 4IV1B 4CDQB 2R6QA 1BBT1 2JECA 1AYM2 3WX5A 5BV6A 1OA4A 2Y38A 3H3UA 5FDBA 3I7DA 3FUQA 1ZA4A 1QJY3 4B8EA 2A75A 4IV3A 2GN3A 1HLCA 2Z3QB 1QXPA 1DGRN 4YZ5A 3MYXA 3OBRA 3B5LB 2NMOA 2C5DA 3OY8A 5GADc 1HRI2 1FOD2 3ZXKA 4L9BA 4N43B 4UBGA 1IHMA 1REEA 4LLOA 4NWWA 3S30A 1IW7D 1GYKA 4FOWA 2R1BA 1NOVA 5I0SA 2R062 1LR5A 4XJUA 4TVMA 1V9U2 3K35A 3LNLA 1FPN1 3AMPA 5DM71 3VGIA 4RGGA 2GH8A 4K7JA 4URTA 1PO21 4LHKA 4PJYA 1ZM1A 3OGJA 3NWKA 3WVJA 1NY71 2R072 2UURA 1VBD3 4IEZA 4YYOA 3LAGA 4AGGA 5GAGc 2DCYA 2YHJA 3C2UA 3MW4A 2Q8OA 2R0HA 4FT8A 1KDKA 1RGSA 4YVWA 1AHSA 1VBA2 1W2UA 4JQRA 4C0HA 5JLVA 2ERJA 4AHZA 5RXNA 4AEMA 1UAIA 4MUVA 2NMNA 5FOJB 2A6YA 2GALA 3J4UH 4CDUA 4EN6B 2L0ZA 3IMNA 1QH7A 5HBAA 3GZTB 2A6WA 5BUVA 3IDEA 2CR8A 2HWE1 2OPKA 4XQWA 3HAGA 1LOFC 4JDNA 2YC0A 5MGNA 1H2KA 1SACA 1QH6A 2DVBA 3LA7A 4LO5B 4LNVA 4CTEA 5C8CC 4HN1A 5EV7A 2V0EA 4IEWA 4CP1A 3BOWA 3TBDA 1VJ2A 4FPOB 1B13A 1G9FA 2RS53 1OMIA 3PNAA 2R30A 3URFA 4DMIA 4IEOA 2VH9A 4NVPA 4BWOA 3J7Z1 2K2DA 3JUUA 3RYGA 4AG4A 5AN9H 3IN9A 2E7AA 1ALYA 3DL3A 3VBRA 1ZZ7A 3AKSA 5ACA2 3KCXA 4FTSA 5JZGC 5DXDA 1CAAA 2DUOA 3ZXEA 1UL9A 3IPVA 1DYKA 1LOFA 2R49A 4OUSA 4AGVA 4Y22B 2X5IB 3A0NA 1J1TA 5C8CA 1GZCA 4P9IA 2PHTA 1YJLA 1SMMA 2A69D 5GLVA 2D6NA 1D0HA 5KHGA 2GMPA 4AGRA 1RB9A 3B93A 1QU0A 4COWA 4Q4Y1 1HIXA 2D6OX 2P37A 4HPKB 2VNRA 2AGSA 1AZDA 2IXIA 1O4YA 5I91A 4I0BA 1S0DA 4YWMA 3CO2A 3OJBA 2D43A 3RRDA 1VBB1 1C8M2 4AFCA 4M3CE 1PVXA 4LBOA 2PLV1 4SBVA 4Q0PA 1VBC2 3RMXA 4A3XA 1CPMA 4I3GA 2GNBA 2D40A 1I5ZA 1UKRA 3EQEA 5DUVA 1GSLA 2B9UA 1ENXA 2DTWA 4FPHA 3ZYGA 3T1LA 3RJRA 4PIXA 3QH6A 3UL2A 4Q4X2 2PAMA 3GZAA 2DUPA 1C5IA 5IK5A 1V70A 4IV1C 4COYA 2H0BA 1S24A 1IGOA 4FAHA 3AYCA 4CDQC 5JI9A 4QMAA 1J3RA 3OYWA 5JI7A 4CEWB 1DQ5A 4XIKA 2OUHA 1V6LA 1RUF1 4D3WA 1BCXA 5JCTA 4M01A 4GMP3 2D6KA 2BWAA 2YZ4A 5JMCA 1GZ9A 3NV1A 5J3UA 4Z92B 2J9UB 1IS6A 3ZN4A 3ZSJA 1DFQA 2VULA 1AR92 5J37A 1RUE1 4HVRA 4N43C 1E57A 1DZQA 4RGAA 1ZZBA 4WVMA 1ND3B 4BYYA 1PIV1 3AK0A 3MFCA 3U10A 2XBO3 3FLTA 2LUWA 4Q1RA 2RR12 2VW0A 1LGBA 3ECQA 3KMHA 2X8KA 1PGSA 3R6SA 1FV2A 2YDEA 3HQXA 2YY1A 4F7ZA 1SBDA 5KXCA 1NCQB 1H4GA 4P9LA 2PHWA 4QM8A 1KRIA 1R091 3H3ZA 3B7MA 3D5OA 4E4SA 2MEV3 3RYPA 1H7VA 1XYOA 3ILNA 5FBZA 3THTA 4KGGA 1WD4A 2NZ9A 3QVDA 1XXNA 2NN8A 5I0UA 1RUI2 1BMV1 4C1XA 2E63A 3VKNA 1HKDA 1R081 2ZGOA 4WZFA 5HCFA 2VVEA 5BY5A 2HWC1 4OHVA 2ZX3A 1APNA 4D7TA 1X33A 1IROA 1OOPB 3AJYA 4B7EA 1AR61 2EXIA 1V6NA 1V6OA 2CV6A 2Q0AA 4PF5A 1W0PA 1BZWA 4RS5B 1ZBA1 4HVQA 2OUJA 4RR3B 3FJSA 4JCKA 4KH9A 1OSGA 2SLIA 1Q8OA 1NXEA 2ARXA 2ARBA 2NPIA 1H8TB 2O1QA 5J7MA 1I9RA 3RDIA 4QPGA 1QNYA 4Y4YA 4F3JA 1LJ7A 2ZGTA 1R1A3 4NHMA 2VMGA 1AF9A 2RJKA 2RM23 1VIWB 1UZYA 2DVFA 2WFF3 4O9EA 3JU9A 4XJZA 5DDJ2 2VOXA 1QQP3 4GA9A 1PMIA 3B08B 4ISQA 4LUMA 2O5JD 1PGL2 2CWMA 3BB6A 1L3JA 5A33B 1HQWA 2KM2A 2PHRA 2PQQA 2UY9A 2VY0A 3V65A 3AMMA 3B00A 1H8VA 1UW8A 3VBHB 3ZMOA 3W59A 3GBFA 1B71A 1IS4A 1UU4A 1QJX3 2MNGA 4BHPA 1UD1A 2KXLA 1A6CA 3L9JT 3ZSMA 3ZIWA 3VKFC 2O8OA 2BUKA 2QZ3A 2KA3A 4XBLA 3ZN6B 5BXXA 1NY72 5JDBA 1H1IA 2C1FA 3OBTA 3G7DA 3HIFA 3FLRA 5JOYA 3TN93 4FTBA 3VHPA 2R042 3QQCE 2P2KA 3S7IA 2VOKA 2QE3A 2VW1A 1BVVA 2Q1ZB 3QH7A 1ZRPA 2OIIA 1QOOA 3QLQA 4I01A 4S2GA 1ZBE1 1XE7A 3M4FA 3VN4A 2DCZA 1I1EA 3HWJA 2IXLA 4AEKA 1AYN3 4CEYB 3V0AA 4WVZA 3AM2A 2EVXA 2BVVA 2X5IA 4Y22A 3ST7A 3BOPA 4FO9A 3TNQA 2VQ0A 3J26N 2WZR1 4KWJA 1V00A 3EO6A 2HWE2 3S0MA 1A8MA 1LOGA 1CPNA 1H9WA 3AXDA 1EV11 4GIQA 4Y1VA 4CEWC 3JD72 1VAMA 4Q1PA 1RUH3 4XZPA 5TSWA 3B01A 5K0UC 3WG2A 1YRZA 3KS7A 3PMEA 4LBLA 4W6XA 2F6BA 3IIAA 1H0BA 1PZ7A 2W08A 4XHXA 1AL23 2ZIXA 2YUEA 4OFGA 4AVAA 1QJY1 1SBEA 4MVTA 1ASJ2 2P17A 2YYOA 3O14A 4WZCA 3AYAA 1MZEA 5T54A 1HRV3 2CL2A 1UPIA 4AVVA 3D0JA 2XJTA 1ND3C 3U11A 5GLWA 4WM8A 4XF1A 3I59B 3ASIA 4P5HA 4Q0VA 4AI0A 2D44A 4AVSA 2GH2A 4R4XA 1S0FA 4IEPA 1NCQC 5IK4A 2HWD3 2UYBA 3RNSA 3TYJA 4Q4V3 5FQ0B 4Q0QA 3V0BB 1KJLA 3KZ4C 1BEV2 2DCJA 5JWPA 1SLTA 4DOUA 3EJKA 1VBD1 4ZU7A 3HT1A 1T9OA 5C4WB 2ZX0A 1Q8SA 4C0BA 1Z7S2 1O7FA 1ND2A 4K21A 1N1SA 5KHKA 4ZN1B 1C57A