2XJVA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae with mutation d201t in complex with calcium and glucose
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPTNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 60
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjvA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjvA01
4LHLA 4CP0A 2XJQA 2XJSA 4COUA 4LHKA 4COVA 4COYA 2XJUA 4COWA 4D3WA 4CP1A 5A3LA 2XJRA 2XJTA 4AFBA 4AI0A 2XJVA 4AFAA 4LHNA 4A3XA 4ASLA 4AF9A 4AI3A 4CP2A 4COZA 4AI1A 4AHYA 4AHWA 4AI2A 4AHXA 2XJPA 4GQ7A 4AHZA 5A3MA 4AFCA
chains in the Genus database with same CATH superfamily
4AGRA 3BOPA 3B0AB 3NKGA 3WXPA 1FATA 3JU9A 1UWWA 5JPNB 1O8PA 1SBEA 5CA6A 4Q0VA 5DUUA 1VB4A 4Z07A 3ZYJB 4D3WA 4EZHA 5CFCB 4C0HA 3AKSA 1S0IA 4BB3A 4Q2FA 5G05L 4Q4Y2 3U0ZA 4YM3A 3D4KA 4CCDA 2XJVA 5FO9B 5GM0A 2XOMA 4JDOA 1GP4A 4Q4W3 3B02A 1UYZA 1QDCA 1R1A2 3ZOIA 4XPVA 4NROA 1LKMA 4C3HL 1RWDA 1V9U2 4AHWA 1MS1A 1QH7A 3MYXA 4MHRA 1ZRFA 1LENA 1QJY3 4XJ8A 1OHFA 1UYPA 5A1LA 4W8JA 3EMRA 5MF6A 3I2OA 1S0GA 1NT0A 3NAPA 2RM23 5FMDA 5FYCA 2P3JA 5IVEA 2RS31 1YCIA 1AX1A 4JVAA 4CCNA 3LIGA 5C7GA 2J1EA 4D7SA 1W6NA 3RVHA 2JECA 1I3QL 1OXCA 3ETQA 3AZZA 3GCXA 4QXHA 2VUDA 1EYBA 4BXSV 2K2DA 2Z5WA 2BTVC 3OEBA 1JZ2A 2YBPA 3ALQA 4K9SA 4XC9A 5LWBA 2PPTA 2ORXA 1AR81 5JZGC 5J7MA 3ZXLA 1X9TA 3ZFFB 3PL5A 1OI6A 1OQDA 1RUE3 4NO4A 1VB2A 4V2WA 4CP2A 5I0TA 5JI9A 1BBT1 2IVJA 3AFKA 5SV8A 5A7OA 1FV3A 1QQP2 3VZJA 1S1AA 2IXJA 1UMIA 1UY1A 2CAUA 2WA3A 4FQZA 4JGYA 5EWSA 3S17L 5FZ8A 4ARYA 4AEDC 2RJKA 1J83A 2WN2A 1UXZA 2YPDA 2B46X 2P34A 4EWEA 4NN0A 1UOJA 5E1RA 5HXVA 2GMEA 1WJVA 3DKWA 2VZ1A 3WQBA 4C1XA 1UOFA 2W2IA 3D0JA 4XFHA 1YIFA 3BPSA 1S24A 5FZOB 3KYWA 4A3ZA 1K5MB 1QJZA 1GV9A 1U5YA 1SDWA 2TUNA 1PM7A 1SLCA 2E2JL 2JWPA 2NQYA 2I07B 2QQJA 1GNYA 4N53A 1R0JA 3DV8A 1R0GA 3KT1A 4Y5SA 4AG4A 4S2GA 3WWNB 4IEXA 2XR4A 3A4UA 4OZOA 4PDWA 4Q1RA 4UFJA 5ANNA 5FK7A 3ZFEB 4CXXA 1WMXA 2PA7A 2ZGNA 4LLFA 4EV0A 5IVJA 1VMFA 1OH4A 1UY4A 3S5AA 3OD0A 3S15L 1K5JA 1VBA1 1W6QB 3QACA 2DVAA 4GKXA 4AVAA 4KGGA 1ZM1A 4CCKA 3U07A 3LA3A 4FFFA 1YFWA 1PK6B 4G9SB 3PKJA 1FX5A 4R9CA 5FYYA 1NXGA 3KYVA 1C8M1 5FV3A 4NMIA 4FXKB 3NV2A 5IHRA 1OUSA 1SBDA 3LZZA 1B35A 2A6HD 2Q1ZB 1COV1 3PURA 5C4JL 5FREA 1H8VA 4MGYE 4FPLA 1NXD1 5FZ6A 2JG8C 4H2AA 4ZZ8A 4HL0A 5FZFA 3OUIA 1IG3A 4UFKA 3HT2A 4DY3A 5I93A 4QM8A 1UMZA 2NP0A 4BDVB 1GICA 3IIIA 3MDPA 3W20A 2WL1A 4BLJA 4OCTA 4XUTA 4HK8A 1VRBA 4DUXA 2Y6FA 1CZTA 4UY81 2VTFA 2BGPA 5I0DA 5M5XL 2VOKA 2PAMA 5EHDA 1J3QA 4WM7A 2CKCA 1ULEA 1ULPA 5JAXA 1JOPA 4XBLA 2PVEA 4WVMB 3O1OA 3MQKB 1BZWA 3MPSA 1OQ1A 2LRPA 3VL8A 2O14A 3MIFA 1NQJA 2HWF3 2JDUA 1C5HA 4YG3A 5FYTA 3VKOA 2G4IA 1L7LA 2HWD2 5HCFA 3BTAA 4IE0A 5M0TA 1NE4A 3H3ZA 1VRH1 3JUUA 3D5OA 2GH2A 3T08A 2V72A 3VBRA 4AAPA 4LPLA 3JBG3 1JYIA 2BP6A 2RS13 3OY8B 2XHKA 5CISA 3J7NA 1V6LA 1Q56A 3I59B 2QFEA 3PO2L 5DAWA 1GU3A 3J8F1 1UKRA 4E2SA 4Q26A 4I09A 3WCSA 4DUVA 1D4M1 3LWVB 4MSVA 1I50L 4FOQA 4IGQA 3AKRA 3AMMA 2Y26A 3ILRA 5DDJ2 4E2QA 4OUSA 4UYBA 3QQCE 2O1QA 1RINA 5KHIA 4YW6A 2ZGLA 3LWRB 2VMDA 1WLCA 1R0HA 4XVHA 3ZFGC 2DUPA 1O59A 1ZZ9A 4GMP1 1B13A 3I2HA 5FIXA 1DGWX 3A22A 2E33A 2QQLA 4M3CE 1YUXA 1VJ2A 4R4ZA 4AHYA 1G8WA 1KJRA 4GH4A 4GJYA 1XC6A 2QQVA 3T1MA 3WUDA 2J1UA 1O3QA 2FD8A 1J1LA 1W8TA 4RQPB 3HOYL 5I0UA 5IAVA 1W9TA 2YY1A 4WZCA 3PIP1 1RC6A 2H6CA 3VV1A 3U37A 5LRSA 2V4AA 3MIBA 1LB2A 1LHOA 3VZNA 2BE5D 1RUI2 1ZBE3 4JX0A 3ZYFA 4D7TA 2D97A 1LEMA 3HJRA 3PWFA 2ZGSA 1CX1A 5FAXA 4JKKA 1YV1A 1W9FA 1ND3A 4OI0A 2P5BA 2XJTA 1ENQA 1LJ7A 1UY3A 1MS0A 3M3CA 3QLQA 1BQ8A 3AL6A 1DZRA 4GALA 4ASLA 4S2HA 2WSUA 1ASJ3 3VDBA 5DZGA 1CJDA 2UYAA 5FLIA 1CX4A 2HKXA 1YFUA 3G6JB 3I8TA 5F6LB 4QPGB 2HWB3 1W04A 1JUIA 2B9UA 2BW8A 2YXSA 2LCQA 5T52A 5T5LA 1AYM3 3A7QA 3WX5A 5GALA 4CDUC 1TWFL 1UNBA 2H12A 4ZS2A 2IXIA 2Q8OA 1UX7A 1BQPA 3BODA 1PFYA 2D93A 5JVG1 2Q0AA 4JGZB 4YW4A 3UJQA 1LTEA 4FPOB 2W94A 3TN91 2KKDA 1BVVA 2P2KA 4EZ4A 3LQCA 1W8ZA 4W50A 3CO2A 2VUAA 4QPIA 4JHTA 4YM0A 3KZ4C 2W91A 4A7ZA 2Q8CA 5HCBA 1RDGA 4CZSA 5K0UB 1W6MB 2GNTA 2E7TA 2PLV1 4NR1A 4XF0A 3ZIWA 3CQZL 1V6KA 3M3YL 3RWKX 2M6OA 1UPSA 3LA7A 1YXWA 1TZOA 3VKLA 4E27A 4AFCA 1MS8A 3EB7A 1LCLA 2VMFA 2XPJA 4IV1B 4ONUA 1R0FA 1PVC1 1YQCA 4UFIA 4AR2A 5FBZA 5FXZA 4LHKA 3H42B 2DCZA 1YFXA 4JDMA 4BOWA 3ORJA 1GUIA 4FAGA 1RVF2 1WLDA 2VMCA 4Y22A 4CSWA 4YW2A 3TEYA 4Q0SA 1WZXA 3RPQA 3J9SA 1C09A 2AEYA 2VR4A 2OQ7A 2ZAAA 2JKBA 1ENXA 2WIIB 4HOOA 3PJQA 4YW3A 4D69A 1ND2A 1YHFA 5AC92 4LKFA 4H7MA 3KVAA 4IQPA 4RHV1 5BNOC 3IPVB 4H55A 3SCGA 2CTVA 3WZ1A 2ES3A 5L7OB 4NPMA 2HWE2 4PT6A 4A3IL 5FY8A 4AXOA 2G9GA 4AHZA 1AXYA 1K5MC 1RUJ1 2RS51 4PQQA 1QY4A 2XQXA 2D5FA 5AFBA 1U5IA 3BVCA 2JA8L 3P6BA 4HZFA 2OYZA 5FYHA 2VVEA 4A3DL 5KXEA 5CFDC 3DN7A 1J3RA 3AXDA 4AVSA 1HRI2 1Y9MA 3ZFEC 1FT9A 1V00A 2EAAA 4IETA 4FTSA 4XFGA 2DUOA 5IK5A 3NWKA 4PIYA 2WLPA 3KV9A 4C3JL 3C8XA 4QB1A 2XDVA 1SFNA 4LHNA 1QMJA 5LATA 5FOJB 3DPRA 2WO2A 3QD6A 2WAAA 1IKPA 1ODHA 3CIHA 4IEOA 1PK6C 1XE0A 1U12A 1EP0A 1T6BX 3RYPA 4DMIA 4DNYA 4B4PA 4BQ3A 3H0OA 1ULFA 1POV3 1GR3A 4M0NA 4Z82A 4QXCA 3HWJA 1BFYA 3N9QA 3ZXDA 2QVSB 2GNMA 2R041 2QL0A 1H8TA 4PF1A 1VE0A 3WT3A 5A6YA 2VQTA 4IEVA 1AR63 1VBC1 3MFAA 1D2SA 4IEPA 2R062 4RFT0 5A6ZA 3TAYA 1FPN3 2JG9B 4DB5A 1FMD1 1HQNA 2HBTA 5BXXA 1DFQA 2R92L 1O3RA 3AC0A 3AP4A 3NJZA 4HPKA 3O12A 3PO3L 3FHAA 2OZJA 2AQCA 4HBNA 4Y20B 5T54A 3OEAA 3VZKA 3UK9A 5FZGA 3LOIA 3ZYGA 4BYYA 1Z7S2 4KNCA 3M4OL 1DQ0A 2GDFA 2ADDA 3VDCA 5A7SA 4Q29A 4A45A 4Q4Y1 5FKBA 1T6GC 2EAKA 3H3VM 3FDJA 4XILA 3SEEA 4ZPIA 1C28A 3UL2A 1R1A1 2WFF2 3AYAA 4YG0A 3U10A 1JS9A 3H9AA 2OUJA 1V9U1 4P00B 3GM8A 4XJUA 4CEYA 2IWGB 5JXIA 5LA1A 2ZS6B 2B39A 1UZ0A 1PO12 2A6WA 4Y4RA 2QQPA 3DGTA 5BNQA 2WO3A 3K3OA 1CAXB 3VBUA 3ZYHA 2A73B 2CY6A 3WP4A 3B00A 5B4XA 5C33A 2TNFA 2FCUA 4UF0B 2LALA 4HKWA 4GS7D 3Q8AA 2VAUA 3ITQA 3LGRA 4P9WA 3S1ML 5AFEA 4YGEA 2X10A 3WINE 5BNPB 2ZX0A 3HQRA 1WW6A 3WHUA 5IVBA 2PFWA 1W6OB 2JA6L 2QBXA 1QQP1 2C4XA 4K7JA 1CAWB 5MFZA 1DHKB 1SLAA 1Z78A 2Q1MA 1WA6X 2ZX4A 4CYDA 1F9KA 1PGL2 1SMVA 3OPTA 2PXJA 4E6YA 4RQPC 1OMIA 4LBOA 1SMMA 1M4WA 4OMDA 2NM1A 2WNUA 4LT5A 1PFUA 5EYXA 4ET7A 4Y1UA 1W0NA 4V1PA 3ZSJA 4WV8A 1H2NA 4RN5A 4AI3A 3RZDL 1VMJA 3O1VA 2DCJA 3TEXA 5T3NA 5FZMA 1APNA 2SBAA 4B8CD 2BRTA 2YFZA 1BE7A 5JPMB 2RR12 1JYVA 1JYTA 4NWVA 3LOBA 1GP5A 1LESA 3M3EA 3MFCA 4K20A 5FZBA 2XJQA 1MEC2 4IL7A 5F32A 3E5UA 5BNNC 4URTA 4R4XA 1HB2A 4XTMA 4W6XA 5HI0A 3MHZA 4ZN1B 1E5IA 2X09A 4N43A 2NVQL 4OI4A 4Q4V2 3T09A 5J3UA 4GB32 3T3YA 1GZWB 5ABJB 2VUCA 3SH5A 1HXS2 4LMFA 4UXAA 1X36A 4QPGC 3ZKYA 1W8HA 3C7GA 1O7FA 5IJRA 3HVDA 2CDOA 2XGXA 1S0DA 2ZBJA 4ASKA 2JD4A 5FY1A 3VBFB 1QYBA 1UW8A 1BK0A 4QKDA 3NO8A 4XFFA 1NCRB 5JIUA 2WABA 3VHRA 1DVBA 3N9LA 3MUZ1 1GANA 2F6BA 2OPKA 1W9SA 1DQ2A 4DS0A 2NVXL 4CVUA 2YUEA 3UETA 1N3OA 5H1Sc 1JHNA 3PVNA 2JD9A 4YARA 5IT6A 1PNFA 5FPVA 4CCLA 4PIXA 3AKQA 3K3NA 3H0GL 2RFKB 2VW2A 4XJWA 4AR6A 3POBA 2UY8A 4COYA 4UBGA 1UU5A 2VZOA 5K0UC 2PHUA 5K2ME 3V0BB 1QH6A 3TBDA 3AL5A 3P2AA 3WHTA 1NKGA 3WP5A 5EJ1B 1RUE2 4GAZA 4LUMA 5IK8A 2DU0A 5EIYB 1GQPA 4JKMA 1CAUA 4IV1C 4C1WA 5A7QA 1RUG3 4A3GL 4FQ4A 4BPZA 3USUA 1LGNA 2FDKA 1KDMA 3N7LA 4X6QB 4YVWA 2NN8A 1O6UA 5IFPA 2VD7A 1JODA 2D43A 1NAEA 1K3IA 2HWD1 4HVRA 3M7AA 1AYN3 5JUVA 3K46A 4RS5B 5H9QA 5LBCA 4XIOA 3HQUA 4NUBA 4PLOA 3DXTA 1DYOA 2BERA 4QDQA 5FYMA 2R7ZL 3T4HB 3ZG6A 1X9PA 5CEHA 1QXRA 3LWOB 2WBKA 3TNQA 3IB3A 5IVFA 4TYSA 4IEUA 1O5LA 2FDHA 3W21A 3JD71 4DY5A 4P9IA 2XKOA 3ZN5A 1JZ7A 2TEPA 3BU7A 5LA9A 2JIJA 1V6OA 2J7MA 5DDJ1 3HOXL 3GF6A 4NIIA 4H3WA 4AEMA 1MZ5A 5BV6A 4CU6A 2NYDA 3DYOA 3DYMA 5CKMA 3ZXKA 5F2WA 3HNYM 4E2GA 2BGCA 5EIOC 3MLJA 2YC0A 1GQGA 5ACA3 2WDBA 3LKJA 3C7FA 4UW4A 1CZVA 2FDGA 1PGW2 2VQAA 5FYUA 3AMHA 1PHMA 1PO22 2XWJB 3NSTA 4UW5A 2JXAA 1REEA 5DZEA 2RDNA 3J7Z1 3CZUA 4Q5OA 4NRQA 3T0AA 5F7UA 5C3QA 3IDBB 4AEDB 2MEV3 4UT5A 1RUI1 3K48A 4EE2A 5D21A 2IXHA 1QJU3 1RYYA 3RYKA 1HB4A 1EPWA 3CQOA 1PMJX 3ZSEA 1DBNA 4QWNA 1JHJA 2F17A 3IKWA 4LKEA 4LBQB 5IWFA 4DOUA 3LSDA 1PX3A 1JUHA 3MIDA 2BVVA 4ZZ5A 2OVUA 1OF3A 1ULCA 3S6PA 1VCXA 1JI6A 5C8CB 3HOUL 2ZEYA 1DLLA 1K83L 1ULGA 2W95A 2DDUA 1S0EA 3CL1A 2YU9L 5HPOA 2DFCA 2VZRA 1YIPA 3FZ3A 2FCVA 3T2PA 3H50A 4BA6A 4XDPA 1VPHA 5E89A 3GBFA 3CJIA 2K46A 2GP3A 1UIKA 1W3XA 2BZDA 4CRQA 1F15A 1B2OA 2LS6A 3HD8B 3OUJA 1OURA 1QGLA 1ZRCA 2VOWA 1AR72 1UU4A 2W5FA 4HSJA 3LWPB 2V09A 1VZGA 2EIBA 2UWCA 3POIA 2WLQA 1K42A 1LGBA 2W1UA 3MPPG 3PUIA 4KWJA 1BKZA 5DQ0A 4Z8BA 4HVOA 3K4DA 3LFMA 4OQ8A 2JG8B 2J42A 3MV11 3B69A 2VNGA 5KXCA 1DYPA 3O14A 3VDDA 1W0PA 1LOCA 1W8NA 2L9LA 4Y1VA 4LOTA 4P02B 2QDRA 5BNPC 4CCJA 2C6AA 1EY2A 1U0AA 2RHPA 3NVCA 2W39A 3EQEA 2YBKA 4P9JA 1XBFA 1RVF1 4QHZA 4U36A 5D2AA 2A7AA 4COZA 5I91A 1QJX3 3EHKA 4IV3C 1R9TL 1JZ6A 3H8OA 5AI2A 2PMWB 4FPFA 3RGBA 3VZOA 4XF9A 4YW1A 4POGA 2XJUA 1AF9A 3FFQA 4A3EL 1ZZCA 3J7LA 4XTPA 2J1RA 1RYTA 1ZBE2 1GSLA 3LFIA 4ZS3A 1DIWA 1QF3A 1TME3 1T9QA 1VBB3 4FPHA 3WEZA 3WQ0A 4ES9A 5AC91 2R073 2RE9A 1Y43B 5A33A 5A80A 2HWE1 3PVOA 4PF5A 4BMEA 4D8MA 5A1AA 4UFHA 2BPA2 1S4CA 2NVTL 1AR93 1F31A 1STMA 2PHTA 2K9ZA 1MVEA 2PHFA 1A3KA 2UWBA 1EPZA 1Y7BA 4JQRA 4XOGA 5GZDA 4C91A 4LE4A 1ASJ2 1RIRA 3LWCA 4MX3A 4MYEA 4NHXA 4QU2A 1JN2P 5A3NA 2W87A 4HKOA 4Y26A 3OYWA 4D94A 5F37A 4LNVA 3WG3A 4FP2A 4R9AA 4A3FL 4M3CA 3H8UA 3AKPA 2JE8A 1QQTA 4CDXA 4CUGA 5AN9H 1Q8PA 2ZABA 4FVVA 4XCBA 3WF1A 1AYM2 3B93A 3ZMOA 3A23A 2CSGA 5FBJA 4BMBA 3ZFGB 3KD4A 1N3PA 1URXA 4KH9A 3S0MA 3ZR5A 3VBFC 4CDQB 2EICA 4FOWA 1NCQA 1J1TA 1QJFA 4ZXEA 4RD7A 4AYBP 4AFMA 1B35B 1ZX5A 2CGNA 5HV0A 2Y60A 2VQ0A 5GAEc 3AKTA 1D0HA 4GWIA 1CAVA 4QDSA 1KRIA 4XQDA 3ZYBA 4DZGA 1HRV2 1GKBA 1YI7A 2R061 3MUY1 2WZPP 4D6RA 1BMV2 2VY0A 4XF1A 2DBIA 5T5OA 3E6DA 5FZ0A 1RUD2 2RS33 1TWAL 2Q4SA 2IXLA 1IZ3A 2BEOA 2JJ6A 3HPNA 3M8LA 1X50A 1G9DA 4GQ7A 5FYVA 2NPIA 4F8AA 2NVYL 4IEWA 2WRAA 4MXWB 3ACIA 1Z7S1 4BIOA 5K8SA 4LIUA 1AR83 4RR3A 2E9QA 3RZMA 1LAJA 1W9WA 1W6PB 4BBSL 2IXCA 2Y0IA 5FLJA 5SV5A 3RJRA 2PQQA 5A6QA 4KG0A 1R092 2VU9A 3U78A 5DM71 1OOPC 2WFF1 4IXLA 2MS3A 1JYXA 2AR6A 3VPBE 3AMQA 3Q8BA 1HJGA 4N7IA 4RS5C 4YZ3A 3AM2A 4K8RB 4CDUB 3THTA 1HB3A 1VR3A 1RUC3 3HOBA 1PO11 2UURA 1S2KA 5HXMA 1NE6A 3AYDA 1GZCA 3I97A 5A6XA 5JVH1 1HIXA 2HWC3 2GC3A 2XL7A 3HNBM 5FZ7A 1PX4A 3WUCA 1KFXL 5C9AB 2A71A 2VJXA 3WP3A 1QHDA 1VZHA 4KBBA 2N7GA 1FHHA 1QKQA 4BQWA 4KWKA 4BU2A 1ZBA3 1BJQA 5FLML 4O9EA 4QPWA 1WUVA 4CP1A 2PAEA 2ZXQA 2J9UB 2HLEA 1XXNA 2UYBA 2B5ID 2A6YA 4FT8A 4LBLA 1S2BA 2ID4A 1PIV3 1QOTA 4QHOA 5GZCA 1X33A 2VCCA 3RI8A 3ZSLA 3I2JA 5M3ML 4ZN3B 4GH4B 3POJA 5KHHA 1VBA3 3BALA 3OBRA 2WA4A 3KF5A 1YFYA 4LBJA 1VALA 4CUBA 1PGL1 3H3UA 1OLRA 4R9DA 3MIEA 5F5QA 1C8M3 3R05A 5LW9A 3RI9A 1MVQA 2ZTNA 5C3SA 4JHZA 1AR62 4A4AA 1B71A 2XJSA 2ZGOA 3OB8A 4YGCA 1FPN2 4DXRA 1B2JA 1COV3 5CKQA 1WLWA 5CVRA 1ND3B 3T4VA 2RR11 2WS92 4QX1A 1FOD3 1OSGA 3S57A 1DLCA 1TNRA 4PBOA 2VZSA 5CB7A 4H14A 1SMUA 1MEC1 2VQUA 4ARXA 4AQTA 3RQ0A 5FZLA 1WWYA 5IYCL 4E4ZA 2HR5A 1H4HA 2GC0A 2ZHLA 4Q4V1 5C8CC 4GB31 3EO6A 5APAA 2WWJA 5CFDB 1HXS1 3PIGA 1QU0A 4CU9A 5FY5A 2VMIA 1R64A 4PLNA 1XNAA 4XFAA 4L9BA 4ES8A 1DQ6A 4ATEA 3QH7A 4I3GA 2E51A 5C3RA 2QZ2A 1U5ZA 4X6AL 1MACA 2YPJA 1BK1A 1R1ZA 3LEKA 3N9PA 1VP6A 1NY72 5HCAA 4NIGA 4E8CA 2KA3A 2FZ2A 4DFSA 3ACLA 2XLFA 3HQXA 1RHI3 4AFBA 5BPXA 1TMF2 3BB6A 1WW4A 1XYNA 2YU1A 3K4ZA 1TWHL 1VBD2 1SG3A 2KM2A 1XU2A 3R4UA 1X8MA 4O7XA 2EA7A 4QD2A 3IIAA 2YV8A 5FZIA 1G86A 2CNAA 5F6KA 5FCCA 5C4WA 3WWLA 1V6MA 3H99A 2ZGQA 3J8F3 5I8SA 1U5XA 1IQDC 5TSWA 2W46A 2RVAA 5BYNA 4Q8LA 1Q8VA 2VC9A 3GJBA 1CIYA 5DMYA 3E1F1 1FYUA 3POEA 5JVVA 3ZYPA 1EV11 2V4VA 1SZBA 4YZ4A 1WBLA 4BK5A 4E9KA 1UO9A 4AR3A 2ATFA 2EIEA 2JB4A 5E6HA 5LASA 4YWAA 3V56A 1IKQA 4BQ5A 2VZPA 3CMGA 3UNPA 4UW6A 3SH3A 1MPXA 4GMP3 4QMAA 3UT0A 4LBMA 5FUNA 1CJPA 4D7YA 3V0AA 3RZKA 2WZ8A 4JGYC 4CP9A 3T30A 2ET1A 3HOZL 1H30A 1LOAA 1BEV2 3WW3A 5ISLA 4AVTA 3WDUA 3B01A 3TB0A 2Y6LA 4EN0A 5D8AA 4M3CF 4XUOA 4YWMA 5A3WA 4BWOA 3LF7A 2CYFA 2R0HA 3OF1A 1S0CA 2X8KA 2XMLA 3I3QA 2M6PA 2X05A 4UBHA 2E2IL 1AL23 2X5IA 2KR2A 4CU8A 1O91A 2VNRA 2VTXA 2A75A 1AHSA 2VBBA 1S0FA 2Z3RB 4FO9A 4Q4X3 1YJLA 4N53C 4XFIA 1XSRA 3MGUA 1FXZA 4OHXA 3WNKA 1P8JA 2DFBA 1E5HA 4AI9A 4AE2A 3H7JA 4PDWC 1UXXX 4UFMA 1JZ5A 1Q3EA 2VCAA 1LOFA 1DGRA 3BTXA 3FE5A 3OPZA 5CFCA 4NIDA 4NHLA 5CIRA 3DPRB 2RJLA 3LDKA 4JRLA 4DRVA 1PGW1 3HOVL 2BBAA 3OG2A 4TLGA 2R93L 3L2YA 1PO21 2PVXA 1L3JA 2Y6JA 2ZACA 3NMBA 1POV0 2DVFA 2ZJCA 1UMHA 4EWDA 1GFF2 3KLSA 2IUWA 2VECA 3SLIA 3VBHA 4CDQC 2Z2SB 5FYSA 5B2GB 1O8SA 4YFWA 4JTOA 1QWRA 3VGIA 2GN3A 1B35C 2XBO2 3U4XA 4XEZA 2VULA 5L36A 2Y6HA 3WD5A 3HIFA 1J58A 3WDYA 2HVYC 4NPLA 5L73A 3NNGA 2WN3A 3HNMA 3TN93 2V5YA 4RA0A 4MOAA 4JAEA 3BTYA 1RL3A 1TE1B 1W39A 1N1TA 4O61A 5CNAA 3N4MA 4OULA 3IDEA 1ZZ7A 4TZDA 4XBNA 2PLV3 2C24A 4QGNA 5F8PA 1JYCA 3H3LA 3T2QA 3I7DA 3LNLA 1UYYA 1MS3A 1XRUA 1YNAA 2Z69A 3CEWA 5BNNB 3O1SA 3NFPI 1NLRA 1XQNA 2JKXA 5AVAA 3ZFFA 2AYHA 2ZHNA 4WM7C 4CEWB 2D6PA 1PVC3 4IUGA 4W4ZA 4U671 3HT1A 1F5FA 2VZ3A 2ZEZA 4TPUA 4QKFA 1I5ZA 4R9BA 1XPWA 4UI9L 3FBYA 3KGZA 5FY9A 4N7UA 1AL0G 3BCWA 2ERFA 3POWA 4CEYB 4EN7B 5BNOA 4RGAA 3VZMA 3H97A 2W3JA 4YM1A 2YROA 5FJ8L 3I4NL 3VBRC 4HETA 1VBE2 4QXBA 4A93L 1H9PA 5JSOA 4LR4A 1AR71 3KHBA 1H7VA 2A3YA 4BY1L 4XUPA 3ZXAC 1MZ6A 2YBSA 2AEZA 3BN6A 2XL9A 4RHV3 3ZDVA 2IXKA 1OBNA 2OUHA 5LRRA 4FTEA 3MI8A 4BJ0A 3ME2A 4KWLA 2G9FA 1S30A 4QM9A 4BQYA 4DRRA 2VE1A 5C9AC 2OX0A 1F8VA 1RUJ3 1O5UA 2RS53 1A78A 2C1FA 1RB8G 2XUEA 5A32B 4JADA 4XHBA 3GDBA 1O4TA 3KVBA 4XAAA 5A3UA 3VKNA 4AQSA 1H6YA 1DYKA 3W9AA 5FPXA 4LXLA 1HKDA 1YWKA 1UN1A 2XKPA 3ZFEA 5FK8A 4G6BA 4HMZA 2AZ5A 2WZR2 1S0JA 3KM5A 1ULOA 1F2NA 3FFZA 4LA2A 4A6SA 1W6QA 1RDVA 4GH4C 4N9HA 4YZ1A 3NL1A 5JCTA 3PNAA 2R32A 5F3EA 2WNUB 1OPMA 2F4LA 2GMPA 2MEV2 5FZDA 3WG1A 1CIWA 4JCKA 5M3FL 5FZEA 1QJU2 1W8UA 4OVEA 1NXEA 1CADA 3NV4A 3K35A 2Y0SP 2A5ZA 2M4YA 2GC1A 3AZXA 4XETA 4AF9A 2A69D 2R043 3KCYA 3NNJA 4GJZA 4Q1PA 2QDNA 3J7MA 2VW0A 4GA9A 5I0RA 3LDRA 1ENSA 2E53A 3LDBA 1UKGA 1VBC3 4S2DA 5H9PA 1ND3C 1WBFA 1H0BA 1OT5A 5M5YL 4AGGA 3KYYA 2JENA 4DQAA 4FPEA 1FMD3 3C7HA 4CPBD 5A3TA 4FPYA 1GNZA 3PIO1 3AX4A 4N43B 2YMZA 3CNAA 1CN1A 3ATGA 1WD4A 1YQ6A 2XONA 3I2GA 3O0XA 2PQSA 3UKTA 4AVVA 4D6SA 2D98A 4LE3A 2WQ4A 2VUJA 3WNNA 3Q8CA 2B4KA 2VZQA 2ZAHA 2BU9A 1MS9A 3D0SA 4FFHA 1PVXA 4Q4Y3 5F3CA 1LOBA 2UU8A 3DECA 4WVMA 1Y1VL 5FP4A 5LA2A 1PZ8A 2PHXA 4JKLA 3HAGA 1R1A3 2RMU3 2F4PA 1V0AA 4LO4B 2LUWA 2LW8A 1NA1B 3OD4A 5FPLA 4IERA 4XABA 1V9U3 2R16A 3OGVA 3BKZA 3M3OA 2JDHA 3U1XA 3H9BA 1HRV1 3OY8A 5JXGA 3PTYA 4QPIC 5EV7A 1BMV1 4FOVA 1PZ9A 3HN3A 4FPCA 2JDNA 2YG0A 1RUD1 3ST7A 4Y24A 5J98B 1O3SA 4OUMA 5GZGA 1SLTA 2UY9A 1NLSA 4A3KL 2J1AA 2JI1A 3WDWA 3DEMA 3GGLA 3JQWA 4KMQA 5FYZA 5C3EL 2WYFA 1TQ5A 5JOWA 1E57A 1SPPA 3IWZA 4LO6B 4NHKA 4BK4A 2ZPXA 4Y52L 3ZM8A 1GBGA 4YVWB 2XVLA 1UPIA 3L2HA 4JZRA 2A6XA 2R1BA 3SXWA 2WQ8A 1QQP3 4MHUA 1JZ8A 4L8QA 1R091 4XZUG 1Y9QA 3AZYA 4JAGA 4AI2A 4QAWA 3MICA 4QX5A 2JE9A 2VBPA 4XBQA 1E8JA 3M3QA 2A6ED 1V70A 3PKIA 2YDEA 2GZWA 4BQXA 4CXWA 3S14L 1HV0A 5JDBA 2BBVA 2R49A 4QKNA 1OWBA 2PSMC 1F35A 1RGSA 8RXNA 2AC1A 2QQKA 3WLUA 4AYUA 4DPNA 1IG0A 1BYHA 1W99A 2B8MA 3GTOL 4AGVA 3WDTA 3ZSKA 1W2OA 1RUF2 4PHZA 2A3XA 2P3IA 4YW7A 1M06G 1UIJA 2HEWF 3A0NA 5F39A 4K6BA 1NG0A 3Q8EA 4XDQA 4XQWA 2VGDA 1R0IA 4C3IL 1QXPA 2ZKNA 5F5CA 4NJ4A 1VAMA 1YYNA 2E63A 3FMGA 3POYA 4YVSA 1DDLA 3ZX7A 4QXKA 1ENRA 1VMHA 4QQLA 2QZ3A 4QPGA 2V0FA 3OBTA 3LPEB 1UD1A 3NJXA 3GHNA 1F5JA 3RZHA 1JYBA 2BFUL 2CHHA 2DU1A 2WNVA 3DPRC 1RMU3 1IS5A 1WD3A 1X7NA 3JB4C 3ZMNA 4MGSA 4BISA 3E6CC 4IV3B 4MGQA 2Z42A 3AJZA 1YLLA 3O1PA 4A2UA 1S2EA 2XJRA 1AR61 1RUH2 2D3PA 4AWDA 5KHJA 4A41A 4JGZA 3B94A 1WCUA 2WAOA 4AVBA 4ZU7A 1FPN1 2ZEXA 4B4QA 6RXNA 5IK4A 3W5MA 1CD3G 1PZ7A 2WS91 5C8WA 1GOHA 2V73A 1ZRDA 4IW3A 1RJ7A 2H6BA 1EAH2 4LO7A 5K0UA 4W6YA 1ZVFA 3VDAA 4HFSA 3BTZA 1YRZA 3ABZA 2WC2A 2I45A 4LTAA 2PHWA 3M3IA 5FFOC 1KQRA 2Q5TA 5JOYA 4IV1A 1VZIA 2VTXJ 2W92A 1ZRPA 4AR5A 1UU6A 4CEWC 5LK7B 3RZLA 5HCHA 3KT7A 3C7EA 4GXLA 4QB2A 1GLHA 5GZFA 4JAFA 3J26N 4FPKA 3GTML 3AP7A 4FOYA 4DINB 2SLIA 3CJIB 5AVPA 1OFSA 1ULDA 5I8YA 4Q4W2 2MPFA 4CEYC 2XB6C 5C71A 1LHVA 3PU3A 1RUC2 5FWEA 1NY71 2HWD3 4KU8A 4ITCA 4TSVA 3BUCA 2E7AA 2ORZA 1QJY2 4K9FA 2HWC2 1TMF1 2NMOA 1HX6A 3IPVA 2ILMA 3VBUC 1VBD1 3GBGA 5J48A 1US2A 3U4SA 5L7OA 1K45A 2JDAA 2RM22 4FXGB 5HBAA 3VD7A 3JD73 4RSUA 1ZBA2 4COUA 1X8EA 4YRDA 5C70A 1AXZA 2P4EA 2ZMKA 1WCSA 4BXXL 4JRAA 2YGLA 1F4AA 1ZRIA 5DDJ3 2E7QA 5IY0A 3QBQA 4Y1XA 1KEXA 2QQWA 4A42A 2R1DA 7RXNA 4BY7L 4FI9A 4J1XA 4J1WA 5H9SA 3SS2A 1PIV2 5FQ0A 5DM61 1BQ9A 1MQTA 1N1YA 1JW6A 1MS5A 2GC2A 2EALA 3HR9A 4GKYA 3FLTA 5FZHA 3GXUA 1BEV1 1W05A 3M4FA 4PI2A 1UZZA 3URFA 3WCRA 3Q8FA 4K21A 2WNUC 3OJBA 3HOWL 3KYXA 1OD5A 1XE8A 2QCSB 4YGBA 2ARAA 5LZ6A 1OOPB 5FTTC 4MV2A 3P1IA 1LHWA 2FMDA 2ERJA 1COV2 2ZX1A 3F95A 3AVRA 2RDVA 1RUI3 3CLPA 1DCSA 2WYSA 1NNQA 1S2ZA 4A3BL 1FOD2 3P3PA 4MVTA 2O8QA 3U11A 1UZWA 4EN6B 3LB9A 1CPNA 2CR8A 1NLQA 2WO7A 3UYJA 1RYQA 3I54A 1REFA 2JG9A 4YZ2A 4LKSA 3P8BA 2A68D 2VW1A 2VXRA 5DPNA 4PQ9A 4A3CL 3OYWB 3AFGA 5FZAA 3UJOA 4C8DA 3VBOB 4M3CB 4N43C 1FI2A 4XFBA 4Y20A 1AX2A 5IUQA 4CDXB 4CA9A 2E31A 3R4SA 2OIIA 5F3IA 1GWMA 3L9JT 4WVZA 4OHWA 3FHQA 5IAXA 3VLBB 1E5SA 4TVMA 2YZ4A 3T0BA 4QDRA 1JU4A 1I5PA 2CGOA 1SCSA 4NVPA 4Q8KA 3BIWE 5FP9A 5GADc 5T55A 5FMOL 2XBO1 5FZ9A 1KITA 1NA1C 1RHI2 5FR3A 3AXEA 3ROUA 4E4HA 3OOXA 2KXLA 4RFRB 4L97A 1CAXA 1CESA 4S2FA 3ASIA 1I6XA 1PM4A 3MIGA 3IM0A 1I1EA 3ZLIA 4P5HA 3H1MA 4OYUA 2WINB 4ZONA 3SH4A 5JXJA 3ZN6B 1D4VB 4UF0A 4B7EA 3NNFA 3WF0A 4WVVA 1LKNA 4HG6B 1HQWA 3GTJL 5I0SA 4RR3B 3N7KA 2X53S 4HSLA 4L92A 4Z92B 5FZKA 5BNPA 3IU3I 2CDPA 1IQAA 3SKVA 3ZXEA 4DEVA 3JZVA 2E2HL 4PJYA 1BLZA 1W6OA 2XVGA 4ISRA 1IRNA 2GNBA 4YVWC 3PU8A 2PYAA 3GTQL 3KQRA 1RVF3 3QCWA 3SKJE 2DF7A 3ZIXA 3MW3A 2Y6GA 2OA2A 1I9RA 4EN9B 4A6OA 2D6KA 2HWF2 1CZSA 2LTNA 2KD7A 4L0PA 4A3XA 3KCCA 1VBE1 1JU3A 5FXXA 3V65A 1J3PA 4E8DA 1AL22 5LBFA 2A3WA 4RGGA 5AC93 4NPRA 5DAPA 3JBG2 5IVCA 2RS12 4EROA 4AQ2A 5F5AA 5FUPA 2WUHA 2HWE3 4Q4X2 2J22A 2JE7A 2DWRA 3NAPB 4CE8A 4QKBA 4BXFA 4CP0A 5DUWA 1H1MA 3RZ6A 1W6NB 5FXVA 4CDWA 1Y4WA 5FP7A 1LNSA 2RV9A 4NE9A 2D5HA 3OBZA 3THPA 3O1RA 4GWJA 3WNOA 1LKOA 2R0FA 2ZGPA 2VPVA 1GZWA 5ABJA 4B3NA 2WZR1 4WM8A 4AR4A 2EIGA 1AVBA 1R083 3CZJA 4XJAA 3FUOA 3B08B 5DUXA 5EXOA 5C3OA 3FX3A 4SBVA 2RDQA 2I2SA 2FHRA 2JIGA 5FJKA 1US3A 3I3DA 1LOEA 3SEPA 1TWCL 1VAKA 2DTWA 5T5JA 1NCRA 2MEV1 2PHDA 4JGYB 2KN9A 1UY0A 3E5XA 3TRSB 1C1LA 5LY1A 3LD8A 3OPWA 1IHMA 3N9OA 3H8XA 4I30A 3RYRA 1IPKA 1H4GA 1CWPA 2MHFA 1OKOA 2VNVA 3BIEA 2O5JD 2R063 3VZLA 3VBSA 4XF3A 4COVA 4FPGA 2ZOEB 1C3HA 4MLOA 1UF2C 4BZ4A 5IP7L 1EUTA 2EXIA 4BHPA 4K8FA 4QGMA 4ATFA 1PMIA 1QOOA 4P08A 3V0BA 4AI0A 3KGLA 3OCPA 2JEMA 1UOBA 4LK6A 4N53B 4BM8A 3KT4A 4RL7A 4MGTA 3DYPA 4KQ7A 2C26A 2OXBA 3NW4A 1BVP1 1OKQA 1PVC2 1SBFA 1ST8A 1REDA 1V6JA 1Z7S3 4PDWB 4YYOA 3UGGA 1IS4A 1HRI1 5LBBA 2HWB2 3USSA 2BOIA 1NXMA 5A3PA 4NHMA 3LSEA 1KFUL 3IBMA 1UL9A 2H0BA 3RJ2X 3MSUA 2I74A 2WSVA 2BGOA 2ERSA 2ZGKA 3CJIC 1Q8OA 4IEQA 2V5DA 2ZGRA 4XZPA 3U14A 3NQHA 1H9WA 1FNYA 4WVWA 2BUKA 3I2IA 1WMFA 4RS5A 3JB8A 1BXHA 4XFCA 4XW3A 2WT0A 1JYNA 3PIJA 4LBKA 3ZO0B 1GOFA 2GH8A 4LJHA 2G9ZA 1UQXA 3AP5A 1KGYA 5F2SA 3S16L 1H2KA 3IAPA 1XNBA 3PLQA 4AL9A 3RWNA 3FL7A 4YPJA 4PBPA 3PHMA 1JH5A 3KCXA 4L11A 3VDDC 4Y1YA 5CYYA 1JOJA 1VAVA 2ZIXA 4C0BA 3EJKA 2WAQP 1UZYA 1NUKA 4M4RA 3WF2A 1H2LA 3MEPA 4GMP0 2P37A 4B29A 4P14A 2ZHKA 5FOBB 2PHLA 1GYKA 2BNNA 4J6GA 4CPBA 5JZGA 3VL9A 5EINC 3H7YA 1WLTA 1IOAA 4GWMA 4B4RA 2FDIA 2A70A 4WM7B 4UFLA 4XUQA 1OUXA 4A7KA 2W47A 4CCEA 1MZEA 1SHWB 4N8MA 1JZ3A 2YC2A 3PMEA 2C6BA 1BBT3 3DL3A 4IE7A 2VH9A 4PCRA 2WT2A 1CPMA 3Q9OA 3TNPB 1W2TA 2ENRA 3JR7A 3P3NA 4ZHNA 3BOWA 3N7MA 4DXZA 4AEDA 2HBUA 4YW5A 1SCRA 5GJ6A 1WW5A 2BNOA 3MLKA 3VD5A 2BWCA 3VBRB 1W90A 2DV9A 2FCTA 4HN0A 1LRHA 4TLFA 2CV6A 1N47A 5GLTA 5A7WA 1KS5A 1RUF1 1XYPA 2BYVE 2RR13 3N35A 5C6CA 3S7IA 1L7RA 2EXJA 4L2NA 3M70A 1MEC3 5JIAA 3VD3A 4FSJA 3TWIA 3VBOC 2Y8KA 1W06A 1CONA 4CCMA 4CDXC 2P3KA 2VVDA 5C8CA 2GALA 4Q4V3 4MGZE 2OS2A 5JSPA 4GB33 1OC1A 5E8AA 5D1IA 3S5QA 4XJ9A 3RRDA 4PI0A 1HXS3 4EN8B 1DQ5A 4FBFA 3WF4A 4MG2A 2DURA 3KS7A 1XE7A 2RMU2 2JDMA 5J37A 3R0RA 1JMUB 4YG6A 1DF0A 1NCQC 3VBHB 2YHJA 4XIKA 3VD4A 5T50A 2BFUS 2W1QA 2M4VA 2BDRA 1AJOA 5K9YA 1RUH1 5MFPA 1C1FA 3D3AA 2FDFA 3N7JA 4Z2WA 3H8RA 4BLIA 4Y5Z0 3KYUA 3SCHA 3UKNA 2VG9A 1IS6A 2IZWA 4LIVA 5T5PA 5KC6A 3I4ML 4DUWA 5EFUA 2E32A 5FY4A 2ZZJA 1IROA 3APBA 3LIHA 2P6CA 1EAH1 2B45X 4LITA 3R6SA 2JG8A 1Q5OA 2JX9A 4HANA 4AZZA 1G9CA 3X29B 5FYIA 4RR3C 2W1WA 4XXPA 1P7PA 2Y6KA 5C44L 1EV13 4KL1A 1LECA 3RMYA 5FWJA 3PZAA 3LWQB 4GWNA 1OA3A 1C8NA 2CAVA 2PN5A 2VCBA 1SACA 2O0OA 2VZVA 1S55A 2DYCA 3BGAA 3MV01 4XMAA 4YNIA 4AEJA 2WB1P 4LEJA 5BNOB 3S2HL 4Q4W1 5IATA 1W28A 4TTGA 5A3OA 1K12A 1RUC1 3EBRA 4OHYA 2BVBA 1AZDA 2E26A 1T9PA 3J4UH 4Q0PA 5FDBA 1QJY1 2HWC1 5JOZA 4I0AA 4M01A 1BHGA 5FRAA 3VHNA 3FWEA 2EXKA 1VRH3 2RM21 5CZKA 5DG2A 4Z1VA 3VHPA 3NAPC 1ZBA1 2YC4A 1YI9A 2XG3A 4QPIB 1SEFA 5J96B 1LHUA 2WWUA 5IFTA 4KI5M 2JI2A 2JI3A 1AUYA 2DCKA 5A1FA 3DUIA 4M00A 3W5NA 4A3ML 4Q0QA 1D4M3 1PIV1 3AZVA 4FP3A 2GMGA 2WNEA 5L19A 4EYUA 4LA3A 4NHYA 2LM3A 3H1WA 1RMU2 2OZ6A 1RUE1 3R4DB 2D7FA 3AP6A 3OSDA 2OKXA 3JXSA 4ZU5A 3ZFGA 4LQRA 5DXDA 2VMGA 1WMDA 3N36A 4Y22B 4A3JL 3AK0A 1SMWA 1PO23 3FC0A 3SISA 4CDQA 3MO4A 1IW7D 5IYYA 3VN4A 1QJEA 1OLMA 2JDYA 1WW7A 3VUOA 5FYBA 1NZCA 2ZGUA 3U75A 2Q8EA 3ES1A 1X82A 1ND2B 4KG8A 1FOD1 2JDPA 5JOXA 4HXCA 3BI3A 2XXZA 3K7AL 2B7YA 4KU7A 1OD3A 5DAQA 3ILFA 3SQOA 2X29A 3K75B 2FMYA 4O9GA 5DN2A 3WY6A 4LORA 4I3PA 1YQ8A 5H9RA 2WQZC 4W6WA 5DAVA 3KSCA 4I01A 3LEMA 1W2UA 3IDAA 3T1LA 3H9CA 4XMIA 3RZGA 3M1HA 3NNMA 2A6VA 1ZZ8A 4MXWA 3DF0A 1LKPA 2C6SA 1OA4A 3RFRA 1W03A 1LEDA 4YLZA 5FKCA 1W6PA 3SNMA 1T9OA 2HYKA 5IVVA 5KWRA 2ZMLA 1A8DA 5FZCA 1NZIA 4V2VA 5CU1A 5EQUA 3WF3A 3RG0A 1NYWA 3VKMA 2V0EA 2P17A 4AK3A 4M4PA 4XAEA 1MR5A 1RHI1 2VMHA 4CDUA 1Y3TA 4POFA 5GLVA 4EJRA 3K2OA 2VM9A 2DVBA 2XUMA 2R7EB 4Y7NL 4ZXKA 1AR73 1H8TB 1VIWB 1ODNA 1G7YA 3JD72 5FPBA 3JQXA 1G9FA 2EF6A 5FMOS 1SQ4A 4WFN1 5C4WC 5C9AA 1GOGA 1NX9A 3WVJA 1XNTA 3I2DA 2V3BB 3POSA 2BQPA 4V196 4HPKB 3RMXA 4P5YA 1LU1A 3AVSA 5DZFA 2OPWA 4NRMA 1W0OA 3FLPA 1KDKA 3GCWA 1SPPB 2RDRA 4QQHA 2VUML 4XYXA 3UKVA 3GTKL 2GNDA 2XQRA 3GZAA 4UAPA 2L0ZA 2PYTA 1RUG2 3LPGA 2OT7A 5MGNA 1ALYA 3KHCA 5CG9A 5FZ4A 2YFUA 5IYDL 2XLGA 2ARBA 3FJSA 5FPUA 3OGGA 4LO5B 4QX2A 2BOJA 2HWF1 5D8AC 1HW5A 2ZX3A 3ETPA 3INAA 4OLLA 2E6VA 4OI2A 1AYN2 3IN9A 4MXVA 1RXFA 1AL21 3JBG1 2RS11 3S1RL 2X5IC 4XE9A 3WG4A 4CUCA 1CVNA 4UWDA 2DBNA 1H1AA 3ILNA 4CTEA 4HVQA 4Q4X1 5ERLA 2JA5L 1UAIA 4QQ2A 3HBKA 2DTYA 1Q8SA 3H1YA 5E16A 3VBUB 4A44A 4AI8A 3O1UA 5A70A 3N9MA 5JMOA 5FUIA 3GALA 4I0BA 5FZOA 5C5TA 1K5MA 2W68A 3D82A 1QNWA 4PIZA 4YVSB 4B8EA 1GQHA 1OWCA 3WQ1A 1LOFC 1W8FA 2K0GA 4E4DX 4CCCA 3FKIL 5IW0A 3S2DL 5CFCC 2ZGTA 5L9RA 2C0ZA 1T2XA 5CFDA 3POGA 1DGRN 2WNVB 4BQ1A 5ACA2 1JBCA 3WNLA 4DO0A 2QQOA 3ENRA 4GULA 4FFGA 2C9AA 3I2FA 2UWAA 1KXGA 2NZ9A 5E88A 2AENA 2ZZQA 4QX0A 2ZMNA 5LA0A 3VBHC 2W52A 2Q1FA 4BE3A 3ZPYA 4JAAA 3CHXA 2P1BA 2QE3A 1RB9A 3B5LB 4LO8A 5FXWA 2GN7A 1PK6A 2JA7L 4K1ZA 1O3TA 4G4FA 2C5DA 2APOB 1EUUA 1ZBE1 2EVXA 1DG6A 1DZTA 1SDDB 4OFGA 2PELA 3ACGA 3CBNA 1HRV3 3GZTB 3MF9A 3K4AA 1QEXA 3E97A 1GP6A 3MIHA 4IGPA 1MS4A 2Y33A 4P9GA 4AEKA 2W9XA 4XUNA 1RUD3 2CL2A 1N3QA 2G19A 2GP5A 4C90A 2WWSA 1WCKA 1ZNPA 1CR7A 3GZEA 4CCOA 3ACFA 1OPOA 1ASJ1 4Y1ZA 5C4XL 5FP8A 2Y0OA 1OA2A 3EYPA 3WNXA 3ZXFA 3GYDA 2OQ6A 1D7PM 3DCQA 3ZFFC 1DGLA 1W2NA 3MZHA 2HWB1 2QQNA 1OQEA 2GSYA 3E5QA 4CU7A 3GJAA 1UYXA 2YYOA 1SLIA 1E5RA 4DXTA 4JV4A 1AYM1 1WCDJ 4YWLA 3ACHA 2D6LX 3CJXA 3G7DA 1ODMA 2BV4A 1Z0HA 2ZKLA 2ZHMA 1R093 3IZOA 1XNKA 4BQ2A 5BY5A 2HEYF 1JTZX 1LODA 1AXKA 4TXWA 5KBFA 5IP9L 3UESA 3ZVXA 2DVDA 2R30A 4AI1A 4KGQA 1UY2A 4Q0UA 2PHRA 5GLUA 4LBQD 1Q8QA 3DXUA 3FN9A 5DABA 2AGSA 2J1SA 1YEWA 4BBRL 5FMCA 2WT1A 5C3PA 3GTGL 2WZEA 3GBWA 5LY2A 3PUAA 2GU9A 1ACCA 1YK4A 3I59A 3ZPOA 2DSXA 3ZSMA 4JDNA 1KD7A 2IVIB 5FQ0B 3TEWA 1R082 3EXUA 1MQTB 3MBWA 4QX8A 5F9TA 4NIHA 4X8PA 1H6XA 3WW4A 1GNHA 1HN1A 2WR9A 1CAUB 5FZ1A 1ZYBA 1I6HL 2Q30A 3GHMA 5J1XA 1SLBA 3USUB 1QJX2 1LTLA 4QIWP 3RSJA 2FQPA 3K77A 1YK5A 3ON7A 4WBBA 3O1TA 3B7MA 4QPYA 4AVCA 3IDCB 1IU5A 2IFWA 3PDQA 1G9BA 2VL4A 5A3MA 3N9NA 4RYDA 1VBB2 1TME2 4RQPA 5GZEA 1UX6A 4HK9A 5K7PA 1O4YA 2D3RA 2NMNA 2R072 1ND2C 3IMMA 4OHVA 2HH9A 4QX7A 5FY7A 4HT1T 3WDVA 2QJVA 1W8WA 4INDA 1FNZA 2WS93 3LEGA 4OUEA 4UW3A 1AR92 3C3VA 3CF6E 3BYWA 3QVDA 1BCXA 1OLME 4HLTA 1SFOL 5GAGc 1TEIA 4HONA 3O1MA 1RTVA 3LAGA 2BNMA 3WP6A 1XB9A 5BNNA 1DGWA 1QDOA 3I49A 2D6NA 3RZJA 4CEWA 1GZTA 3NJVA 2XJPA 2W0XA 4MGKE 2RMU1 4CXYA 3SCFA 1ONAA 4X6RB 4L99A 3KMHA 1VLNA 2WNOA 3PUQA 4D0QA 2CU5A 5M5WL 2QNKA 4QQPA 1KS4A 2EY4E 3NRUA 5MLC3 2K2SA 4MZUA 4K1YA 5GKAC 1IGOA 1HN0A 1POV1 3AJYA 3C7OA 5C5UA 4EWAA 5CAZA 3FUQA 4XDOA 1YO8A 3B9CA 2IC1A 2ARXA 1TNFA 3POFA 1H8TC 1TMF3 4Y33A 1VBD3 3GTLL 1KJLA 1V6IA 5CBLA 1DQ4A 5FO7B 1TWGL 3A44A 4Z2AA 1HDKA 2RS32 2ZX2A 5A32A 3AYCA 5JWPA 2VBDA 3WSOA 5CADA 3WG2A 3ZR6A 1S0BA 2XVKA 1PNGA 2VCMA 4LLOA 5ANQA 1W6MA 1XJAA 4LULA 1PZXA 3NKTA 1LOGA 2HYXA 4LUKA 1AR82 1HLCA 2B5HA 2NYYA 3KV6A 3MW2A 2FBEA 5FPZA 1C4RA 1PFWA 3O0WA 4LBNA 1XNDA 2H0VA 4F3JA 3HKZP 3AB0A 2PTMA 5BUVA 2QTWB 1BBT2 1OH3A 2DVGA 1N1SA 5DUVA 4JQTA 4H7LA 1BEV3 4AFDA 2A6ZA 4MGIE 3RS6A 1DZQA 2GMMA 2JB8A 3J7HA 2VVFA 3UV9A 4IESA 4AAXA 2D6MA 1QXJA 5EJ3A 4CUAA 1HJFA 4XGHA 3E6BA 3GZUC 5DAXA 5K4LA 5F1RA 3VD9A 3I3MA 1FAYA 5IK7A 3HMYA 1RXGA 4XHXA 3CDZB 3ZYIB 5FY0A 4LHLA 1ZA4A 1W3VA 3ES4A 3THCA 4CDWB 2DUQA 5LEKA 1YJKA 1OLQA 3WW1A 3V64A 2VNOA 4YVSC 1RUNA 4MADA 1DX8A 3BPZA 4FPJA 4WM8B 3VDDB 2RDSA 3I2KA 4ZU4A 1G6NA 1RMU1 3I4IA 2WNVC 1GZ9A 3LCPA 3MPBA 4DXSA 3LEIA 3PVBB 5A3LA 2B42B 1IPSA 1W9YA 4C2M1 3WV6A 2W1SA 2D3SA 4IEYA 4XQ4A 3HAXC 1VBA2 4OMCA 4P9YA 3UGHA 2TBVA 2B9VA 3RDIA 4K3UA 2ZA9A 1C5IA 4ZY9A 5KXBA 4NWWA 4Y3OA 1C8M2 1DP0A 1NA1A 3I3EA 4JGZC 4YSFA 3A0KA 2XBO3 3WQ7A 3CKHA 3B3QE 2FZ1A 5FLHA 5JLVA 3VBSB 5A7PA 1J84A 3SHRA 5A33B 1YUDA 4META 4XXAA 1H1IA 1IPJA 5DG1A 3CU7A 2PAKA 2AUYA 5FO8B 4BH9A 3HEIA 4A7YA 4A3LL 4GZ9A 1W2AX 4QHBA 5RXNA 3RZOL 2GAUA 4MH0E 2Q8DA 3VKFC 4QB6A 3ELNA 4FTBA 4IE5A 3HN1A 2YGMA 3NV3A 4BCUA 1A34A 1EV12 4GIQA 4XCAA 5GLZA 3T2OA 4N9IA 3NV1A 2VO5A 5LK5A 5J09A 5LEJA 1FV2A 4X8NA 2ETEA 4O65A 4W65A 2CWSA 4HKLA 3ZXGA 1DU3D 3OGSA 1C57A 4QX3A 4DEQA 1YUZA 3IAQA 4LKDA 1LGCA 3PUHA 2NLRA 2WFPA 2Z79A 4KBZA 3BU0A 1LULA 2Z3QB 1IU6A 4IE4A 4DIQA 1LHNA 4XURA 5IVYA 1NCQB 2IFRA 4K40A 4YGDA 4FAHA 2A1XA 3PUSA 4MO3M 2CGPA 2Y64A 1VBE3 2VZUA 4JTNA 3ZKUA 4COWA 1PGSA 1OVPA 2WJSA 1XU1A 2XH6A 3THDA 5L7OC 1VRH2 2QUOA 3N3HA 4D6QA 1CAVB 3T0DA 3ECQA 2BWAA 4I0WB 3SC7X 1WKYA 4NOTA 3AYEA 4WZFA 4B1MA 3KWVA 3NNLA 3O7OA 4F83A 4LHSA 5B4NA 4R8HA 4AQ6A 3WNMA 3JCIA 3MLLA 2P6HA 3D6EA 3J8F2 1UCXA 1F4HA 3TYJA 4QGLA 1CQ9A 1D4M2 2HJIA 3O5SA 1WGPA 2DCYA 2QQIA 4OI1A 1Y1WL 1OFNA 3KB5A 1MQTC 2ET7A 3QH6A 5JZGB 4P9XA 2J1TA 5FMBA 2WZR3 5G04L 1AJKA 1RUG1 1GWLA 5F5IA 1HB1A 2XWBB 4NIAA 2JDZA 1XYOA 1W8OA 3I3BA 2RG4A 2VZTA 2YU2A 3IMNA 1YQ2A 1D2QA 4E4SA 4OHZA 4IV3A 2W08A 1CAWA 1OF4A 1POQA 1JXNA 3AMPA 4QT6A 1AYN1 3WNPA 4OZXA 5KR7A 4XF4A 4U2AA 1JOBA 4PLMA 3PVEA 3ZN4A 4UOJA 3TEZA 1Y9GA 1ZRRA 2ADEA 3OGJA 4ORFA 3F2ZA 1RJ8A 5JSRA 3C2UA 4TWTA 5A7WB 2XLAA 2PMZP 2JG9C 5LB6A 1A6CA 5FJHA 2B63L 4FFIA 5EPAA 4XACA 4URAA 2LROA 4B1LA 2CKAA 1GMMA 1XNCA 2O8OA 1AX0A 1DQ1A 5EZWA 5LBEA 3VHOA 4QQOA 3K51A 1I3HA 3S1QL 4FCAA 4EQVA 3PTRB 2HEVF 1SLLA 1H2MA 2D6OX 3B9IA 5L9BA 3SITA 5ACA1 2D40A 4P9LA 2QQMA 1ZZBA 5JMCA 2AH2A 1HRI3 2FDJA 1UOGA 3T2TA 4BQ4A 3HBZA 3ZYRA 4LOSA 2Y38A 3S30A 4IGOA 4IEZA 1ZZ6A 3GTPL 1JZ4A 3WOGA 1D0GA 3W59A 1UZVA 2VOTA 3VBFA 4XXBB 1Q43A 2ZCWA 3D8CA 3M2MA 3OTFA 5GAHc 2VMEA 4QU1A 4BIFA 1CAAA 3DKQA 1QJU1 3O0VA 3WR0A 3S7EA 2AREA 3TN92 1QNYA 4AW7A 3OUHA 1J59A 2RJ2A 2EXHA 3KF3A 2AYJA 5FZ3A 4YZ5A 5KC5A 5KHGA 1PFVA 5KHKA 5EJZB 2OW4A 1JYWA 1OVSA 2PLV2 1MZFA 3PMSA 4ZKTB 1ZA7A 4ISQA 1O4ZA 1FHMA 1RITA 2G1MA 4RGKA 5EP9A 5GLWA 3J7Y1 2BJSA 3KQ4B 5CG8A 4HN1A 1NQDA 1XSQA 2QQUA 4JC1A 1WCML 1Z92B 4I02A 4G3YC 4J25A 1F4LA 5F3GA 3SMHA 3RZTA 1BRFA 4RXNA 3OGRA 1TVGA 5CKNA 1B09A 1QIQA 4ME3A 2XHNA 3AP9A 3MW4A 4XJZA 2J1VA 4R52A 3PJYA 4IE6A 5FPAA 4GD4A 3NJYA 5IYBL 4AHXA 1NOVA 3LPFA 1WCQA 4YM2A 1V6NA 5FP3A 2C9KA 3A21A 3GNEA 1OOPA 4AOCA 5JR7B 4M0HA 3W58A 5I8TA 3PL0A 2WFF3 1L7QA 3AZWA 2QKDA 5JXHA 3WDXA 4TN7A 3IT8A 4RHV2 4Y4YA 2AACA 4IDZA 3FBMA 5J36A 3LE0A 1PO13 2ARCA 2JDKA 1YQ5A 3FHIB 3RZZA 2Y34A 3LA2A 2AUSB 1RUF3 3WW2A 1RUJ2 4CDWC 5C4WB 2RS52 2R6QA 3S1NL 1WMEA 2D44A 3FLRA 3P5BA 1N1VA 2DCTA 2VOVA 3VBOA 4LK7A 3VB9A 3TOJA 1R081 3OBAA 5A7NA 5ABJC 1A8MA 2VL6A 4WM8C 5EYYA 5JI7A 4YFZA 5LCWL 4SLIA 4Y5TA 1QCVA 2P3YA 4KWUA 2JICA 3QOPA 3ZXJA 3KV5A 5L9VA 3UGFA 2WO1A 1TG7A 3RYGA 2Z4FA 1IS3A 4NAOA 1QJX1 3V0AB 4I2OA 1G9AA 1NCRC 1SFPA 4NAMA 4CP9B 2CWMA 1GWKA 4MUVA 3RNSA 1LR5A 1LU2A 5AI3A 2WKKA 2VOXA 2VXJA 4B7KA 1HV1A 2ZGMA 1VBB1 1TME1 5HV4A 3MF6A 4NRPA 5D8AB 1RUH3 2MNGA 4AFAA 2R071 2EIDA 5KXDA 1WA4A 3HJWB 5JR2A 1RUOA 1ZREA 4OQ9A 2R042 3VBSC 3ZDSA 4ASMB 1HQLA 1QOSA 3HJYB 1PMHX 3AMNA 1YC61 1CGPA 1XOYA 2ZEWA 4N90A 1VBC2 2X5IB 1AR91 1SFYA 3KV4A 4Q27A 4F7ZA 3ZN6A 1EAH3 1FMD2 2YB7A 4LBQA
chains in the Genus database with same CATH topology
4AGRA 3BOPA 3B0AB 3NKGA 3WXPA 1FATA 3JU9A 5JPNB 1SBEA 5CA6A 4Q0VA 5DUUA 1VB4A 4Z07A 3ZYJB 4D3WA 5CFCB 4C0HA 3AKSA 1S0IA 4Q2FA 4Q4Y2 3U0ZA 4YM3A 3D4KA 2XJVA 5FO9B 5GM0A 4Q4W3 4JDOA 3B02A 1QDCA 1R1A2 4XPVA 1LKMA 1RWDA 1V9U2 4AHWA 1MS1A 1QH7A 3MYXA 1ZRFA 1LENA 1QJY3 4XJ8A 1OHFA 5MF6A 1S0GA 3NAPA 2RM23 2P3JA 2RS31 1YCIA 1AX1A 4JVAA 4D7SA 1W6NA 2JECA 3ETQA 3AZZA 1EYBA 2K2DA 2Z5WA 2BTVC 3ALQA 4K9SA 2PPTA 5JZGC 1AR81 5J7MA 3ZXLA 3ZFFB 1OI6A 1OQDA 1RUE3 4NO4A 1VB2A 5JI9A 4CP2A 5I0TA 1BBT1 3AFKA 3VZJA 5SV8A 1FV3A 1QQP2 1S1AA 2IXJA 2CAUA 2WA3A 4FQZA 4JGYA 5EWSA 4AEDC 2RJKA 2B46X 2P34A 4EWEA 4NN0A 5E1RA 5HXVA 2GMEA 1WJVA 3DKWA 4C1XA 4XFHA 3D0JA 1YIFA 1S24A 3KYWA 1K5MB 1QJZA 1GV9A 1U5YA 1SDWA 2TUNA 1PM7A 1SLCA 2NQYA 2I07B 4N53A 1R0JA 3DV8A 1R0GA 3KT1A 4AG4A 4S2GA 3WWNB 4IEXA 3A4UA 4PDWA 3ZFEB 4Q1RA 2PA7A 2ZGNA 4LLFA 4EV0A 3OD0A 3QACA 1VBA1 1W6QB 4GKXA 2DVAA 4KGGA 1ZM1A 3U07A 3LA3A 1YFWA 1PK6B 4G9SB 3PKJA 1FX5A 4R9CA 1NXGA 3KYVA 1C8M1 4FXKB 3NV2A 1SBDA 3LZZA 1B35A 2A6HD 2Q1ZB 1COV1 5FREA 1H8VA 4MGYE 4FPLA 1NXD1 2JG8C 4HL0A 3HT2A 4DY3A 5I93A 4QM8A 1UMZA 2NP0A 1GICA 3MDPA 4BLJA 2WL1A 4HK8A 4UY81 2VOKA 2PAMA 1J3QA 4WM7A 2CKCA 1ULEA 5JAXA 4XBLA 2PVEA 4WVMB 1BZWA 3MPSA 1OQ1A 3VL8A 3MIFA 1NQJA 2HWF3 4YG3A 1C5HA 3VKOA 2G4IA 2HWD2 5HCFA 3BTAA 1NE4A 3H3ZA 1VRH1 3JUUA 3D5OA 2GH2A 3VBRA 1JYIA 3JBG3 2RS13 3OY8B 2XHKA 1V6LA 1Q56A 3I59B 2QFEA 4E2SA 3J8F1 1UKRA 4Q26A 4I09A 3WCSA 1D4M1 4MSVA 4FOQA 5DDJ2 3AKRA 3AMMA 2Y26A 3ILRA 4E2QA 4OUSA 3QQCE 2O1QA 1RINA 5KHIA 2ZGLA 1WLCA 1R0HA 3ZFGC 2DUPA 1ZZ9A 4GMP1 1B13A 1DGWX 4M3CE 1YUXA 1VJ2A 4R4ZA 4AHYA 1G8WA 1KJRA 4GH4A 3WUDA 3T1MA 1O3QA 1J1LA 4RQPB 5I0UA 2YY1A 4WZCA 3PIP1 1RC6A 2H6CA 3VV1A 5LRSA 3MIBA 1LB2A 1LHOA 3VZNA 2BE5D 1RUI2 1ZBE3 4D7TA 2D97A 1LEMA 3PWFA 2ZGSA 5FAXA 1YV1A 1ND3A 4OI0A 2XJTA 1ENQA 1LJ7A 1MS0A 3M3CA 3QLQA 1BQ8A 4GALA 1DZRA 4ASLA 4S2HA 2WSUA 1ASJ3 5DZGA 1CJDA 2UYAA 5FLIA 1CX4A 2HKXA 1YFUA 3G6JB 3I8TA 5F6LB 4QPGB 2HWB3 1JUIA 2B9UA 2BW8A 2YXSA 2LCQA 5T52A 5T5LA 1AYM3 3WX5A 5GALA 4CDUC 2H12A 2IXIA 2Q8OA 1BQPA 3BODA 2D93A 5JVG1 2Q0AA 4JGZB 4YW4A 3UJQA 1LTEA 4FPOB 3TN91 2KKDA 1BVVA 2P2KA 3CO2A 2VUAA 4QPIA 4YM0A 3KZ4C 4CZSA 4A7ZA 5K0UB 5HCBA 1RDGA 1W6MB 2GNTA 2E7TA 2PLV1 4NR1A 4XF0A 3ZIWA 1V6KA 2M6OA 1UPSA 3LA7A 1YXWA 4E27A 3VKLA 4AFCA 1MS8A 1LCLA 2XPJA 4IV1B 4ONUA 1R0FA 1PVC1 5FBZA 4LHKA 4BOWA 2DCZA 1YFXA 4JDMA 4FAGA 1RVF2 1WLDA 4Y22A 4YW2A 4Q0SA 3RPQA 3J9SA 1C09A 2ZAAA 2JKBA 1ENXA 2WIIB 4YW3A 3PJQA 4D69A 1ND2A 1YHFA 5AC92 4H7MA 4IQPA 4RHV1 3IPVB 4H55A 3SCGA 2CTVA 3WZ1A 2ES3A 5L7OB 2HWE2 4AXOA 2G9GA 4AHZA 1AXYA 1K5MC 1RUJ1 2RS51 1QY4A 2D5FA 5AFBA 1U5IA 4HZFA 5KXEA 2VVEA 5CFDC 3DN7A 1J3RA 3AXDA 4AVSA 1HRI2 3ZFEC 1FT9A 1V00A 2EAAA 4IETA 4FTSA 4XFGA 2DUOA 5IK5A 3NWKA 4PIYA 2WLPA 1SFNA 4LHNA 1QMJA 5FOJB 3DPRA 3QD6A 1IKPA 1ODHA 4IEOA 1PK6C 1U12A 1EP0A 3RYPA 4DMIA 4DNYA 4B4PA 3H0OA 1ULFA 1POV3 1GR3A 4M0NA 4Z82A 4COYA 3HWJA 1BFYA 3ZXDA 2QVSB 2GNMA 2R041 2QL0A 1H8TA 3WT3A 4IEVA 1AR63 1VBC1 3MFAA 1D2SA 4IEPA 2R062 4RFT0 3TAYA 1FPN3 2JG9B 4DB5A 1FMD1 1HQNA 1O3RA 5BXXA 1DFQA 3AP4A 3NJZA 4HPKA 3O12A 2OZJA 4HBNA 4Y20B 5T54A 3VZKA 3UK9A 3ZYGA 3LOIA 4BYYA 1Z7S2 4KNCA 1DQ0A 2GDFA 4Q29A 4Q4Y1 1T6GC 2EAKA 4XILA 1C28A 3UL2A 1R1A1 2WFF2 3AYAA 4YG0A 3U10A 4CEYA 3H9AA 2OUJA 1V9U1 4XJUA 2IWGB 2ZS6B 2B39A 1PO12 2A6WA 3DGTA 5BNQA 1CAXB 3VBUA 2A73B 2CY6A 3WP4A 3B00A 5C33A 2TNFA 2LALA 4HKWA 4GS7D 3LGRA 4P9WA 5AFEA 4YGEA 3WINE 5BNPB 2ZX0A 1WW6A 3WHUA 2PFWA 1W6OB 1QQP1 4K7JA 1CAWB 5MFZA 1DHKB 1SLAA 1Z78A 2Q1MA 2ZX4A 4CYDA 1F9KA 1PGL2 1SMVA 4E6YA 4RQPC 1OMIA 4LBOA 1SMMA 1M4WA 4LT5A 2NM1A 2WNUA 5EYXA 4Y1UA 4V1PA 3ZSJA 4WV8A 1H2NA 4AI3A 2DCJA 5T3NA 1APNA 2SBAA 4B8CD 1BE7A 5JPMB 2RR12 4NWVA 3LOBA 1LESA 3M3EA 3MFCA 4K20A 2XJQA 1MEC2 4IL7A 3E5UA 5BNNC 4URTA 4R4XA 4XTMA 4W6XA 4ZN1B 4N43A 4OI4A 4Q4V2 4GB32 1GZWB 5ABJB 3SH5A 1HXS2 4UXAA 1X36A 4QPGC 1O7FA 2XGXA 1S0DA 2ZBJA 2JD4A 3VBFB 1QYBA 1UW8A 3NO8A 4XFFA 1NCRB 5JIUA 3VHRA 1DVBA 1GANA 2F6BA 2OPKA 4DS0A 1DQ2A 2YUEA 1N3OA 5H1Sc 1JHNA 3PVNA 4YARA 5IT6A 1PNFA 4PIXA 3AKQA 2VW2A 4XJWA 4AR6A 2UY8A 4UBGA 1UU5A 5K0UC 2PHUA 5K2ME 3V0BB 1QH6A 3TBDA 3P2AA 3WHTA 3WP5A 1RUE2 4LUMA 2DU0A 1CAUA 4IV1C 4C1WA 1RUG3 4FQ4A 4BPZA 3USUA 1LGNA 1KDMA 3N7LA 4X6QB 4YVWA 2NN8A 2D43A 2HWD1 4HVRA 3M7AA 1AYN3 4RS5B 5H9QA 4XIOA 4PLOA 3ZG6A 1QXRA 3TNQA 4TYSA 4IEUA 1O5LA 3JD71 4DY5A 4P9IA 2XKOA 3ZN5A 2TEPA 3BU7A 5IK8A 5DDJ1 1V6OA 4AEMA 3GF6A 4H3WA 1MZ5A 5BV6A 2NYDA 3ZXKA 4E2GA 2BGCA 5EIOC 3MLJA 2YC0A 1GQGA 5ACA3 3LKJA 4UW4A 1PGW2 2VQAA 3AMHA 1PHMA 1PO22 2XWJB 3NSTA 4UW5A 2JXAA 1REEA 5DZEA 3J7Z1 3IDBB 4AEDB 2MEV3 1RUI1 3K48A 2IXHA 1QJU3 3RYKA 1EPWA 3ZSEA 1DBNA 3IKWA 4LBQB 4DOUA 3LSDA 1JUHA 3MIDA 2BVVA 2OVUA 1ULCA 3S6PA 1VCXA 5C8CB 1DLLA 1ULGA 3CL1A 1S0EA 2DFCA 1YIPA 3FZ3A 4BA6A 3H50A 5E89A 3GBFA 3CJIA 1UIKA 4CRQA 1B2OA 3HD8B 1QGLA 1ZRCA 2VOWA 1AR72 1UU4A 4HSJA 2V09A 1VZGA 2UWCA 2WLQA 1LGBA 3MPPG 4KWJA 1BKZA 4Z8BA 4HVOA 2JG8B 3B69A 2VNGA 5KXCA 1DYPA 3O14A 3VDDA 1W0PA 1LOCA 4Y1VA 5BNPC 2QDRA 2C6AA 1EY2A 1U0AA 2RHPA 3NVCA 2W39A 3EQEA 4P9JA 4U36A 1RVF1 4COZA 2A7AA 5I91A 1QJX3 3EHKA 4IV3C 5AI2A 3VZOA 4FPFA 4XF9A 4YW1A 4POGA 2XJUA 1AF9A 3FFQA 1ZZCA 4XTPA 1RYTA 1ZBE2 1GSLA 1DIWA 1QF3A 1TME3 1T9QA 1VBB3 4FPHA 4ES9A 3WQ0A 5AC91 2R073 2RE9A 1Y43B 5A33A 2HWE1 3PVOA 4PF5A 4BMEA 2BPA2 1AR93 1F31A 2PHTA 2UWBA 2PHFA 2K9ZA 1MVEA 4JQRA 1A3KA 4XOGA 1EPZA 1Y7BA 5GZDA 4C91A 4LE4A 1ASJ2 1RIRA 3LWCA 4MX3A 4MYEA 4QU2A 1JN2P 4HKOA 4Y26A 3OYWA 4D94A 4LNVA 3WG3A 4FP2A 4R9AA 4M3CA 3H8UA 3AKPA 4CDXA 5AN9H 1Q8PA 2ZABA 4FVVA 1AYM2 3B93A 3ZMOA 4BMBA 3ZFGB 3KD4A 1N3PA 1URXA 4KH9A 3S0MA 3VBFC 4CDQB 4FOWA 1NCQA 1J1TA 4RD7A 4AFMA 1B35B 1ZX5A 2CGNA 2VQ0A 5GAEc 3AKTA 1D0HA 1CAVA 1KRIA 4XQDA 4DZGA 1HRV2 1GKBA 1YI7A 2R061 2WZPP 1BMV2 2VY0A 4XF1A 5T5OA 3E6DA 1RUD2 2RS33 2Q4SA 2IXLA 1IZ3A 2BEOA 2JJ6A 3M8LA 1G9DA 1X50A 4GQ7A 2NPIA 4F8AA 4IEWA 4MXWB 1Z7S1 4BIOA 5K8SA 1AR83 4RR3A 2E9QA 1W6PB 2IXCA 2Y0IA 5FLJA 5SV5A 3RJRA 2PQQA 4KG0A 1R092 2VU9A 5DM71 1OOPC 2WFF1 4IXLA 2MS3A 2AR6A 3VPBE 3AMQA 4N7IA 4YZ3A 4CDUB 4RS5C 3AM2A 3THTA 1VR3A 1RUC3 1PO11 2UURA 1S2KA 1NE6A 3AYDA 1GZCA 5JVH1 1HIXA 2HWC3 2GC3A 2XL7A 3WUCA 1KFXL 5C9AB 2A71A 3WP3A 1QHDA 1VZHA 4KBBA 2N7GA 1FHHA 1QKQA 4KWKA 1ZBA3 1BJQA 4O9EA 1WUVA 4CP1A 2PAEA 2J9UB 2UYBA 1XXNA 2B5ID 2A6YA 4FT8A 4LBLA 1S2BA 1PIV3 1QOTA 5GZCA 1X33A 3RI8A 3ZSLA 4GH4B 4ZN3B 5KHHA 1VBA3 3BALA 3OBRA 2WA4A 4LBJA 1YFYA 1PGL1 1VALA 3H3UA 1OLRA 4R9DA 3MIEA 5F5QA 1C8M3 3R05A 3RI9A 1MVQA 2ZTNA 1AR62 1B71A 2XJSA 2ZGOA 4YGCA 1FPN2 1B2JA 1COV3 1WLWA 5CVRA 1ND3B 2RR11 2WS92 1FOD3 1OSGA 1TNRA 4PBOA 5CB7A 4H14A 1SMUA 1MEC1 4AQTA 3RQ0A 4E4ZA 2HR5A 1H4HA 2GC0A 2ZHLA 4Q4V1 5C8CC 4GB31 3EO6A 5CFDB 1HXS1 1QU0A 2VMIA 4PLNA 4XFAA 4L9BA 4ES8A 1DQ6A 4ATEA 3QH7A 4I3GA 2E51A 2QZ2A 1U5ZA 1MACA 2YPJA 1BK1A 1R1ZA 1VP6A 1NY72 5HCAA 2KA3A 2FZ2A 4DFSA 3ACLA 2XLFA 3HQXA 1RHI3 4AFBA 5BPXA 1TMF2 3BB6A 1WW4A 1XYNA 4AVAA 3R4UA 1VBD2 2KM2A 1XU2A 4QD2A 1X8MA 2EA7A 3IIAA 2YV8A 1G86A 2CNAA 5F6KA 5FCCA 5C4WA 3WWLA 1V6MA 2ZGQA 3J8F3 5I8SA 1U5XA 5TSWA 5BYNA 4Q8LA 1Q8VA 3ZYPA 1FYUA 5JVVA 1EV11 4YZ4A 1WBLA 4E9KA 4AR3A 2ATFA 3V56A 1IKQA 4UW6A 3SH3A 4GMP3 4QMAA 4LBMA 4D7YA 1CJPA 3V0AA 4JGYC 2ET1A 1H30A 1LOAA 3WW3A 1BEV2 4AVTA 3WDUA 3B01A 3TB0A 4EN0A 5D8AA 4M3CF 4YWMA 4BWOA 2CYFA 2R0HA 3OF1A 1S0CA 2X8KA 2M6PA 4UBHA 1AL23 2X5IA 1O91A 2VNRA 2A75A 1AHSA 1S0FA 2Z3RB 4FO9A 4Q4X3 1YJLA 4N53C 4XFIA 3MGUA 1FXZA 4OHXA 2DFBA 4AE2A 3H7JA 4PDWC 1Q3EA 1LOFA 1DGRA 3FE5A 3OPZA 5CFCA 4NHLA 5CIRA 3DPRB 2RJLA 4JRLA 1PGW1 3L2YA 1PO21 2PVXA 1L3JA 2ZACA 1POV0 2DVFA 2ZJCA 4EWDA 1GFF2 3KLSA 3SLIA 2VECA 4CDQC 3VBHA 2Z2SB 5B2GB 4YFWA 4JTOA 1QWRA 3VGIA 2GN3A 1B35C 2XBO2 3U4XA 4XEZA 2VULA 5L36A 3WD5A 3HIFA 1J58A 3WDYA 5L73A 3TN93 2V5YA 4RA0A 4JAEA 1RL3A 1TE1B 1W39A 1N1TA 3N4MA 5CNAA 4OULA 3IDEA 1ZZ7A 4TZDA 4XBNA 2PLV3 4QGNA 1JYCA 3I7DA 3LNLA 1XRUA 1MS3A 1YNAA 2Z69A 3CEWA 5BNNB 3NFPI 1NLRA 1XQNA 5AVAA 3ZFFA 2AYHA 2ZHNA 4WM7C 4CEWB 2D6PA 1PVC3 4U671 3HT1A 1F5FA 4TPUA 4R9BA 1I5ZA 3FBYA 3KGZA 4N7UA 1AL0G 3BCWA 2ERFA 3POWA 4CEYB 4EN7B 5BNOA 4RGAA 3VZMA 4YM1A 2YROA 3VBRC 4HETA 1VBE2 1H9PA 5JSOA 4LR4A 1AR71 1H7VA 2A3YA 3ZXAC 4DRVA 1MZ6A 4RHV3 2XL9A 2IXKA 2OUHA 5LRRA 4FTEA 3MI8A 3ME2A 4KWLA 2G9FA 1S30A 4QM9A 4DRRA 5C9AC 1F8VA 1RUJ3 1O5UA 2RS53 1A78A 2C1FA 1RB8G 5A32B 4JADA 4XHBA 1O4TA 3VKNA 4AQSA 3W9AA 1DYKA 5FPXA 1HKDA 1YWKA 1UN1A 2XKPA 3ZFEA 4G6BA 4HMZA 2AZ5A 2WZR2 1S0JA 3KM5A 1F2NA 3FFZA 4LA2A 1W6QA 1RDVA 4GH4C 4N9HA 4YZ1A 3NL1A 5JCTA 3PNAA 2R32A 2WNUB 1OPMA 2GMPA 2MEV2 3WG1A 1CIWA 4JCKA 1QJU2 4OVEA 1NXEA 1CADA 3NV4A 3K35A 2A5ZA 4XETA 2M4YA 2GC1A 3AZXA 4AF9A 2A69D 2R043 3KCYA 4Q1PA 2QDNA 4GA9A 2VW0A 5I0RA 4S2DA 1ENSA 2E53A 5H9PA 1UKGA 1VBC3 1ND3C 1WBFA 1H0BA 4AGGA 3KYYA 2JENA 4DQAA 4FPEA 1FMD3 4FPYA 1GNZA 3PIO1 3AX4A 4N43B 2YMZA 3CNAA 1CN1A 3ATGA 1WD4A 3UKTA 3O0XA 4AVVA 2D98A 4LE3A 2WQ4A 2VUJA 2ZAHA 3D0SA 1MS9A 1PVXA 4Q4Y3 1LOBA 2UU8A 4WVMA 1PZ8A 2PHXA 3HAGA 1R1A3 2RMU3 2F4PA 4LO4B 2LUWA 1NA1B 3OD4A 4IERA 1V9U3 2R16A 3M3OA 1HRV1 3OY8A 3PTYA 4QPIC 5EV7A 1BMV1 4FOVA 1PZ9A 4FPCA 1RUD1 3ST7A 4Y24A 5J98B 1O3SA 4OUMA 5GZGA 1SLTA 2UY9A 1NLSA 3WDWA 2JI1A 3JQWA 1TQ5A 5JOWA 1E57A 3IWZA 4NHKA 4LO6B 1G9AA 2ZPXA 1GBGA 4YVWB 2XVLA 1UPIA 3L2HA 3SXWA 2A6XA 2R1BA 1QQP3 4L8QA 1R091 1Y9QA 3AZYA 4JAGA 4AI2A 3MICA 4QX5A 2JE9A 4XBQA 1E8JA 3M3QA 2A6ED 1V70A 3PKIA 2YDEA 2GZWA 1HV0A 5JDBA 2BBVA 2R49A 1OWBA 2PSMC 1RGSA 3WLUA 8RXNA 4AYUA 4DPNA 4AGVA 1BYHA 2B8MA 3WDTA 3ZSKA 1RUF2 2A3XA 2P3IA 1M06G 1UIJA 2HEWF 3A0NA 4K6BA 1NG0A 4XDQA 4XQWA 2VGDA 1R0IA 1QXPA 2ZKNA 1VAMA 1YYNA 2E63A 3FMGA 3POYA 4YVSA 1DDLA 3ZX7A 4QXKA 1ENRA 4QQLA 2QZ3A 4QPGA 2V0FA 3OBTA 3LPEB 1UD1A 3GHNA 1F5JA 1JYBA 2BFUL 2DU1A 2WNVA 3DPRC 1RMU3 1IS5A 1WD3A 1X7NA 3JB4C 3ZMNA 3E6CC 4IV3B 2Z42A 3AJZA 1YLLA 4A2UA 2XJRA 1AR61 1RUH2 2D3PA 4AWDA 5KHJA 4JGZA 3B94A 5IK4A 4AVBA 4ZU7A 1FPN1 4B4QA 6RXNA 1CD3G 1PZ7A 2WS91 5C8WA 2V73A 1ZRDA 1RJ7A 2H6BA 1EAH2 4LO7A 5K0UA 4W6YA 1ZVFA 4HFSA 1YRZA 2WC2A 2I45A 4LTAA 2PHWA 3M3IA 5FFOC 1KQRA 2Q5TA 5JOYA 4IV1A 1VZIA 1ZRPA 4AR5A 1UU6A 4CEWC 5LK7B 3KT7A 4GXLA 1GLHA 5GZFA 4JAFA 3J26N 4FPKA 3AP7A 4FOYA 4DINB 2SLIA 3CJIB 5I8YA 1OFSA 1ULDA 4Q4W2 2MPFA 4CEYC 2XB6C 1LHVA 1RUC2 1NY71 2HWD3 4KU8A 4ITCA 4TSVA 2E7AA 1QJY2 4K9FA 2HWC2 1TMF1 2NMOA 1HX6A 3IPVA 2ILMA 3VBUC 1VBD1 3GBGA 5J48A 5L7OA 2RM22 4FXGB 5HBAA 3JD73 4RSUA 1ZBA2 4COUA 1X8EA 4YRDA 1AXZA 4JRAA 2ZMKA 1WCSA 2YGLA 5DDJ3 2E7QA 5IY0A 3QBQA 4Y1XA 2R1DA 7RXNA 4J1XA 4J1WA 5H9SA 3SS2A 1PIV2 5FQ0A 5DM61 1BQ9A 1MQTA 1N1YA 1JW6A 1MS5A 2GC2A 2EALA 3HR9A 4GKYA 3FLTA 1BEV1 3M4FA 1UZZA 3URFA 3WCRA 4K21A 2WNUC 3OJBA 3KYXA 1OD5A 1XE8A 2QCSB 4YGBA 1OOPB 5FTTC 4MV2A 1LHWA 2FMDA 2ERJA 1COV2 2ZX1A 3CLPA 2RDVA 1RUI3 3P3PA 3U11A 1NNQA 1S2ZA 1FOD2 4MVTA 2O8QA 4EN6B 3LB9A 1CPNA 2CR8A 1RYQA 3I54A 1REFA 2JG9A 4YZ2A 3P8BA 2A68D 2VW1A 2VXRA 4PQ9A 3OYWB 3AFGA 3UJOA 3VBOB 4M3CB 4N43C 1FI2A 4XFBA 4Y20A 1AX2A 5IUQA 4CDXB 3R4SA 2OIIA 3L9JT 4WVZA 4OHWA 3VLBB 4TVMA 2YZ4A 2CGOA 1SCSA 4NVPA 4Q8KA 3BIWE 5GADc 5T55A 5FMOL 2XBO1 1KITA 1NA1C 1RHI2 3AXEA 3ROUA 2KXLA 4L97A 1CAXA 1CESA 4S2FA 3ASIA 1I6XA 3MIGA 3IM0A 1I1EA 4P5HA 3H1MA 2WINB 3SH4A 3ZN6B 1D4VB 4B7EA 4WVVA 1LKNA 1HQWA 5I0SA 4RR3B 3N7KA 2X53S 4HSLA 4L92A 4Z92B 5BNPA 3IU3I 1IQAA 3ZXEA 3JZVA 4PJYA 1W6OA 2XVGA 4ISRA 1IRNA 2GNBA 4YVWC 2PYAA 3KQRA 3QCWA