4AHWA

Flo5a showing a heptanuclear gadolinium cluster on its surface
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 59
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ahwA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ahwA01
4CP1A 4COYA 4AI3A 4AI1A 4A3XA 4AHXA 4AI2A 4COUA 4AHZA 4AFBA 4AHYA 4COWA 2XJUA 2XJTA 4D3WA 2XJPA 2XJSA 4ASLA 2XJQA 4AF9A 4CP2A 4LHKA 4CP0A 2XJVA 4GQ7A 5A3MA 4LHNA 4AHWA 4AI0A 4AFAA 4COZA 4LHLA 5A3LA 4AFCA 4COVA 2XJRA
chains in the Genus database with same CATH superfamily
4M00A 1XSQA 1YUDA 2ZGSA 3A44A 3MPBA 2WSUA 1DQ6A 3HN3A 5A6YA 1NA1A 2E53A 5DUUA 5BPXA 5LK7B 3PKIA 3RYRA 4W6YA 3NV4A 4X8PA 2VMEA 2BFUL 2RJKA 4OQ8A 4AR5A 3ACGA 1ZRDA 4ME3A 1K5MA 5I0UA 3JD71 5DAPA 1FX5A 4FQ4A 3J7HA 1W8ZA 2PXJA 3RZMA 2HR5A 3GZUC 1R091 5A3NA 1CAWA 1SDDB 4YVWA 5FYZA 3N7LA 4BIFA 5EIOC 2GDFA 3USUA 1R0GA 1F31A 2P6CA 3B5LB 3ILFA 1NOVA 4EWEA 3ZXEA 2W47A 3OEAA 1Y4WA 1VBA3 2DVFA 2WS91 5JXGA 1P7PA 1RMU3 2JD9A 1VBE3 1AF9A 3MPSA 4JVAA 4EZ4A 3E97A 5A7WA 4XFCA 4COYA 2CKCA 2UU8A 3GTQL 5J48A 5DN2A 3OUIA 3AMMA 1QJU1 4A3BL 3VD9A 1NXEA 2WNVA 3IMMA 2VXJA 2D3SA 2ARBA 5GZFA 2JI1A 5FZKA 2YROA 4IV1C 1RIRA 4BMEA 3FFZA 1JU4A 1QXPA 2GAUA 1SLAA 5I93A 2E2HL 2D43A 2CAUA 1V6MA 2JKBA 1NCQB 2P17A 5IYYA 4OVEA 1ASJ1 3AXDA 1GNZA 4YYOA 2GNMA 2H6CA 2OW4A 1RUF2 4KBBA 1QH7A 1UPIA 5H1Sc 3RVHA 3HOZL 4CPBD 3HT2A 2EXKA 1W8TA 5CFDA 1MS9A 4LE3A 1MEC1 1XSRA 1KGYA 1UZ0A 3WR0A 2FZ2A 3AMQA 3NKTA 1XNAA 2JE9A 1OLQA 3VZMA 1CAXA 2AYHA 1GU3A 2CTVA 1WLDA 2E51A 5ABJB 1CAAA 3VBRA 3UL2A 3MICA 1SDWA 3H7JA 1U5XA 5FUNA 4A7KA 2ATFA 3PU3A 2RFKB 1UX6A 2RDRA 3SHRA 2KN9A 2D5FA 2WFF2 3D6EA 1VB2A 3PVNA 4B7EA 3W5MA 2JDNA 4CXYA 1H8VA 2GSYA 4KU8A 2X29A 2Z42A 4LEJA 3WUDA 5C5UA 1P8JA 1Q8OA 2J1UA 4F8AA 4N90A 4TYSA 1OH4A 2RJ2A 3LIHA 4JTNA 5T55A 3ZKUA 1LENA 2A3YA 2FDJA 3KF3A 5FZIA 5BUVA 3HJYB 4TWTA 3B02A 4XDQA 1SCRA 3PJYA 4AI0A 5GAEc 5T3NA 3T2OA 3AVSA 2PHFA 3HNMA 4UFIA 5E8AA 3JQXA 2BWAA 4XURA 4EV0A 5FUPA 3WSOA 2RM22 3ILNA 3WNMA 3V0BB 1S55A 4C3JL 2ZHLA 2ZX0A 3IAQA 3LFIA 2NN8A 4Q4V3 2PYAA 3OB8A 2KKDA 3KMHA 5F5AA 4DXRA 1N1VA 2E63A 1BEV3 2VW0A 4RN5A 2HKXA 1MZ6A 4DFSA 3RZGA 4RD7A 3U07A 5IFPA 2LCQA 4K9SA 3X29B 2WNUB 5ISLA 1VBB2 1U12A 1PVC3 5LRSA 2VUJA 1WA4A 4RFT0 4YGCA 5JXJA 4F83A 4FP3A 1VBD1 5GM0A 3S6PA 1S1AA 3I59A 3NL1A 4L9BA 4Y5TA 4QX0A 4OHWA 5FMBA 4A3FL 1FV2A 3JBG2 4AEDA 4D6RA 1YUXA 1PMIA 1TME3 1L3JA 4QQLA 5C9AA 1BJQA 4AAXA 1YUZA 3B08B 3WEZA 1YV1A 5E88A 3QCWA 5FP3A 1LKMA 1AXZA 2DTYA 2QDRA 4GKYA 3M3CA 4YVSA 5KXCA 2UYBA 3GBFA 1XPWA 4QDSA 2EXHA 4N53B 2KD7A 5DUXA 2VOXA 2PHWA 3THTA 2FHRA 4O9EA 4YW6A 3AL6A 1OVPA 2VL4A 4CVUA 1DBNA 1QQP1 5L9VA 1JH5A 3GHNA 4G3YC 2NZ9A 4UI9L 1RUE1 1OA2A 4JDOA 4WVMB 4HKOA 3W20A 1FPN1 2DBIA 3EHKA 3IB3A 1DLCA 2J22A 2WT2A 4KH9A 1YRZA 3QD6A 1D4M2 1US3A 3OYWB 4AFMA 4LIVA 5EWSA 2XKOA 5FTTC 4OHZA 5FMCA 1DDLA 2GNDA 5FLHA 2WA3A 1BLZA 1XYOA 4GH4C 3WHTA 2RHPA 1PX3A 3D5OA 4QM8A 1PVXA 4IGPA 4MOAA 2A6YA 3WDVA 1UAIA 3ZYHA 3S57A 1G9BA 1RUC2 2WO1A 2BW8A 5AI2A 2DCKA 4MUVA 4QGNA 5DZFA 1C09A 4YGDA 3WNNA 4CXXA 3ZYBA 3HVDA 1LODA 1O91A 4N8MA 2C6AA 4PDWC 1CJPA 1DLLA 3S0MA 2XLFA 5KHHA 1V6LA 3A21A 2Y6JA 4GWIA 5A7NA 1N3PA 4IE0A 1V0AA 1SLLA 2QE3A 5BNPA 4OI4A 1XNCA 1ZA4A 1SFPA 5AFBA 5IAXA 4N7IA 1H30A 4ZS2A 3AKTA 1DF0A 2BP6A 3M8LA 4KGQA 2ES3A 4IL7A 4J1WA 4X6QB 4E2GA 2ZEYA 4LK7A 4DXTA 4Q29A 5KR7A 3O1VA 2VG9A 2WB1P 1COV1 4L99A 1D7PM 5J98B 3VBFA 3PTYA 2QQVA 5B4NA 1WLWA 4Q1RA 5EJ3A 4ORFA 3MFCA 4QPIB 2FDKA 1QJY1 4FOQA 1Y1VL 1JTZX 5JIAA 1MQTB 4XJUA 2A6VA 4AGVA 3TEZA 1PIV1 4OI0A 4IEPA 1RGSA 1RWDA 1S24A 1YI7A 3AC0A 2J1AA 5FZFA 1W6QB 1LULA 3AP7A 3JD72 2OVUA 4K8RB 1RUJ1 5FV3A 2OKXA 2RS33 3TWIA 1PHMA 4LBLA 3ZFEA 1R092 4GWNA 4XUNA 5C71A 2E7QA 4PI0A 3ZSJA 4EZHA 3QH7A 2RG4A 1IKPA 1RXFA 4D0QA 2ZAAA 4IESA 1ZZ7A 2R16A 4XFGA 4CDUC 1LGNA 4X6AL 1BXHA 2WS92 3RS6A 3GTOL 1W0OA 1OLRA 3VKOA 2VR4A 3FHAA 3RZHA 3I2IA 4MLOA 3NJVA 5A33A 3ZN6A 1KJRA 4OZXA 1UOFA 1XJAA 1OBNA 4QMAA 4XDOA 3W59A 1OOPB 1H2LA 1QJU2 5C3QA 4YPJA 1R1A1 1EYBA 2Y64A 4HK9A 1JUIA 1NA1B 1RB9A 1JW6A 1NKGA 2WC2A 4LOSA 1SHWB 3SNMA 3HQRA 5CFCB 4EN9B 2P1BA 1K5MB 1WCSA 2HJIA 1QJX3 2JDHA 2XXZA 2YXSA 1AYM1 2V09A 4N7UA 2D6LX 1WLCA 4YVWB 3WNXA 1I50L 3HOBA 4IW3A 2MEV3 1QEXA 1AL23 4ITCA 4YFWA 3EJKA 1MEC2 1HXS3 4U671 2R041 1W6OB 2HBUA 3J7LA 2I07B 3ECQA 4JGYC 4M3CB 4AVCA 1LKPA 3NW4A 4ATEA 1POV0 2XL7A 2Y6HA 3LEMA 2VW2A 4D6SA 1AL0G 2A6WA 5C8CC 1JU3A 5J37A 3N7MA 2BVBA 4JGZB 1PM7A 5C5TA 2VZRA 4P14A 4W65A 3EBRA 3UKNA 1VZHA 1URXA 2E33A 2VNOA 2XQXA 5IHRA 5FAXA 3WP3A 4XQWA 5KXBA 5FCCA 5FYBA 2K2DA 4NR1A 2AACA 3TOJA 4B7KA 3IN9A 2GU9A 3TBDA 2Y8KA 3BODA 3GTLL 4D7TA 4YG0A 4NWVA 2YPJA 3TEXA 5IVFA 3MIFA 3VZJA 1LKOA 4C3HL 1H2NA 4QX1A 1R0IA 2ZA9A 4FPHA 2G1MA 5DAQA 5JLVA 3ACIA 1X8EA 4R52A 5CFDB 4QHBA 4KI5M 1OQ1A 2XVKA 5FZ0A 3VBSB 2AGSA 1SLBA 3VZNA 2WNEA 3HN1A 3I2OA 2JG8C 2NMNA 2ADDA 2VE1A 1KFXL 4XFBA 3T08A 4Q4W1 1G9CA 5T5JA 3FLPA 4LKEA 4YGEA 5FPAA 4WZCA 1JYWA 2W95A 1OXCA 2XG3A 2Q30A 2RMU1 1FXZA 3SC7X 1NAEA 1VBD2 3N9LA 3ZOIA 3LZZA 4RA0A 2R6QA 3MIBA 4IV1A 3S1RL 3M3EA 4FPEA 5FP8A 1SMMA 5IVYA 4BK4A 4F7ZA 2UY9A 1H6XA 3MF6A 3I97A 4HPKB 1GQHA 4A6SA 2VO5A 5F37A 2PVXA 5FMOS 3O1PA 2BRTA 2Y0IA 1LGBA 3KYXA 1TVGA 2A5ZA 5GLTA 4GWJA 4BXSV 4MXWB 1BYHA 3IWZA 1QQP2 2BGCA 4MO3M 4NJ4A 4R8HA 2TBVA 3NNFA 2NVYL 4CXWA 1XBFA 3WF4A 2FMYA 3C7FA 1RUE2 4KL1A 4I01A 1IG3A 1BCXA 1YQCA 4JHZA 5JPMB 2IFWA 1FPN2 2QQJA 1Q43A 5BNQA 1XU1A 2WWUA 3OCPA 5CVRA 1VBA1 1PFYA 2Y0SP 1BBT3 1RMU1 2A7AA 3F95A 1ZYBA 3OBRA 2Q8CA 5C7GA 4CP9A 2D97A 1PMJX 5FP4A 1S0BA 2CGOA 1NLSA 2OA2A 3VBOC 5HXVA 3RZJA 3B69A 5JR2A 3VDAA 4XF1A 4NAOA 3ZPOA 4CDXB 3LB9A 4H7MA 4JRAA 3LDKA 3CJXA 3PIP1 5H9PA 5H9SA 4DB5A 4CTEA 1DYKA 2AREA 4EN7B 2WLQA 4FTSA 3H0GL 3I3EA 3WDXA 2V0EA 1W8OA 2VUCA 1LGCA 1W6MA 4OUEA 1DHKB 1LR5A 2QQUA 1VLNA 4Z1VA 3O12A 1RITA 4AR2A 5FZCA 4DUVA 4Q0PA 2DCTA 5FJ8L 3R0RA 4Y22A 4Y7NL 3LEGA 3R6SA 1HLCA 2A6HD 1Q8VA 1BRFA 1YQ6A 1E5HA 1SMVA 2WDBA 3AZWA 3BVCA 3LDRA 3N4MA 1DQ2A 1SLCA 3FHQA 4QX3A 2CNAA 5CKNA 2JB4A 3LGRA 1COV2 1FHMA 1ODHA 2B5ID 4Y1UA 3BU0A 4O61A 1DGRN 5GAHc 2JD4A 5CBLA 1Y9QA 5EFUA 5IFTA 1QJY2 1VPHA 1WCQA 2EVXA 3HNBM 3GZAA 4RL7A 1GKBA 1QGLA 4L0PA 1PIV2 3DCQA 3DPRC 2J1VA 4P08A 4CUCA 2PQSA 4HFSA 1RYQA 1UYXA 1XNTA 3USSA 1B13A 5C70A 1RUJ2 1GYKA 4JCKA 2GC1A 4A3JL 2P37A 1B2JA 4FVVA 2C1FA 1O4TA 3Q8AA 5GZDA 5SV8A 2QQPA 5BNPB 3OTFA 4MVTA 3T30A 4POGA 1PK6B 1RUD3 3I2JA 4E8CA 5FZ7A 3LWOB 4AI3A 4QGLA 1H8TC 2KXLA 2Y6KA 4J1XA 4Q4V1 3ELNA 1AX0A 4XMAA 2XGXA 2W46A 5FXWA 2KR2A 4TLFA 1UNBA 2M6PA 1G9FA 2WZ8A 1BEV1 4GULA 4AEJA 1JUHA 2JE8A 4XHBA 2DDUA 5JVVA 2M4YA 1HIXA 2ZMKA 4NMIA 4XZUG 2R073 1PVC1 1EUTA 4UAPA 5C4WA 1E5RA 4MHRA 2YFUA 4GH4A 1E57A 3MLKA 3OOXA 2FD8A 4NN0A 4XFFA 5HI0A 5I0RA 4HLTA 3TNPB 3HBZA 4NPMA 1W8WA 1C5IA 1R081 4NHYA 4ZU5A 2AUSB 5F8PA 3KYWA 1GP6A 1W39A 2BFUS 1AYM2 3DF0A 4QM9A 5BNOB 5CAZA 2A6XA 3ZO0B 1BHGA 2A1XA 5A70A 2Z3QB 2ERSA 3WF3A 2YBKA 4WM7C 7RXNA 3ZDSA 4CP1A 4PDWA 2R042 3KQRA 3SLIA 5FWJA 2O8QA 3WXPA 2PHTA 5IY0A 1UF2C 2QFEA 3PIJA 5BNNB 3EQEA 3LSDA 4OMDA 4LBOA 4QAWA 1C8NA 4K3UA 2GH8A 1B71A 5A33B 3ZN6B 3LDBA 4QQOA 4BM8A 5LY2A 2WYSA 3BIEA 4Q4X3 3OGGA 3OUJA 1FNZA 3NNGA 4I09A 4PLNA 2JENA 4LKDA 2HWF3 5CEHA 1BMV1 2XOMA 5A3MA 5M3ML 3GTML 4AAPA 1WJVA 3OY8B 3AJZA 3VBRC 3POYA 4YZ3A 2ZGUA 2AYJA 1QMJA 2JECA 4BQ2A 5JOXA 2QQMA 1MS8A 4WM8B 3RYKA 2CKAA 3QLQA 4BB3A 4UW6A 2FCTA 2X5IB 1DZRA 4P9YA 3VBUB 4NE9A 4URTA 5FYIA 4LUMA 4RGKA 1CR7A 2DFCA 3KYUA 5A80A 3GTJL 2VNGA 5F39A 5L7OC 5A1FA 3FBMA 3WDTA 2DBNA 4OHVA 2D5HA 3AJYA 2PAEA 3KQ4B 3BPZA 3K35A 1W0PA 2ET1A 3HQUA 4QPGC 2CDPA 4CDUA 4Q4W2 5IK8A 3AKRA 2WN3A 5A1LA 2XJSA 5DQ0A 2A68D 2RR13 4AZZA 2P3IA 3H1MA 5EIYB 4JKMA 4RS5C 3O1RA 2WO2A 1YYNA 5JIUA 2F17A 3Q8BA 4RGAA 3LAGA 2RMU2 1SZBA 1JHNA 1DG6A 4JDNA 3VV1A 1ZZBA 5ANNA 1OPOA 1REDA 3S2HL 2QTWB 3URFA 1VALA 5JDBA 1NYWA 2Y6LA 3VDBA 2R0FA 4C2M1 3Q8FA 4A3GL 3N36A 2HWC3 4QKNA 3BPSA 3WW4A 2EICA 3QACA 1I5ZA 5FXXA 1WW7A 4LOTA 2E26A 3KV5A 1R0FA 2VVFA 4JRLA 1PMHX 5FO8B 3H50A 2XJUA 1AX1A 1XYPA 4IEXA 4JGYA 2Q5TA 1JZ4A 3ACHA 4OQ9A 4MG2A 2JDZA 1Q8QA 4FQZA 1X33A 4LBKA 5FP7A 3CMGA 1PZ8A 4FTEA 3UJOA 3C7HA 4JQRA 3C2UA 5C8CA 2RS31 2D6OX 2F4LA 4DRRA 2E32A 5DAWA 4I0AA 2BOJA 4NIIA 4DXZA 2Q1ZB 5M0TA 5F5QA 1RB8G 1RTVA 1NZCA 1W8UA 2A69D 1VBA2 2UWBA 3D8CA 2ZCWA 1RMU2 2VOKA 1AXYA 3MI8A 5FYVA 1SMWA 3HAXC 3LA7A 1AR93 4C1XA 4DO0A 4CDQB 5AFEA 3U4XA 2P4EA 4K9FA 2YMZA 3DEMA 1Z0HA 3S7IA 1B35B 4XC9A 1HB2A 1CZTA 1E5IA 2Q4SA 3AKPA 2RE9A 3J9SA 2P5BA 3O1OA 2WZR1 2JI2A 2VH9A 3NJXA 1J84A 2JEMA 4S2GA 1V9U3 3NRUA 3SCFA 3WW2A 4ZS3A 4IETA 1QJX1 2VPVA 5FZAA 3LEIA 4I2OA 3VL8A 5FMOL 5JMCA 4AHWA 5ACA3 2BVVA 4M3CE 3GGLA 5G04L 3ZFFC 5L19A 4TLGA 2NP0A 2MEV1 1AL21 5JWPA 2RM21 1HXS1 2W94A 1DGWA 2GNTA 1O4ZA 5I0DA 4Y1ZA 3AZZA 1XNKA 4RR3C 5CIRA 4E4DX 1NQJA 2I2SA 3AYAA 2VCCA 5BY5A 4KGGA 2FDIA 2WJSA 3PWFA 1UMZA 2IC1A 2VMIA 3VBHB 3KV4A 2OYZA 3VLBB 3WNKA 1ODNA 5JPNB 3JB8A 3RZTA 5FY7A 1AZDA 1HB3A 1ZZ8A 1HB4A 3AVRA 4V2VA 3U4SA 1EUUA 1W8FA 1RYYA 3GJAA 2TUNA 4DMIA 4E4HA 5BV6A 1LEMA 1NZIA 5LCWL 1G9DA 2D6PA 2QZ3A 1GQPA 1LTEA 3NJZA 1BVVA 2ILMA 1LEDA 5DXDA 3VKFC 2RS53 4XYXA 1EAH3 4M4RA 3MIHA 4Y22B 2ORXA 3NVCA 5JUVA 2PQQA 2XHNA 3LA3A 4BLIA 4LTAA 5FDBA 3JU9A 4XUQA 4AVBA 3DXUA 4Q4V2 5FZ8A 3SMHA 1IU5A 5EYXA 3BUCA 4AHYA 1TEIA 1BEV2 1YQ2A 2W68A 5HPOA 4BZ4A 3PIGA 4H7LA 3POFA 4CCEA 4M3CF 1ND3C 3LKJA 3S5QA 1PVC2 5IVBA 1OA3A 2DUPA 4A3ML 2PTMA 2ZEWA 5FPZA 3VBOA 2JA5L 2Z69A 1IPJA 4Q27A 5T5LA 3NKGA 4DS0A 5EZWA 2NVTL 2D40A 3J7Z1 5DUVA 1QY4A 2HYXA 2VXRA 3N7JA 4COZA 2ID4A 1POV3 3AYDA 4XBNA 5T5OA 4UWDA 4P9IA 4P02B 1JZ2A 1J3PA 1HN1A 4QB6A 3K3NA 5K2ME 1OQDA 3LOIA 4Q8LA 4FPCA 2VM9A 4BE3A 5HV0A 3V65A 2VMCA 4LNVA 2YZ4A 3ZXJA 4UF0A 4AI2A 2ZABA 1X7NA 2B46X 3POJA 4A45A 4AVVA 1O3QA 3J8F3 4BHPA 3ZXKA 1GSLA 1S0DA 2WL1A 3RYGA 1FOD3 1TWGL 4IEUA 4NPLA 4EQVA 4DINB 2XDVA 2CR8A 3QQCE 3H3VM 2ADEA 2QJVA 1EPZA 1OQEA 1I6XA 1QDCA 1SACA 4HXCA 4OI2A 4QU1A 4XEZA 1VR3A 5FBJA 1XE7A 4PQ9A 5T5PA 5K7PA 1BMV2 3MQKB 3K4AA 1GOFA 3VUOA 4IE6A 3O5SA 2PLV1 3UKVA 2LALA 2JKXA 3KV6A 3NV2A 3U11A 1BBT1 1JYNA 4QDQA 4W6XA 3LWVB 1S2KA 3DPRA 2A3XA 4CRQA 3I8TA 4BXFA 1VMHA 4YZ4A 3VDCA 1MS1A 3H3UA 2VY0A 1NCRB 1RDGA 4K1YA 2VOWA 2CAVA 1KJLA 2J1RA 1OD5A 3F2ZA 1AHSA 1NXMA 2JDUA 4Q0QA 2C9KA 3PURA 3GXUA 1Y1WL 3KWVA 3W21A 1M4WA 1O8PA 5AC93 2HVYC 3AP6A 1H8TA 1UY3A 1VRH3 3C7EA 3P3NA 2VOTA 2OS2A 4H3WA 2JJ6A 4YM0A 5IVCA 2JI3A 1AYN1 3MW3A 1ULGA 1R0JA 5FKCA 4QKDA 4RFRB 2RDVA 1H1IA 3SEPA 5FYCA 2AUYA 2VQ0A 1YJLA 4CEYC 1EV13 3DN7A 3OGSA 1DGWX 1KXGA 3U14A 3IDEA 2PSMC 4HKLA 5H9QA 1H2KA 5IWFA 4M4PA 4IQPA 4UOJA 4E4SA 3VKMA 3PUAA 3ZFGC 4XIKA 1TWHL 3VDDB 5IATA 1WZXA 3I4IA 2CU5A 2WQ4A 3ZYFA 4WM7A 4ES9A 3IU3I 4LBMA 4LJHA 4QPWA 4AW7A 2QZ2A 5JZGB 2E7AA 2DU1A 2C4XA 3ZSMA 4K40A 2I74A 2CL2A 4P9WA 1HQLA 5FRAA 2DTWA 5C3SA 2D6KA 3UNPA 2W0XA 2BNNA 2RS32 4D8MA 2C6SA 2XPJA 1VZIA 4XTPA 1JYBA 1V6OA 3BOWA 2VZ1A 1RUD1 4XFHA 3GZEA 5KHGA 4C91A 3FUQA 1UZZA 5D8AB 1YEWA 4YW4A 4PT6A 4GD4A 1UYZA 2V3BB 1H4GA 1CESA 5K0UB 3IKWA 3ZM8A 2VZUA 1W2OA 1OI6A 2P3YA 1SFYA 5DM61 4RXNA 1RUG3 3WW1A 2Y60A 2R071 3DKQA 2HLEA 3HAGA 2WZR2 3FJSA 5GLUA 1SQ4A 5L7OA 2LW8A 1AXKA 3SH4A 2CY6A 3WV6A 1VJ2A 5DAXA 4CEWC 1JN2P 5BYNA 2VCMA 3CDZB 1BE7A 4AXOA 5CG8A 1QJX2 3KB5A 4TN7A 2OQ6A 4QPGA 4BQ1A 3S17L 4QPYA 4D7SA 1DVBA 5IJRA 2CYFA 2P34A 2MEV2 1AL22 4ISRA 3RNSA 1HXS2 1XE0A 4ZN3B 4RS5A 1VAMA 4CUGA 4AOCA 1GZWB 1VP6A 1H7VA 1CAVA 4ASMB 4A3DL 2XHKA 3OEBA 5MFZA 4LKFA 4LXLA 2J1TA 3UGGA 3LQCA 2BWCA 3I49A 3DECA 1M06G 5C9AC 3K77A 3H3LA 4Q0VA 4Q4X1 4E4ZA 3AP9A 2BNMA 1OF3A 4LR4A 2HWF1 4LHSA 5HV4A 1H1MA 4PLMA 1ND2C 1KITA 1W99A 4YRDA 2CGNA 3I4ML 4E9KA 2B7YA 2JG9B 2P3KA 2FDHA 2JG8B 1WCDJ 4AQSA 3CJIC 5A6ZA 1KFUL 3VZLA 4QKBA 4X8NA 2APOB 1JYCA 2AR6A 3UJQA 1TQ5A 4GXLA 1HRV3 4P9LA 3MDPA 4QKFA 4PBPA 3TEYA 1NLRA 3RZLA 1TNRA 5FJHA 1YFYA 3RZDL 4UYBA 3HOUL 5IK4A 2WZPP 3E6BA 3FDJA 4LT5A 3MIGA 4WVWA 1MVEA 5I91A 2R063 1T9OA 2QQIA 1QIQA 3VL9A 3A0KA 1J83A 1VIWB 1Y7BA 1ZREA 8RXNA 5T52A 4B4PA 1C28A 4AVSA 4A3CL 2W52A 2RDSA 2ZGLA 2LROA 4LO4B 3VHNA 1DP0A 1PNGA 4Y5SA 2KM2A 5FPVA 5C4WC 5D21A 1CIWA 2HWC1 3V0AA 1UX7A 2DYCA 1IQAA 5FLJA 1F4LA 2IXHA 2YY1A 2VOVA 1RVF3 3ZFFA 3NWKA 5LA0A 1KEXA 1SPPA 1CQ9A 4AR4A 1GP5A 2PHLA 1ULFA 5EPAA 1W0NA 3KSCA 4HOOA 2CGPA 4QXKA 4CU6A 1UY0A 1X82A 2WNOA 1ZRIA 2NVXL 3P6BA 4RR3A 2WN2A 1IS6A 1O4YA 1S0FA 4L92A 4ASKA 4KWLA 2V4AA 1UD1A 3ZN4A 5GZEA 2BPA2 3GTPL 3WT3A 4WVZA 3WDUA 2L0ZA 2PLV2 1S0GA 4LORA 3BOPA 1ZZ9A 2ZGNA 3BALA 4JAAA 4XQ4A 2XJRA 3VPBE 1VAKA 5F2WA 3BN6A 4V2WA 4NAMA 4TPUA 1BBT2 4AI1A 1BK1A 3TN91 3O0WA 4AQ6A 5IK5A 5DG1A 5FZGA 1AR91 3DUIA 1SFOL 2ZBJA 5IVEA 5K8SA 4COWA 4PIXA 1U5ZA 4C0BA 2R1DA 3UV9A 2BQPA 2QQNA 4I0BA 4AVTA 2RS11 3BTXA 4UT5A 1DQ5A 1V9U1 3GTKL 3LWPB 2P6HA 2ZEXA 4Q2FA 2WUHA 4P9GA 1O3SA 2AZ5A 2PYTA 3H1WA 4JHTA 5FYHA 1X9TA 4CCMA 1CWPA 3KYYA 1AYN2 1S0EA 5FK7A 4NOTA 2BEOA 3PNAA 1TNFA 4Q0UA 1ND3A 4H2AA 2PVEA 4LO5B 4M0NA 1KD7A 3D4KA 1CPNA 1NUKA 1CPMA 3ON7A 1G8WA 3QVDA 5LEKA 2DCJA 4A44A 4BY1L 1RUI3 4YSFA 2O14A 2BGOA 1H1AA 1RUF3 1H2MA 4B1LA 3EO6A 2RV9A 3R4SA 2O8OA 1QNYA 4MGIE 4B4QA 4D3WA 3ILRA 4EN8B 3N3HA 3T1LA 2Z79A 2DUOA 4QXBA 3GHMA 4Y26A 5C33A 3V56A 2OIIA 1I3QL 4ZN1B 1NCQC 2XONA 4IE7A 3PO3L 4BOWA 4Z2WA 1CAWB 1LHUA 3T0DA 2NYYA 3USUB 2RS51 4YG6A 2ZZQA 1CAUA 4D7YA 1EAH1 5HCAA 2YBPA 2LS6A 4FFGA 4A3EL 1RUD2 2WT1A 1GUIA 5LBCA 1ZA7A 4A3LL 3RFRA 4BK5A 4F3JA 5I0SA 3ST7A 5DDJ1 5A7WB 3ZSEA 1HDKA 2Z3RB 4K20A 4UFMA 4UFHA 1DYPA 2GC0A 3APBA 1LAJA 4Y3OA 2WNVB 2PHDA 3DYMA 3GF6A 2YC2A 5FIXA 1X36A 5KHKA 3OPWA 2R072 5DM71 4LHKA 4S2HA 3B01A 1CIYA 3CIHA 3ETPA 3KCXA 3O14A 5IP9L 5IAVA 5JXHA 3VD7A 5IYBL 4MGSA 1AR73 4BQYA 1S0JA 4B1MA 4FI9A 2VUAA 3KGZA 3T2PA 4R4XA 1N1SA 1POV1 2OZJA 1F4HA 4INDA 3O0XA 3WX5A 1JYVA 2C24A 5DUWA 2WO7A 4FPGA 1ZBA3 4HZFA 1JZ7A 1HV0A 3DYOA 4XJ9A 5A7SA 5JCTA 4FO9A 4ONUA 2YDEA 3IM0A 1UN1A 3AMPA 4ZU4A 1VBB3 3AZXA 3E5QA 5DAVA 4CA9A 4KBZA 3PIO1 2JA7L 1CD3G 1GOHA 1CAXB 2PELA 3G7DA 1SLIA 3H9CA 4LBJA 5L9BA 3WG3A 4GS7D 5DG2A 4AFBA 2VVEA 4FOVA 3J8F1 5FY5A 3VBRB 1BFYA 1MACA 3KM5A 1FOD1 4HONA 4CEYA 4FP2A 1YNAA 1AJOA 1G6NA 4ZXEA 1S4CA 4OUSA 4Q4X2 3TYJA 2WNUC 4GQ7A 1X9PA 3JB4C 1D0HA 5JSPA 4AYUA 4XMIA 2HWF2 3ZKYA 4XACA 1AR63 1JMUB 4OI1A 2X53S 4XF4A 3ZFGA 5L7OB 3E6DA 1F4AA 3O1MA 1YHFA 2IWGB 5J1XA 2BBVA 3WG2A 4I0WB 3WDYA 1R0HA 1UU5A 4QPGB 5F32A 2B8MA 3PDQA 3D0SA 2L9LA 1C5HA 1YIPA 1UYPA 1O7FA 1ZM1A 2ZJCA 1BVP1 1OSGA 2WAQP 2QQKA 4Y1VA 1Z7S3 4FFIA 4XGHA 5C3RA 5GALA 4CDWC 2AEYA 2F6BA 3VKNA 2ZGOA 4C3IL 1CAVB 1GNYA 2FMDA 1C4RA 1QKQA 4N53C 4YW2A 1REEA 4WV8A 5A3OA 5AC91 4FPKA 3LPEB 1LB2A 5MGNA 1VRH1 2B63L 2ZZJA 1JYXA 4CCDA 4DEQA 3UKTA 2VGDA 1DGLA 1JS9A 5FYSA 3I59B 3GM8A 1QOTA 4JAEA 2VZSA 1DCSA 4LA2A 3KZ4C 1W03A 3D3AA 4JTOA 1VBE1 2BERA 4GWMA 4AEDB 3P5BA 2DURA 2EA7A 5LBEA 1I5PA 3GNEA 2D7FA 3KF5A 4LULA 5H9RA 3P8BA 5LA2A 3VZOA 4CEWA 4XCBA 2ZX3A 2HWC2 2PAMA 5K9YA 2H6BA 3MGUA 1W6NA 4XFIA 1S2BA 3GTGL 1KQRA 4COUA 3LPGA 4YVSB 4ZZ8A 4IEQA 4MHUA 4AQ2A 2Y33A 4CCNA 2EF6A 1JHJA 1H9PA 1POQA 3FMGA 3G6JB 4XDPA 1K45A 4XZPA 2OXBA 4CP0A 1O6UA 3NFPI 1LOFC 4XJAA 5CA6A 2NQYA 3H42B 4HVOA 3T1MA 2R93L 4K7JA 5FJKA 1MS3A 4CE8A 4DZGA 1QH6A 2DWRA 2HWD3 4Q4Y3 5FLML 2C0ZA 5GADc 1IS4A 3N9MA 1UZYA 2W2IA 4U36A 1UY4A 4UFLA 2VMGA 5FZEA 2VTXA 1J1LA 5MFPA 5LA9A 3TN92 3M3YL 2WLPA 1ND2A 1XU2A 3FKIL 4PBOA 5M5YL 4Y20A 1LOAA 1H9WA 1AR92 3ZIXA 2E2IL 3B3QE 4QQPA 2XJTA 1RUG1 5EJZB 4CUBA 1V6NA 1W9TA 3CJIA 1PM4A 1MS5A 2ZHNA 1TMF3 4QPIC 4RHV3 4UY81 5DPNA 5FZOA 5JI7A 1OT5A 1MQTC 1ZZCA 3S2DL 3CZJA 1RHI3 1JXNA 2RS12 3M3OA 4JQTA 5EHDA 1B2OA 1V9U2 1HW5A 4UXAA 2DSXA 3NSTA 4XABA 3POWA 4RSUA 2A71A 1JOBA 2R0HA 2MHFA 3B94A 1UXXX 3WZ1A 3J7NA 4N43A 4COVA 3KD4A 1IPKA 2EIGA 1IS3A 1ODMA 1OWBA 2QNKA 3PMSA 2BJSA 4LKSA 4NVPA 4QHOA 2YU1A 3HT1A 1BQ9A 5FZ9A 1WD3A 3ES4A 1GWMA 4EN6B 3MYXA 4KG8A 3GALA 3BTYA 1MS0A 3SH5A 4DXSA 3KHCA 4DEVA 1I1EA 3IDAA 2B39A 3VBFB 2JDKA 4CCCA 1GZTA 2C26A 3WW3A 2QKDA 3WP6A 3J26N 1ASJ3 3BB6A 3VGIA 2XLGA 4HK8A 5JOYA 1TZOA 1OOPC 2W39A 2VQUA 1L7RA 2Q8OA 1DQ4A 4AF9A 3KCYA 4A7ZA 1W2UA 2BDRA 4J6GA 1ZNPA 3KLSA 3DL3A 4AK3A 2DCZA 3HMYA 5FR3A 4UW4A 5M5WL 1YK5A 4BY7L 4MYEA 5RXNA 1I9RA 3CNAA 1PO13 5F9TA 3I3QA 1VZGA 3ZFEB 1TME1 5FZLA 2SBAA 5CKMA 4GMP0 3I3BA 2EIEA 2JIJA 2RS52 1OPMA 4NIGA 3VHOA 1EAH2 2IFRA 3RPQA 3AP4A 1HRV1 3BGAA 3KT7A 5ERLA 5GLWA 1N1TA 2W9XA 4JKLA 1GZ9A 5DDJ2 2K46A 4YW5A 3PJQA 3K4ZA 2K0GA 4JGZC 3JXSA 1JZ3A 1WBFA 3ZN5A 1JZ5A 1A8MA 1WW4A 2EALA 2ETEA 3H3ZA 1Q56A 1YFUA 2XJVA 2G9GA 4LA3A 4NHMA 4QQHA 2R061 3WOGA 4XF3A 4YM1A 3WNPA 4BQ3A 4QU2A 4BBSL 3SKVA 5CADA 1WBLA 3W5NA 1HV1A 2QVSB 4MV2A 5FXZA 3ZXFA 3CBNA 1YJKA 3A4UA 3BI3A 1LECA 4D94A 5DMYA 3D0JA 1CGPA 5FZ3A 2OZ6A 3RRDA 1PO23 1E5SA 5FZ6A 2XWJB 4A41A 3O1SA 3HJRA 3CHXA 5M5XL 2D6NA 2EXIA 1CAUB 1FNYA 2V0FA 1WMFA 2XL9A 5A7OA 4AG4A 1RVF1 3VBSC 4IGOA 4ZONA 2GNBA 3VKLA 2C5DA 1C8M3 1YLLA 2CWSA 2VVDA 2W1UA 3M1HA 1QJFA 3QH6A 3J8F2 1XYNA 4YWAA 2W08A 4O65A 1LOCA 5EV7A 1PZ7A 1FOD2 2F4PA 4IEVA 3VHPA 4OULA 2ET7A 4FOYA 3LD8A 4XTMA 3O7OA 4PF1A 2GMGA 3HOWL 1YFWA 2W1SA 1VB4A 3M70A 3T0AA 5C3OA 2FCVA 2D93A 3GYDA 3H1YA 4PF5A 3AX4A 1UY2A 3H0OA 3IT8A 5KHIA 2HBTA 1UIKA 4A6OA 4XJZA 4BPZA 5IUQA 4AL9A 2IXCA 4OHYA 1DQ1A 5FPXA 1MZFA 1OLME 2VBBA 4KWKA 4EROA 1U5YA 2VQAA 4NO4A 1NCQA 1UW8A 1D2SA 1SMUA 2VJXA 4RQPC 3SEEA 2DF7A 4AWDA 5LZ6A 1UU4A 2ZGPA 1N1YA 1V00A 1STMA 4CCOA 5KC5A 5KC6A 3HWJA 1K12A 5I8TA 2X8KA 4YARA 1FI2A 3W9AA 1VBC3 1W2TA 5HXMA 5AC92 2XVLA 1VRH2 3RG0A 5JOWA 4Y4YA 4OHXA 4LITA 2ZAHA 3VD4A 1FAYA 2K9ZA 3BIWE 2J1SA 3ES1A 1PX4A 3K3OA 3ZFGB 3MZHA 3RZKA 1WGPA 2A6ZA 4IV1B 4K21A 4I3PA 1VAVA 4XBQA 1VBE2 3S14L 4HBNA 3ZXAC 2WABA 4AVAA 3S30A 4A2UA 4QX5A 3J7MA 3DKWA 4NRPA 5GZGA 3MUY1 1H4HA 1RUI1 2AH2A 2VCAA 4H14A 3OPTA 3THDA 3KCCA 1B09A 4CDXC 3D82A 1OD3A 2QQLA 3AL5A 1RL3A 3OBTA 4P9XA 1ONAA 4IE5A 4BQWA 3AM2A 4XETA 2I45A 5F6KA 3KHBA 3POGA 3V0BA 2Z5WA 4XUOA 4AFAA 4LLFA 4Y5Z0 3NQHA 2CV6A 3NMBA 3LE0A 3E5XA 1DX8A 1WLTA 1ZRRA 2BE5D 1GR3A 1YQ8A 5JR7B 2GC3A 2VZOA 4A3XA 1CN1A 1K5JA 2WNUA 1QQTA 2DVAA 2NMOA 3IPVA 2QL0A 4HN1A 2ZOEB 3MV01 3H9BA 1IKQA 3I2DA 4JAGA 1PGW1 4GIQA 4QXHA 2VC9A 5F3IA 4CP9B 5KHJA 3H8XA 1I6HL 5LY1A 3RGBA 1QDOA 1GZCA 3LFMA 1EPWA 1W6NB 1OA4A 1TWAL 1N3QA 2QQWA 2TNFA 3SKJE 1RUG2 3UETA 3CKHA 4LBNA 1IPSA 3OF1A 4KWUA 5J96B 4ZHNA 1ENXA 2GMMA 2WINB 1LU1A 5F7UA 5GZCA 3LCPA 3MW2A 1SLTA 1JOPA 3P2AA 1H6YA 5F2SA 3T4HB 3WP5A 3B93A 1AR71 3CF6E 4FT8A 4FCAA 1UOGA 4CDWA 1W6MB 5KXDA 4C1WA 2JWPA 1VMJA 5L36A 4YGBA 2UY8A 4I30A 4NUBA 4N53A 3K46A 3E5UA 5A3PA 1CX1A 1LHNA 1ZBA1 1JZ6A 4AHXA 4UFKA 4FPJA 5EP9A 1RC6A 2NLRA 5C9AB 1R1A3 3IMNA 2UWCA 4WVMA 1LHWA 1REFA 3CQOA 3MEPA 3N9NA 4SBVA 4GALA 1ND2B 2JXAA 5F5CA 1CONA 4CPBA 3AK0A 3M3QA 3WUCA 3OYWA 3U1XA 4FSJA 2YGMA 3DV8A 1HJFA 3CEWA 3WDWA 3ATGA 5IVVA 1W04A 4JKKA 1XOYA 4AEKA 1I3HA 3B9CA 5FZOB 1AR61 4Y1XA 1X50A 1OUXA 3KT4A 4CU9A 1W3XA 4GB33 1PGSA 4C90A 3ZSLA 4YW1A 5EYYA 1TME2 4YWLA 1N47A 1FYUA 5A32A 4XJWA 5BNOC 3FLTA 2VD7A 1LOFA 3ZYRA 2XBO3 1GMMA 2QDNA 1AR83 1Z7S1 4MZUA 1Y43B 3PLQA 2JX9A 2R7EB 1QXJA 1HRV2 2A3WA 2DCYA 4NROA 2RDNA 1AVBA 2E9QA 2DFBA 5C3EL 2MNGA 5BNNC 3C8XA 3K75B 4ASLA 5FQ0A 3OD0A 5EXOA 3VN4A 4PCRA 4IDZA 4CCJA 3ZR5A 1GOGA 3A22A 4FOWA 2VU9A 3ZDVA 3WWLA 4LHNA 5C4WB 5LW9A 2R062 2WA4A 5EQUA 4GH4B 5IK7A 3WCSA 1YWKA 3MF9A 3N7KA 1DU3D 2VZTA 4LO8A 4QGMA 3ZMOA 4ZZ5A 4AR3A 3PVOA 4W6WA 1K3IA 4LPLA 4KG0A 4R9BA 4E27A 4FAHA 5CNAA 4YZ5A 4MGYE 4QPIA 3U10A 5J3UA 1S2EA 1MQTA 3LPFA 1XXNA 2D44A 2WYFA 2XR4A 4WM8C 1RDVA 4XXPA 2X5IC 4G9SB 1NNQA 2RJLA 3VBUC 3POSA 3BTZA 2MS3A 3AP5A 4PDWB 3RI9A 2FDFA 4UW3A 1MZ5A 3TAYA 4ET7A 3I4NL 3WF1A 2HH9A 2H0BA 2RVAA 3EMRA 2VTXJ 1R1ZA 1RVF2 2DUQA 4OUMA 5BXXA 2WSVA 3U75A 1W2NA 3CZUA 4CP2A 2EAAA 3S1QL 2RMU3 2JDYA 1HJGA 1XNDA 3LSEA 5LWBA 1HQNA 3LEKA 3C3VA 4IEWA 3P1IA 2PMWB 1WCML 1SBEA 2NVQL 5FZMA 3GJBA 3BTAA 3IDCB 3LF7A 5C4XL 1TG7A 2JDMA 3VHRA 2HWD1 1HRI3 1RYTA 3NV3A 4W8JA 1LOBA 2M6OA 5FOJB 1OOPA 1GNHA 3WQBA 4BA6A 1OFNA 1OUSA 5HCBA 4BIOA 2DV9A 3PUSA 1ZZ6A 5L9RA 4HANA 2XH6A 2R32A 2VW1A 3MHZA 5CFCA 5LK5A 2JA6L 1GQGA 4BDVB 3DGTA 3RZZA 5FY8A 2WQZC 1F5FA 5FY9A 2XJPA 4MGKE 5C6CA 1C3HA 1TMF1 2WBKA 4RHV1 1T2XA 2Q8EA 3FE5A 3T0BA 2QUOA 4CDUB 1RHI1 3E1F1 4ZPIA 3SCHA 4M3CA 1W6OA 1XRUA 3SXWA 1RJ7A 3LNLA 3WCRA 4AI9A 2HWE3 3JZVA 3M4FA 4ARYA 4TZDA 2EXJA 2ZIXA 1AX2A 1R64A 3W58A 4JGZA 5GKAC 3FWEA 5C44L 1UZVA 2E31A 4G6BA 3AYEA 4JV4A 4Z07A 3ALQA 2WWSA 4MGZE 2E2JL 1YIFA 2D98A 3H97A 1OC1A 4QX2A 4WFN1 3AKSA 4QIWP 2BV4A 1Q8PA 4YG3A 2FBEA 2W5FA 1CADA 4Z82A 3ZSKA 4A42A 2M4VA 4MX3A 4OFGA 1KRIA 3O1UA 2YV8A 4XFAA 1Y3TA 1RUI2 1DZQA 4QD2A 4CDQC 4YWMA 1LTLA 1LNSA 2HWB3 1B35C 5GLVA 2J1EA 3S15L 2BU9A 1FATA 3OGJA 1APNA 4C0HA 5LBFA 2PHUA 4LK6A 2JIGA 4JGYB 4NRMA 4UBHA 2XUMA 1LHOA 3T2TA 3VBSA 5JSOA 1LRHA 2ZGMA 5C8CB 4AFCA 1PO11 3CU7A 2AQCA 5F5IA 3PUIA 5JSRA 2W91A 4QWNA 1ZVFA 4LUKA 4IV3C 3RWKX 4FBFA 3H99A 2AEZA 2PA7A 1ENSA 1O3TA 1IROA 4L2NA 1R9TL 1ULDA 3A23A 4B4RA 3IZOA 3NAPC 4A3IL 2OUJA 4P9JA 5FPUA 5CG9A 4K1ZA 3OPZA 3PKJA 1LKNA 5EJ1B 5J09A 1WMEA 1PGW2 1Y9MA 4EN0A 2QQOA 4CUAA 2YPDA 5I8SA 1WD4A 4Y52L 3VBHC 4BJ0A 1YK4A 2WR9A 3RJ2X 1GFF2 3PHMA 4YZ1A 4MGTA 4LBQA 4GAZA 3FZ3A 4YLZA 3OJBA 4DY3A 1RINA 1LOGA 1NQDA 5L73A 3RQ0A 3A7QA 4AI8A 2PHXA 4RQPA 1ZBE3 1AR72 4HPKA 1QU0A 2ERFA 1F2NA 2G9ZA 4AGGA 3ZYGA 1KDKA 1RUOA 3WLUA 1PO21 3RMXA 3MO4A 1TWFL 1YCIA 4MXWA 3PL0A 3TEWA 1ULOA 1ZBA2 2VZQA 1NT0A 3I2HA 2P3JA 5FPLA 3N9OA 1FMD3 1FT9A 3HNYM 3IPVB 3ME2A 1W6PA 3ZR6A 5E89A 4CCKA 1UO9A 4N43C 1RUH3 1C8M1 2JE7A 1PZXA 2UYAA 2RR11 3MLJA 2R1BA 4Q26A 4M01A 1R083 4FTBA 4Q5OA 1JYTA 3ACFA 4FXGB 4B8EA 1SBDA 4A7YA 3LWRB 1DGRA 3MBWA 3KVBA 3K2OA 1SEFA 4GMP3 4QDRA 4QB2A 4UBGA 1GANA 4Y1YA 5A3LA 1AR62 3INAA 3AZYA 2EIDA 4N9HA 1CVNA 3ENRA 4CDWB 4CDXA 2ERJA 1BK0A 1F5JA 1ZRPA 1O59A 1OKQA 4XF9A 2XUEA 2Y6GA 3I7DA 5DZEA 1UU6A 4HSLA 1V70A 3VD3A 3LWCA 5F3EA 1UMHA 3BU7A 1Z7S2 3ZX7A 1MVQA 2GN3A 5IT6A 1NX9A 4D6QA 3OD4A 3WHUA 3K7AL 2XLAA 3N35A 3HJWB 4FPLA 3MIEA 4ARXA 1VBC1 1WA6X 2VUML 3WVJA 5FPBA 3FLRA 3UT0A 4EWAA 2V5DA 3RMYA 3QOPA 5M3FL 1TE1B 4IEOA 3BYWA 3H8OA 1CZSA 1MZEA 3OBZA 5FYTA 3VBOB 1DQ0A 1SG3A 2K2SA 5FY0A 3B00A 2V5YA 2VBDA 3N9PA 5CISA 1YO8A 5LASA 4BXXL 3CLPA 2QCSB 5HCFA 1JODA 1H0BA 2YU2A 4E6YA 4Z92B 3JUUA 4ES8A 2D3RA 5A32B 1HKDA 2IVIB 1T6GC 5FXVA 2Y0OA 4NRQA 2BUKA 3ETQA 1NCRC 3MPPG 2OPWA 4UF0B 1XC6A 2IXKA 2O1QA 3MFAA 1HB1A 3DXTA 1OVSA 3J7Y1 3M7AA 3WG1A 6RXNA 5CB7A 3AMHA 1OH3A 3ORJA 2YGLA 3Q9OA 1W9WA 4DRVA 5FQ0B 5FK8A 1WMDA 1AJKA 2VULA 1PK6A 2Y6FA 4V1PA 3HOYL 2LRPA 1XB9A 1W8NA 4NIAA 5ACA1 3S1NL 4S2FA 4I3GA 2Q8DA 4QB1A 1Y9GA 4FPFA 4Q4Y2 2HWD2 1Q3EA 1UMIA 5E6HA 4LE4A 4LO7A 4YM3A 5FY1A 1UKRA 2ZEZA 2QBXA 4PJYA 4IUGA 4XAEA 1K83L 4OLLA 1J59A 2Y34A 1UPSA 3DPRB 4AHZA 5IP7L 3PO2L 4QQ2A 5AVAA 4BQXA 2JA8L 1D0GA 4E2QA 2HYKA 2VMDA 4IERA 1C57A 5BNOA 3KT1A 3RI8A 3VDDC 2ENRA 2ZHMA 5ANQA 1TMF2 4RHV2 1EY2A 4NPRA 4XOGA 2VMHA 5F3GA 3WF0A 2BTVC 1RHI2 5JZGC 4LBQD 2UWAA 2EAKA 1H8TB 2XVGA 2OT7A 5FYUA 3MIDA 1MR5A 5J36A 5BNNA 2R7ZL 3C7OA 4HN0A 5B2GB 3FN9A 2ZGKA 5FREA 5GAGc 1YFXA 1ZRCA 2YUEA 1QNWA 1W9YA 4L11A 2VNVA 2WFF3 3OGRA 3U0ZA 2JB8A 4AE2A 4G4FA 2W3JA 2WZR3 1HN0A 1HX6A 2GMEA 2ZKLA 5D8AC 3NV1A 1HQWA 2B4KA 1UXZA 4E2SA 3OY8A 5ABJC 2LUWA 5K0UC 4MXVA 1ASJ2 2N7GA 4YFZA 1UY1A 3PU8A 2VUDA 4WM8A 2GALA 1ENQA 4P5HA 3RJRA 4WM7B 3ZPYA 1NY71 2X5IA 3GDBA 3GZTB 3AKQA 3VBUA 5F3CA 4I02A 1IOAA 5A3WA 2YYOA 2IVJA 4LHLA 2B42B 1J3RA 2RM23 4BWOA 3UK9A 2XKPA 2V72A 4JDMA 4M0HA 4GB31 5FLIA 1PO12 2YC0A 3SH3A 5LRRA 3SISA 2B9UA 2XMLA 3L2YA 1GWKA 4ZXKA 2X09A 3T4VA 1JYIA 2NYDA 5KBFA 2XBO1 3ZLIA 1AR81 2TEPA 4WZFA 2WAOA 1QJZA 3TNQA 1F35A 4CSWA 4KQ7A 2OPKA 2CHHA 2PPTA 3ZYJB 5JVH1 1UCXA 5FO7B 4IGQA 4AEMA 3AZVA 1SBFA 1S0CA 3Q8EA 3JBG3 4WVVA 1ULCA 2PAKA 4BCUA 2VZ3A 1JZ8A 5LEJA 1GV9A 1PGL1 2XB6C 1W2AX 3MLLA 1WW6A 3TRSB 2NM1A 2O0OA 4SLIA 3ZXDA 1O5UA 4J25A 4R9DA 4XF0A 3IDBB 3VB9A 1LU2A 1W9FA 2JG9C 1NXD1 1A3KA 4Y24A 3RWNA 5KXEA 3I2FA 3TB0A 1UZWA 2GMPA 3MSUA 4XILA 3WNOA 1IQDC 1PO22 5IYDL 4Q1PA 3ZMNA 1W28A 1BQPA 2OX0A 2YB7A 3L2HA 2SLIA 2EIBA 2Z2SB 5SV5A 4JC1A 4RS5B 2B45X 1U0AA 2OQ7A 5FZBA 2FDGA 1T6BX 2VL6A 4ISQA 3AYCA 2ZMLA 3OBAA 2C6BA 2X10A 5JXIA 1C8M2 4OZOA 2CSGA 1D4M3 1OF4A 2RR12 3ABZA 1S0IA 4MGQA 1LJ7A 3I2KA 5A7PA 3PZAA 1W8HA 1C1FA 2VBPA 3FFQA 4LBQB 4W4ZA 4K8FA 4GKXA 2V4VA 3IBMA 4XQDA 4W50A 4CDQA 1HRI1 5FOBB 1D4VB 5FZ4A 5CZKA 1B35A 4RQPB 1EV11 1RUC3 1G7YA 2AENA 3RSJA 1X8MA 1YI9A 2YC4A 1DFQA 2ZX1A 4PI2A 3ZXLA 4EJRA 1JI6A 1BKZA 3K51A 2WQ8A 3C7GA 2LTNA 2E7TA 1WUVA 1IRNA 3PUQA 2DVDA 1OMIA 1BQ8A 2R30A 3B9IA 2R92L 3FX3A 1UL9A 2IXIA 1G86A 4MH0E 4XUPA 4HETA 4XVHA 1W6PB 4P5YA 4IV3A 4A3KL 4BISA 4UFJA 3R05A 2YBSA 2PLV3 4AYBP 3NAPA 4RGGA 2X05A 2EY4E 1VBC2 2ZGQA 2HWE1 4X6RB 3MW4A 4ZKTB 1JBCA 2KA3A 2OUHA 4IXLA 1VE0A 2Q0AA 3RZ6A 1RJ8A 4DQAA 1OFSA 3VBHA 1WMXA 2DVGA 4YM2A 3NNJA 4DPNA 1AUYA 5DZGA 1QJEA 4NHXA 2GP3A 1WCKA 2ZGRA 1VRBA 2PHRA 1QYBA 4Z2AA 2Y38A 4TSVA 4NHKA 3V0AB 4QX7A 2A6ED 3J4UH 2ZS6B 4HSJA 5AN9H 4Y33A 3JD73 1RXGA 3HBKA 2HWB1 3DYPA 1A78A 1R093 2VNRA 3ZFFB 1QHDA 4A4AA 1SPPB 1AYN3 1XNBA 1Z92B 2BZDA 2JICA 3WD5A 1DYOA 1UKGA 2BYVE 2H0VA 3AFKA 2O5JD 3Q8CA 2E6VA 2WS93 1US2A 4R4ZA 5LATA 4RR3B 4TVMA 5A7QA 2YHJA 5T54A 3VZKA 4HVRA 1IW7D 3EB7A 3H8UA 5ACA2 3NNMA 4TXWA 3M3IA 3SQOA 5A1AA 4ZY9A 1EP0A 5B4XA 4PLOA 2Q1MA 1QJU3 3FUOA 1Q8SA 5CYYA 4DUXA 2MPFA 4HL0A 2G9FA 2C9AA 4HT1T 3AFGA 1OHFA 4Q8KA 3RZOL 4FXKB 5AI3A 5AVPA 5EINC 2IUWA 4LMFA 4OMCA 3GBGA 2D3PA 1IZ3A 1IG0A 1DIWA 1ULPA 2HEWF 4Q0SA 4XW3A 3SCGA 4BLJA 1KS5A 3HD8B 1N3OA 4MSVA 2ZHKA 3QBQA 2ZXQA 4OCTA 3KYVA 4DOUA 2J42A 4XUTA 1NA1C 3FC0A 1MEC3 3NJYA 3E6CC 4H55A 1PNFA 3IAPA 4EWDA 2W1QA 5CFCC 3WG4A 1QWRA 2J7MA 3MUZ1 5FMDA 1ZBE1 5FWEA 1K5MC 3POEA 3ASIA 4META 4FPOB 4YVWC 5FYYA 5FZDA 3LOBA 1W9SA 3H8RA 4B29A 4BBRL 1KS4A 4XAAA 1VMFA 1YQ5A 2VCBA 1ND3B 2CDOA 4XIOA 1FMD1 1L7QA 1R1A2 3SITA 2ORZA 1C1LA 5MLC3 4CZSA 5J7MA 1RUH1 5C4JL 1O5LA 3BKZA 4NIDA 3U78A 1LCLA 2ZKNA 5I0TA 3OG2A 3A0NA 2WNVC 4JX0A 1ACCA 3UGFA 1QOSA 1SCSA 2YFZA 1NY72 4KWJA 4GMP1 5DABA 4A93L 3FHIB 4YW7A 3PUHA 3M2MA 1IU6A 4YNIA 4HG6B 2HEVF 1NCRA 1K42A 5JOZA 3O0VA 5IVJA 1XQNA 3KGLA 2GH2A 1W3VA 4GB32 4PQQA 1A6CA 5CKQA 3GBWA 1BZWA 4UW5A 5F1RA 4YZ2A 5A3UA 4NWWA 4EYUA 1ZX5A 1ULEA 1LOEA 5CFDC 2WKKA 2UURA 2XBO2 4IE4A 4C8DA 3AB0A 2GZWA 1AR82 3IIIA 1TWCL 2ARCA 3S5AA 1OWCA 2HEYF 2ARAA 4AQTA 1IS5A 1VBD3 4KU7A 4ATFA 1J3QA 2WZEA 3UYJA 3PL5A 1GLHA 3IIAA 1W05A 1S30A 4QXCA 2WIIB 3B0AB 3HEIA 4QHZA 1PGL2 3OSDA 2W87A 2XWBB 4KNCA 1WKYA 4O7XA 2Q1FA 2JDPA 2AC1A 2VTFA 3PVEA 4U2AA 4XXAA 5D1IA 1NG0A 2IXLA 2ZPXA 5E16A 3RYPA 3VDDA 1O8SA 3WP4A 4A3ZA 1GICA 1G9AA 3I3DA 4L97A 3HQXA 5JZGA 1E8JA 1FHHA 1QQP3 2IXJA 2A70A 5CU1A 5FY4A 2W92A 4CCLA 4R9CA 4CYDA 1QCVA 3WWNB 1RUE3 2WT0A 3EYPA 4E8DA 1PZ9A 4IEZA 2JDAA 5A3TA 1W06A 1WWYA 5I8YA 1FPN3 1W90A 3JR7A 3ACLA 2VMFA 4FPYA 4CEYB 1XE8A 1T9PA 4DY5A 1UIJA 4LO6B 3WF2A 1J58A 3JCIA 5D8AA 2WFPA 4WBBA 5ABJA 3H7YA 3PMEA 1FV3A 2D6MA 1CJDA 5TSWA 5K0UA 3T09A 4AFDA 1HRI2 2GP5A 1D2QA 4HMZA 5K4LA 4BYYA 1EV12 2R49A 4BQ4A 3V64A 4AEDC 1CZVA 1PFVA 1LESA 3AXEA 1MS4A 1RUF1 1PFUA 2YG0A 3HR9A 4FFHA 3KVAA 5E1RA 2FZ1A 4YVSC 4QX8A 1GWLA 4CU8A 1NE4A 3O1TA 2PN5A 4FFFA 2WO3A 1GP4A 1QXRA 2GN7A 3R4UA 3WQ1A 2G4IA 4GA9A 1JOJA 4KMQA 4DIQA 1UYYA 2Y26A 2HWE2 1NE6A 1GZWA 2Z4FA 3HIFA 4GZ9A 4HKWA 5A6QA 1COV3 3TN93 2NPIA 5JMOA 1UWWA 2BGPA 4XBLA 1V6IA 3THPA 3P3PA 2FQPA 1WW5A 3JQWA 3ZVXA 2P2KA 2VECA 1LHVA 3L9JT 1QJY3 3PTRB 2WFF1 1MPXA 2FCUA 5D2AA 3ZYIB 3H9AA 1PIV3 4MADA 4PIZA 2BNOA 1T9QA 1ST8A 4XPVA 5A6XA 4CEWB 3GCXA 4JADA 2RS13 4JZRA 1UOJA 4OYUA 1GBGA 4LIUA 3LA2A 4R9AA 5GJ6A 2B5HA 2JG9A 4URAA 1RUJ3 3FL7A 5KWRA 2HWB2 2JG8A 4Y4RA 4IEYA 4ZU7A 3AMNA 1IHMA 2G19A 4IV3B 2V73A 1L7LA 4QT6A 2IZWA 2DU0A 3SS2A 3HOXL 1OKOA 2YU9L 1U5IA 5JI9A 5FP9A 3NAPB 5LA1A 4O9GA 5FZ1A 1QF3A 4XJ8A 4S2DA 4CU7A 1ALYA 3LIGA 3OUHA 3POIA 4XCAA 3POBA 2WAAA 2ZMNA 3I54A 4P00B 4XXBB 2A75A 5BNPC 3NNLA 3PVBB 1VBB1 3HPNA 3S16L 5T50A 1PK6C 3ITQA 5IYCL 2VQTA 5FYMA 5HCHA 4GJZA 3I3MA 3NO8A 4K6BA 3EXUA 1V6KA 4N9IA 4Y20B 5C3PA 1NXGA 2XJQA 3VBFC 2ZGTA 3I2GA 3MV11 5FUIA 4Z8BA 5APAA 4LLOA 3K4DA 1AYM3 3CJIB 2H12A 3JBG1 4L8QA 1DZTA 3CQZL 2B9VA 4FAGA 1Q5OA 1A34A 4NIHA 1PFWA 5JVG1 1S2ZA 4D69A 2R043 3T2QA 3WINE 4HVQA 2GC2A 1IGOA 4LQRA 5F6LB 3RDIA 1ZBE2 3R4DB 3CL1A 4B3NA 4N43B 3ROUA 4BU2A 3ZFEC 2BBAA 5DDJ3 3KS7A 5MF6A 1V6JA 3UESA 1F8VA 3M4OL 2WRAA 1F15A 2PMZP 1CX4A 4EE2A 3HKZP 2ZX2A 3N9QA 2VZVA 4POFA 2LM3A 1FMD2 3K48A 4PHZA 4DNYA 2ZACA 5LBBA 2XQRA 3LWQB 3WNLA 2DVBA 3OGVA 1RUH2 4YW3A 3ZIWA 1QOOA 2PFWA 4GJYA 1D4M1 4TTGA 1YC61 1KDMA 1R082 1UOBA 3WQ7A 4AR6A 1Z78A 2A73B 3B7MA 3T3YA 3U37A 2CWMA 3S1ML 2W1WA 4BQ5A 1NLQA 4V196 3BCWA 5FO9B 5GLZA 1OLMA 1SFNA 1J1TA 2VZPA 3FBYA 1RUC1 5FKBA 3ZYPA 1VCXA 2ZX4A 3UGHA 5IW0A 3CO2A 2ARXA 5FFOC 5FZHA 3S7EA 3WQ0A 1UQXA 4Q4W3 4PIYA 4RYDA 4XHXA 3THCA 3VD5A 3WY6A 2VAUA 1W6QA 4XE9A 5HBAA 5LB6A 4NHLA 2ZTNA 2WWJA 5FBZA 4BMBA 5C8WA 1ZRFA 3ZXGA 1RUNA 2BOIA 3HOVL 3KV9A 4BH9A 1F9KA 3GCWA 5G05L 4DUWA 5JAXA 1ENRA 1YXWA 3ZG6A 1O3RA 4B8CD 1OURA 2J9UB 4AGRA 4JAFA 2RDQA 1WCUA 4Q4Y1 1A8DA
chains in the Genus database with same CATH topology
4M00A 1YUDA 2ZGSA 3A44A 3MPBA 2WSUA 1DQ6A 1NA1A 2E53A 5DUUA 5BPXA 5LK7B 3PKIA 3RYRA 4W6YA 3NV4A 4X8PA 2BFUL 2RJKA 4AR5A 1ZRDA 4ME3A 1K5MA 5I0UA 3JD71 1FX5A 4FQ4A 2HR5A 3GZUC 1R091 1CAWA 4YVWA 4BIFA 3N7LA 5EIOC 2GDFA 3USUA 1R0GA 1F31A 3B5LB 3ILFA 4EWEA 1NOVA 3ZXEA 1VBA3 2DVFA 2WS91 1RMU3 1VBE3 1AF9A 3MPSA 4JVAA 3E97A 4XFCA 4COYA 2CKCA 2UU8A 5J48A 3AMMA 1QJU1 1NXEA 2WNVA 2D3SA 2ARBA 5GZFA 2JI1A 2YROA 4IV1C 1RIRA 4BMEA 3FFZA 1QXPA 5I93A 2GAUA 1SLAA 2D43A 2JKBA 2CAUA 1V6MA 2P17A 1NCQB 4OVEA 1ASJ1 3AXDA 1GNZA 4YYOA 2GNMA 2H6CA 2OW4A 1RUF2 4KBBA 1QH7A 1UPIA 5H1Sc 3HT2A 2EXKA 5CFDA 1MS9A 4LE3A 1MEC1 2FZ2A 3WR0A 3AMQA 3NKTA 2JE9A 1OLQA 3VZMA 1CAXA 2AYHA 2CTVA 1WLDA 2E51A 5ABJB 1CAAA 3VBRA 3UL2A 3MICA 1SDWA 3H7JA 1U5XA 4A7KA 2ATFA 1UX6A 3SHRA 2KN9A 2D5FA 2WFF2 3D6EA 1VB2A 3PVNA 4B7EA 1H8VA 2GSYA 4KU8A 2X29A 2Z42A 4LEJA 3WUDA 4F8AA 1Q8OA 4N90A 4TYSA 4JTNA 5T55A 1LENA 2A3YA 5BUVA 4TWTA 4XDQA 3B02A 1SCRA 3PJYA 4AI0A 5GAEc 5T3NA 2PHFA 5E8AA 4EV0A 3JQXA 2BWAA 2RM22 3ILNA 3V0BB 1S55A 2ZHLA 2ZX0A 4Q4V3 2NN8A 2PYAA 2KKDA 3KMHA 1N1VA 2E63A 1BEV3 2VW0A 4DFSA 2HKXA 1MZ6A 4RD7A 3U07A 2LCQA 4K9SA 3X29B 2WNUB 1VBB2 1U12A 1PVC3 5LRSA 2VUJA 1WA4A 4RFT0 4YGCA 4F83A 4FP3A 1VBD1 5GM0A 3S6PA 1S1AA 3I59A 3NL1A 4L9BA 4OHWA 1FV2A 3JBG2 4AEDA 1YUXA 1PMIA 1TME3 1L3JA 4QQLA 1BJQA 1YUZA 3B08B 1YV1A 5E88A 3QCWA 1LKMA 1AXZA 2DTYA 2QDRA 4GKYA 3M3CA 4YVSA 5KXCA 2UYBA 3GBFA 2EXHA 4N53B 5DUXA 2VOXA 2PHWA 3THTA 2FHRA 4O9EA 1DBNA 1QQP1 1JH5A 3GHNA 4G3YC 2NZ9A 1RUE1 1OA2A 4JDOA 4WVMB 4HKOA 1FPN1 3EHKA 4KH9A 2WT2A 1YRZA 3QD6A 1D4M2 3OYWB 4AFMA 5EWSA 2XKOA 5FTTC 4OHZA 1DDLA 2GNDA 5FLHA 2WA3A 1XYOA 4GH4C 3WHTA 2RHPA 3D5OA 4QM8A 3WDVA 1PVXA 2A6YA 1UAIA 1G9BA 1RUC2 2BW8A 5AI2A 2DCKA 4MUVA 4QGNA 5DZFA 1C09A 4YGDA 1LODA 1O91A 2C6AA 4PDWC 1CJPA 1DLLA 3S0MA 2XLFA 5KHHA 1V6LA 1N3PA 1SLLA 2QE3A 5BNPA 4OI4A 1XNCA 1ZA4A 5AFBA 4N7IA 1H30A 3AKTA 1DF0A 3M8LA 4KGQA 2ES3A 4IL7A 4J1WA 4X6QB 4E2GA 4Q29A 2VG9A 1COV1 4L99A 5J98B 3VBFA 3PTYA 1WLWA 4Q1RA 5EJ3A 4ORFA 3MFCA 4QPIB 1QJY1 4FOQA 1JTZX 5JIAA 1MQTB 4XJUA 2A6VA 4AGVA 1PIV1 4OI0A 4IEPA 1RGSA 1RWDA 1S24A 1YI7A 1W6QB 1LULA 3AP7A 3JD72 2OVUA 3TWIA 1RUJ1 2RS33 1PHMA 4LBLA 3ZFEA 1R092 4GWNA 2E7QA 3ZSJA 3QH7A 1IKPA 2ZAAA 4IESA 1ZZ7A 2R16A 4XFGA 4CDUC 1LGNA 1BXHA 2WS92 3RS6A 1W0OA 1OLRA 3VKOA 4MLOA 5A33A 3ZN6A 1KJRA 4OZXA 4QMAA 3W59A 1OOPB 1H2LA 1QJU2 1R1A1 1EYBA 4HK9A 1JUIA 1NA1B 1RB9A 1JW6A 2WC2A 3SNMA 5CFCB 1K5MB 1WCSA 2HJIA 1QJX3 2YXSA 1AYM1 2V09A 4N7UA 2D6LX 1WLCA 4YVWB 3WNXA 2MEV3 4ITCA 1AL23 4YFWA 1MEC2 1HXS3 4U671 2R041 1W6OB 4JGYC 4M3CB 2I07B 3ECQA 3ZMOA 4AVCA 1LKPA 3NW4A 4ATEA 1POV0 2XL7A 2VW2A 1AL0G 2A6WA 5C8CC 5J37A 3N7MA 2BVBA 4JGZB 1PM7A 4P14A 4W65A 3EBRA 3UKNA 1VZHA 1URXA 2VNOA 5FAXA 3WP3A 4XQWA 5KXBA 5FCCA 2K2DA 4NR1A 3TOJA 4B7KA 3IN9A 2GU9A 3TBDA 3BODA 4D7TA 4YG0A 4NWVA 2YPJA 3MIFA 3VZJA 1LKOA 1H2NA 1R0IA 2ZA9A 4FPHA 5JLVA 1X8EA 4R52A 5CFDB 4QHBA 1OQ1A 2XVKA 3VBSB 2AGSA 1SLBA 3VZNA 2WNEA 3HN1A 2JG8C 2NMNA 1KFXL 4XFBA 4Q4W1 1G9CA 5T5JA 3FLPA 4YGEA 4WZCA 2XG3A 2Q30A 2RMU1 1FXZA 1VBD2 3LZZA 4RA0A 2R6QA 3MIBA 4IV1A 3M3EA 4FPEA 1SMMA 4F7ZA 2UY9A 3MF6A 4HPKB 1GQHA 2PVXA 5FMOS 2Y0IA 1LGBA 3KYXA 2A5ZA 5GLTA 4MXWB 1BYHA 3IWZA 1QQP2 2BGCA 4R8HA 2TBVA 2FMYA 1RUE2 4KL1A 4I01A 1BCXA 5JPMB 2IFWA 1FPN2 1Q43A 5BNQA 1XU1A 5CVRA 3OCPA 1VBA1 2A7AA 1BBT3 1RMU1 1ZYBA 3OBRA 2D97A 1S0BA 2CGOA 1NLSA 2OA2A 3VBOC 5HXVA 3B69A 4CDXB 3LB9A 4H7MA 4JRAA 5H9PA 3CJXA 3PIP1 5H9SA 4DB5A 4CTEA 1DYKA 2AREA 4EN7B 2WLQA 4FTSA 3WDXA 2V0EA 1LGCA 1W6MA 1DHKB 1LR5A 1VLNA 4Z1VA 3O12A 1RITA 4Q0PA 2DCTA 3R0RA 4Y22A 3R6SA 5C9AA 1HLCA 2A6HD 1Q8VA 1BRFA 3AZWA 3EJKA 1SMVA 3N4MA 1DQ2A 1SLCA 2CNAA 3LGRA 1COV2 1FHMA 1ODHA 2B5ID 4Y1UA 1DGRN 5GAHc 2JD4A 5CBLA 1Y9QA 5EFUA 1QJY2 2EVXA 3GZAA 4RL7A 1GKBA 1QGLA 1PIV2 3DPRC 4HFSA 1RYQA 3USSA 1B13A 1RUJ2 1GYKA 4JCKA 2GC1A 2P37A 1B2JA 4FVVA 2C1FA 1O4TA 5GZDA 5SV8A 2QQPA 5BNPB 3OTFA 4MVTA 4POGA 1PK6B 1RUD3 4QGLA 4AI3A 1H8TC 2KXLA 4J1XA 4Q4V1 3ELNA 1AX0A 4XMAA 2XGXA 4TLFA 4AEJA 2M6PA 1G9FA 1BEV1 4GULA 1JUHA 4XHBA 5JVVA 2M4YA 1HIXA 2ZMKA 2R073 1PVC1 5C4WA 4GH4A 1E57A 3MLKA 4NN0A 4XFFA 5HI0A 5I0RA 4HLTA 3TNPB 3HBZA 4ZU5A 1C5IA 1R081 3KYWA 1W39A 2BFUS 1AYM2 3DF0A 4QM9A 5BNOB 5CAZA 2A6XA 3ZO0B 2Z3QB 2ERSA 4WM7C 7RXNA 3ZDSA 4CP1A 4PDWA 2R042 3KQRA 3SLIA 2O8QA 3WXPA 2PHTA 5IY0A 1UF2C 2QFEA 5BNNB 3EQEA 3LSDA 4LBOA 1C8NA 4K3UA 2GH8A 1B71A 5A33B 3ZN6B 4QQOA 4BM8A 4Q4X3 3OGGA 4PLNA 1FNZA 4I09A 2JENA 2HWF3 1BMV1 5A3MA 1WJVA 3OY8B 3AJZA 3VBRC 3POYA 2ZGUA 2AYJA 1QMJA 2JECA 5JOXA 1MS8A 4WM8B 3RYKA 2CKAA 3QLQA 4UW6A 4P9YA 2X5IB 1DZRA 3VBUB 4URTA 4LUMA 1CR7A 2DFCA 3KYUA 2VNGA 5L7OC 3FBMA 3WDTA 4OHVA 2D5HA 3AJYA 2PAEA 3BPZA 3K35A 1W0PA 2ET1A 4QPGC 4CDUA 4Q4W2 5IK8A 3AKRA 2XJSA 2A68D 2RR13 2P3IA 3H1MA 4RS5C 1YYNA 5JIUA 4RGAA 3LAGA 2RMU2 1JHNA 1DG6A 4JDNA 3VV1A 1ZZBA 1OPOA 1REDA 3URFA 5JDBA 1VALA 1NYWA 2R0FA 3N36A 2HWC3 3WW4A 3QACA 1I5ZA 1WW7A 1R0FA 2VVFA 4JRLA 5FO8B 3H50A 2XJUA 1AX1A 1XYPA 4IEXA 4JGYA 2Q5TA 2JDZA 1Q8QA 4FQZA 1X33A 4LBKA 1PZ8A 4FTEA 3UJOA 4JQRA 3C2UA 5C8CA 2RS31 2D6OX 4DRRA 4I0AA 4DXZA 2Q1ZB 5F5QA 1RB8G 1RTVA 1NZCA 2A69D 1VBA2 2UWBA 3D8CA 2ZCWA 1RMU2 2VOKA 1AXYA 3MI8A 1SMWA 4C1XA 3LA7A 1AR93 3U4XA 4CDQB 5AFEA 4K9FA 2YMZA 1Z0HA 3S7IA 1B35B 2Q4SA 3AKPA 2RE9A 3J9SA 2WZR1 2JI2A 2VH9A 2JEMA 4S2GA 1V9U3 3SCFA 3WW2A 4IETA 1QJX1 2VPVA 4I2OA 3VL8A 5FMOL 5JMCA 4AHWA 5ACA3 2BVVA 4M3CE 3ZFFC 5L19A 2NP0A 2MEV1 1AL21 5JWPA 2RM21 1HXS1 1DGWA 2GNTA 1O4ZA 4Y1ZA 3AZZA 1XNKA 4RR3C 5CIRA 4E4DX 1NQJA 2I2SA 3AYAA 5BY5A 4KGGA 2WJSA 3PWFA 1UMZA 2IC1A 2VMIA 3VBHB 2OYZA 3VLBB 5JPNB 3JB8A 3RZTA 1AZDA 1ZZ8A 2TUNA 4DMIA 5BV6A 1LEMA 1G9DA 2D6PA 2QZ3A 1LTEA 3NJZA 1BVVA 2ILMA 1LEDA 5DXDA 3VKFC 2RS53 4XYXA 1EAH3 3MIHA 4Y22B 3NVCA 2PQQA 3LA3A 4BLIA 5FDBA 4LTAA 3JU9A 4AVBA 4Q4V2 3SMHA 1IU5A 5EYXA 4AHYA 1TEIA 1BEV2 2W68A 4BZ4A 4H7LA 4M3CF 1ND3C 3LKJA 1PVC2 1OA3A 2DUPA 2PTMA 5FPZA 3VBOA 4Q27A 2Z69A 1IPJA 5T5LA 3NKGA 4DS0A 5EZWA 2D40A 3J7Z1 5DUVA 1QY4A 2VXRA 3N7JA 4COZA 3AYDA 1POV3 4XBNA 5T5OA 4P9IA 1J3PA 5K2ME 1OQDA 3LOIA 4Q8LA 4FPCA 4BE3A 3V65A 4LNVA 2YZ4A 3ZXJA 4AI2A 2ZABA 1X7NA 2B46X 4AVVA 3J8F3 4BHPA 3ZXKA 1GSLA 1S0DA 2WL1A 3RYGA 1FOD3 4IEUA 4DINB 2CR8A 3QQCE 2QJVA 4OI2A 4XF1A 1EPZA 1OQEA 1I6XA 1QDCA 1SACA 3V64A 3ZIXA 4XEZA 1VR3A 1XE7A 4PQ9A 5T5PA 5K7PA 1BMV2 3VUOA 3O5SA 2PLV1 3UKVA 2LALA 3NV2A 3U11A 1BBT1 4W6XA 1S2KA 3DPRA 2A3XA 3I8TA 4YZ4A 1MS1A 3H3UA 2VY0A 1NCRB 1RDGA 4K1YA 2VOWA 2CAVA 1KJLA 1OD5A 1AHSA 1NXMA 4Q0QA 1M4WA 5AC93 3AP6A 1H8TA 1VRH3 3P3NA 4H3WA 2JJ6A 4YM0A 2JI3A 1AYN1 3MW3A 1ULGA 1R0JA 2RDVA 1H1IA 2AUYA 2VQ0A 1YJLA 4CEYC 1EV13 3DN7A 1DGWX 1KXGA 3IDEA 2PSMC 4HKLA 5H9QA 1H2KA 4IQPA 4E4SA 3ZFGC 4XIKA 3VDDB 3I4IA 2WQ4A 4WM7A 4ES9A 3IU3I 4LBMA 4AW7A 2QZ2A 5JZGB 2E7AA 2DU1A 3ZSMA 4K40A 2I74A 2CL2A 4P9WA 1HQLA 5FRAA 2DTWA 2D6KA 2W0XA 2BNNA 2RS32 2XPJA 1VZIA 4XTPA 1JYBA 1V6OA 3BOWA 1RUD1 4XFHA 5KHGA 4C91A 3FUQA 1UZZA 5D8AB 4YW4A 2V3BB 1H4GA 1CESA 5K0UB 3IKWA 1OI6A 1SFYA 5DM61 4RXNA 1RUG3 3WW1A 2R071 3HAGA 2WZR2 3FJSA 5GLUA 1SQ4A 5L7OA 1AXKA 3SH4A 2CY6A 3WV6A 1VJ2A 4CEWC 1JN2P 5BYNA 5CG8A 1BE7A 4AXOA 1QJX2 3KB5A 4BQ1A 4QPGA 4QPYA 4D7SA 1DVBA 2CYFA 2P34A 2MEV2 1AL22 4ISRA 3RNSA 1HXS2 4ZN3B 4RS5A 1VAMA 1GZWB 1VP6A 1H7VA 1CAVA 4ASMB 2XHKA 5MFZA 2BWCA 1M06G 5C9AC 4Q4X1 4Q0VA 4E4ZA 3AP9A 2BNMA 4LR4A 2HWF1 1H1MA 4PLMA 1ND2C 1KITA 4YRDA 2CGNA 4E9KA 2B7YA 2JG9B 2P3KA 2JG8B 1WCDJ 4AQSA 3CJIC 1KFUL 3VZLA 4X8NA 3UJQA 1JYCA 2AR6A 1TQ5A 4GXLA 1HRV3 4P9LA 3MDPA 4PBPA 1NLRA 1TNRA 1YFYA 5IK4A 2WZPP 3E6BA 4LT5A 3MIGA 4WVWA 1MVEA 5I91A 2R063 1T9OA 3VL9A 3A0KA 1VIWB 1Y7BA 1ZREA 8RXNA 5T52A 4B4PA 1C28A 4AVSA 2W52A 2ZGLA 4LO4B 3VHNA 5C4WC 1PNGA 2KM2A 1CIWA 2HWC1 3V0AA 2DYCA 1IQAA 5FLJA 2IXHA 2YY1A 2VOVA 1RVF3 3ZFFA 3NWKA 1CQ9A 4AR4A 2PHLA 1ULFA 3KSCA 2CGPA 4QXKA 1X82A 4RR3A 1IS6A 1O4YA 1S0FA 4L92A 4KWLA 3ZN4A 1UD1A 5GZEA 2BPA2 3WT3A 4WVZA 3WDUA 2L0ZA 2PLV2 1S0GA 3BOPA 1ZZ9A 2ZGNA 3BALA 4JAAA 4XQ4A 2XJRA 3VPBE 1VAKA 4TPUA 1BBT2 4AI1A 1BK1A 3TN91 3O0WA 4AQ6A 5IK5A 5DG1A 1AR91 3DUIA 2ZBJA 5K8SA 4COWA 4PIXA 1U5ZA 4C0BA 2R1DA 3UV9A 2BQPA 4I0BA 4AVTA 2RS11 1DQ5A 1V9U1 4Q2FA 4P9GA 1O3SA 2AZ5A 2PYTA 3H1WA 3KYYA 1AYN2 1S0EA 4NOTA 2BEOA 3PNAA 1TNFA 4Q0UA 1ND3A 2PVEA 4LO5B 4M0NA 1KD7A 3D4KA 1CPNA 1CPMA 1G8WA 3QVDA 5LEKA 2DCJA 4YSFA 1RUI3 1H1AA 1RUF3 1H2MA 3EO6A 3R4SA 4MGIE 2O8OA 1QNYA 4B4QA 4D3WA 4EN8B 3ILRA 3N3HA 3T1LA 2Z79A 2DUOA 3GHMA 4Y26A 5C33A 3V56A 2OIIA 4ZN1B 1NCQC 4Z2WA 1CAWB 1LHUA 2NYYA 3USUB 2RS51 4YG6A 2ZZQA 1CAUA 4D7YA 1EAH1 5HCAA 1RUD2 2WT1A 4F3JA 5I0SA 3ST7A 5DDJ1 3ZSEA 1HDKA 2Z3RB 4K20A 1DYPA 2GC0A 3APBA 2WNVB 2PHDA 3GF6A 1X36A 5KHKA 2R072 5DM71 4LHKA 4S2HA 3B01A 3KCXA 3O14A 1AR73 1S0JA 2VUAA 3KGZA 4R4XA 1N1SA 2OZJA 1POV1 4INDA 3O0XA 3WX5A 5DUWA 4FPGA 1ZBA3 4HZFA 1HV0A 4XJ9A 5JCTA 4FO9A 4ONUA 2YDEA 3IM0A 1UN1A 3AMPA 4ZU4A 1VBB3 3AZXA 3E5QA 3PIO1 4LBJA 1CD3G 1CAXB 3VKMA 2PELA 3G7DA 1SLIA 3WG3A 4AFBA 4GS7D 5DG2A 2VVEA 4FOVA 3J8F1 3VBRB 1BFYA 1MACA 3KM5A 1FOD1 4CEYA 4FP2A 1YNAA 1AJOA 1G6NA 4OUSA 4Q4X2 3TYJA 2WNUC 4GQ7A 5JSPA 3JB4C 1D0HA 4AYUA 4XMIA 2HWF2 1AR63 4OI1A 2X53S 4XF4A 3ZFGA 5L7OB 3E6DA 1YHFA 2IWGB 2BBVA 3WG2A 4I0WB 3WDYA 1R0HA 1UU5A 4QPGB 2B8MA 3D0SA 1C5HA 1YIPA 1O7FA 1ZM1A 2ZJCA 1BVP1 1OSGA 4Y1VA 1Z7S3 4XGHA 5GALA 4CDWC 2F6BA 3VKNA 2ZGOA 1CAVB 2FMDA 1C4RA 1QKQA 4N53C 4YW2A 1REEA 4WV8A 5AC91 4FPKA 3LPEB 1LB2A 5MGNA 1VRH1 2ZZJA 3UKTA 2VGDA 1DGLA 3I59B 1QOTA 4JAEA 4LA2A 3KZ4C 4JTOA 1VBE1 4GWMA 4AEDB 2DURA 2EA7A 3GNEA 2D7FA 4LULA 5H9RA 3P8BA 4CEWA 3VZOA 2ZX3A 2HWC2 2PAMA 5K9YA 2H6BA 3MGUA 1W6NA 4XFIA 1S2BA 4COUA 1KQRA 4YVSB 4IEQA 4AQ2A 2EF6A 3FMGA 1H9PA 3G6JB 4XZPA 4CP0A 3NFPI 1LOFC 4XJAA 5CA6A 2NQYA 4HVOA 3T1MA 4K7JA 1MS3A 4DZGA 1QH6A 2DWRA 2HWD3 4Q4Y3 2C0ZA 5GADc 1IS4A 1UZYA 4U36A 2VMGA 1J1LA 5MFPA 3TN92 2WLPA 4CRQA 1ND2A 1XU2A 4PBOA 4Y20A 1LOAA 1H9WA 1AR92 3B3QE 4QQPA 2XJTA 1RUG1 1V6NA 3CJIA 2ZHNA 1MS5A 4QPIC 1TMF3 4RHV3 5JI7A 4UY81 1MQTC 1ZZCA 3M3OA 1RHI3 1JXNA 2RS12 5AVPA 1B2OA 1V9U2 1HW5A 4UXAA 2DSXA 3NSTA 3POWA 4RSUA 2A71A 2R0HA 2MHFA 3B94A 3WZ1A 4N43A 4COVA 3KD4A 1IPKA 2EIGA 1IS3A 2QNKA 1OWBA 3PMSA 4NVPA 3HT1A 1BQ9A 1WD3A 3ES4A 4EN6B 3MYXA 4KG8A 3GALA 1MS0A 3SH5A 1I1EA 2B39A 3VBFB 3WW3A 2QKDA 3WP6A 3J26N 1ASJ3 3BB6A 3VGIA 2XLGA 4HK8A 5JOYA 1OOPC 2W39A 4AF9A 4A7ZA 2Q8OA 1DQ4A 3KCYA 1W2UA 4J6GA 1ZNPA 3KLSA 3DL3A 4AK3A 2DCZA 3HMYA 4UW4A 4MYEA 1YK5A 5RXNA 1I9RA 3CNAA 1PO13 5F9TA 1VZGA 3ZFEB 1TME1 2SBAA 4GMP0 2RS52 1OPMA 3VHOA 1EAH2 2IFRA 3RPQA 3AP4A 1HRV1 3KT7A 5GLWA 1N1TA 1GZ9A 5DDJ2 4YW5A 3PJQA 2K0GA 4JGZC 1WBFA 3ZN5A 1A8MA 1WW4A 2EALA 2ETEA 3H3ZA 1Q56A 1YFUA 2XJVA 2G9GA 4LA3A 4NHMA 4QQHA 2R061 3WOGA 4XF3A 4YM1A 4QU2A 5CADA 1WBLA 1HV1A 2QVSB 4MV2A 3ZXFA 1YJKA 3A4UA 1LECA 4D94A 1CGPA 3D0JA 2OZ6A 3RRDA 1PO23 2XWJB 2D6NA 2EXIA 1CAUB 1FNYA 2V0FA 1WMFA 2XL9A 4AG4A 1RVF1 3VBSC 2GNBA 3VKLA 2C5DA 1C8M3 1YLLA 2CWSA 2VVDA 3M1HA 3QH6A 4EN9B 5EV7A 3J8F2 1XYNA 2W08A 1LOCA 1PZ7A 1FOD2 2F4PA 4IEVA 3VHPA 4OULA 2ET7A 4FOYA 4XTMA 3O7OA 2GMGA 1YFWA 3M70A 1VB4A 2D93A 3GYDA 3H1YA 4PF5A 3AX4A 5KHIA 3H0OA 3IT8A 1UIKA 4XJZA 4BPZA 5IUQA 2IXCA 4OHYA 1DQ1A 5FPXA 1MZFA 4EROA 4KWKA 1U5YA 2VQAA 4NO4A 1NCQA 1UW8A 1D2SA 1SMUA 4RQPC 2DF7A 4AWDA 1UU4A 2ZGPA 1N1YA 1V00A 5KC5A 5KC6A 3HWJA 5I8TA 2X8KA 4YARA 1FI2A 3W9AA 1VBC3 5AC92 2XVLA 1VRH2 3RG0A 5JOWA 4Y4YA 4OHXA 2ZAHA 1FAYA 2K9ZA