4AHWA

Flo5a showing a heptanuclear gadolinium cluster on its surface
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Sugar binding protein
total genus 59
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ahwA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ahwA01
4CP1A 4AFAA 2XJVA 4ASLA 5A3MA 4COWA 4AI2A 4COVA 4AHWA 4AF9A 4LHKA 4CP2A 4AHXA 4AI3A 4LHNA 4D3WA 4AI1A 2XJUA 2XJSA 4AI0A 2XJRA 4COZA 4AFCA 2XJPA 4A3XA 4COUA 4AFBA 4AHZA 2XJQA 4AHYA 4COYA 4GQ7A 4LHLA 5A3LA 2XJTA 4CP0A
chains in the Genus database with same CATH superfamily
2Y26A 4DMIA 2X09A 4GMP0 1V6IA 2YPDA 2LRPA 1D4M2 3H1YA 4MVTA 3V64A 4CDXB 2PTMA 3RJ2X 3GM8A 3FMGA 4LJHA 4P9XA 1Q8VA 1BHGA 5BNNC 3CJIC 3NAPA 1X50A 2R30A 2E7TA 4RHV2 1GNZA 3K51A 5LWBA 2WA4A 2ILMA 3PVBB 3GTQL 4N7IA 3RVHA 1LOCA 3MI8A 1Q56A 3WG4A 4CE8A 5C8CA 2YPJA 5EINC 2W92A 2VZSA 3LKJA 3FE5A 4V196 1XNCA 3PTYA 1NZCA 3VBOB 4FVVA 1TWGL 5CIRA 1RVF2 3HBKA 4QMAA 3WP6A 1F8VA 1X33A 3DPRA 1OHFA 2VNVA 4JTOA 2C26A 2ERFA 2W68A 3GZAA 4HVRA 4JKLA 4YW3A 3U75A 3V56A 1UCXA 1AF9A 1UL9A 2IWGB 4EZ4A 3MLLA 1R1A3 2IVJA 3IBMA 4Q4V2 4Y26A 4Y5SA 3RJRA 1FV2A 3ZSLA 1B35B 5F6KA 2GNDA 4TSVA 2IUWA 2GMEA 2WLQA 4I0AA 3ZVXA 2WAQP 1LKNA 4BA6A 5ABJB 1RITA 1FOD2 5FZ4A 3OUJA 1HRV2 2Y6LA 4ZU7A 4NO4A 3TNQA 1VBA2 2RV9A 4QX2A 1D4M3 4AOCA 1A34A 4DXTA 1Q8OA 1LKMA 3SH3A 5T5LA 2ZGSA 3ST7A 3S17L 3HJYB 2HH9A 4XBNA 3U07A 2FMDA 3GHNA 5IUQA 5IP7L 3L9JT 4C2M1 2W47A 3AKRA 4LUKA 2WZ8A 1J1LA 1H9WA 1OFSA 4C1XA 2NLRA 5H9QA 2R062 4RL7A 1SZBA 4CU8A 2OX0A 2VOXA 2F4PA 4TPUA 3NL1A 1VCXA 4PJYA 3DYPA 5I8SA 4H55A 3LFMA 5DAQA 1QY4A 3RGBA 5FPUA 4FOQA 1NA1A 4QX5A 4CEYB 1NNQA 5FP7A 4LTAA 4XETA 1QMJA 2K9ZA 5DAXA 3WQ7A 4KG8A 1EV13 2YUEA 4U36A 3DYOA 1ZVFA 5EJZB 3R4SA 4CA9A 3WHUA 4B8EA 4CUBA 3ES1A 1RL3A 1GP5A 1H7VA 4Q4V3 4V2WA 3FHQA 1JHJA 2CKCA 1DFQA 1YNAA 2QQKA 3ENRA 2DBIA 3H1WA 4LK6A 4EJRA 5KC5A 1SLBA 3ZXFA 3ZG6A 4XPVA 4J6GA 1MEC1 1WMDA 1PGL1 3HNYM 3DXTA 1FOD3 4UF0B 2R32A 1HRV3 2RR12 1GNHA 2H12A 1SLLA 4LHNA 2ZHLA 5ERLA 4OFGA 3SLIA 1EYBA 3WF1A 4OYUA 2HKXA 2UY8A 3JB8A 3H3LA 2MEV2 5AVPA 3WP4A 5LW9A 4NIDA 1BJQA 2VW1A 2BW8A 3KV4A 4W6XA 1PFVA 5C3RA 2P6CA 2XBO3 3Q8AA 2PHDA 2GDFA 4TWTA 5JZGC 2VMIA 5DAPA 1N3QA 1DLCA 5F37A 4OHZA 2HWD2 1LESA 1BZWA 4OMCA 2X8KA 2Y34A 3GTLL 4OHYA 3J8F3 4XFFA 5FYBA 1TE1B 3KYUA 1K83L 2W1UA 3LZZA 4UY81 4JTNA 4UI9L 3AZYA 4DNYA 5FDBA 1E8JA 3KGZA 3F2ZA 3GJBA 4ZU5A 1JZ5A 2RMU1 2VZTA 4YZ3A 5A33A 1W04A 1LULA 1RJ7A 2VW2A 1QH6A 3PZAA 1BQ9A 3NNGA 4XJZA 2R7EB 1LEMA 4IESA 2VW0A 5FAXA 4AR2A 4XILA 4IV3A 5F6LB 4KNCA 2KR2A 1TWFL 1C1FA 3WQBA 2FZ1A 1G9DA 1GFF2 1AYM3 2P34A 4YW1A 1CVNA 2YZ4A 3ZN6A 2A1XA 3RZHA 2P3YA 4J1XA 1VIWB 1QJFA 2BNOA 4FCAA 2RR13 4IETA 2TNFA 4XF0A 1PHMA 3H3ZA 4AR6A 1GLHA 2J7MA 4RSUA 2A6WA 5I0TA 1OOPC 4EROA 2Z4FA 4GD4A 4OZOA 1IZ3A 2VL6A 4E2GA 5IVVA 1N1SA 1P7PA 4SBVA 2KD7A 4NMIA 1W0PA 4HT1T 4Q2FA 3TAYA 3TEZA 1ASJ1 3HQXA 3ALQA 3VN4A 1N3OA 4BY7L 2YBPA 4PI0A 4QU1A 1V70A 4XACA 2CR8A 2CTVA 3M8LA 5FY0A 3FKIL 2E63A 5I0SA 1W9FA 4D0QA 4YG3A 4QPIC 1IS4A 5I0DA 1ZM1A 1KITA 4AG4A 4GWNA 1QQTA 3KV9A 5IVFA 2VO5A 3PKIA 1FNYA 1UX6A 1C1LA 3AM2A 3HT2A 3ACGA 2KXLA 1RDGA 3N7MA 3O1VA 1H1IA 2VZRA 4FI9A 3RZOL 3AZVA 3NAPB 1XNDA 2YXSA 5FYCA 4K1YA 3VHOA 3FN9A 4E2QA 4AHWA 3P8BA 1LODA 4EN6B 5A7OA 2VMFA 1CPMA 4NUBA 4BISA 3WCRA 5JSOA 3O5SA 3VDBA 2WQ4A 4YWLA 4OULA 4ATEA 4XF3A 3SMHA 5BNOC 2Y60A 1OPMA 2W1SA 1CIWA 1XYNA 3GXUA 3I3EA 4K8FA 4PBOA 2VAUA 3PO3L 2PVEA 3FUQA 5BUVA 3ZFGB 1B13A 5IYCL 5DZFA 4AVTA 2VCAA 1ULGA 3OD0A 4LT5A 2G9GA 1AXYA 1W3VA 5KHJA 2KN9A 2PHTA 1NXEA 3B5LB 1QJEA 3JQWA 2YC4A 2LS6A 3RDIA 4LO8A 2KM2A 3MLKA 2WSVA 5CAZA 1I6HL 1RUD1 1YFUA 2WUHA 2WLPA 5A3LA 1APNA 2XL9A 1EUUA 1F31A 3U4XA 1F2NA 3D0JA 4NIGA 2DU1A 2B5HA 2ZMLA 1VAKA 2CV6A 2Z79A 3NQHA 3ZR6A 2G19A 3W5MA 3C2UA 5FZAA 1WA6X 2OVUA 4WM7C 1G9AA 3M7AA 3AKPA 3AK0A 1R64A 1MEC2 1PGL2 3LFIA 1RUI3 3WW4A 4AAPA 3O0WA 2JICA 1AZDA 4AFMA 4AVBA 3O1TA 4GKYA 2A6HD 2D7FA 2J1VA 1NE4A 2HWE2 4ES8A 3PDQA 3CBNA 4GWMA 1W2UA 4BJ0A 3IM0A 4BK5A 1XU1A 5EQUA 1QF3A 4AHYA 3LA2A 5K4LA 2R49A 4NR1A 3PKJA 1REFA 1IOAA 3GZTB 4O61A 2BRTA 1LHWA 1NQDA 2JA6L 2JE7A 1V6LA 3BODA 2ZHNA 4HK9A 2A5ZA 3NMBA 2NZ9A 2DVGA 5F8PA 4CXYA 4XOGA 2Y6KA 4MH0E 3MPSA 1W2AX 1JXNA 4G3YC 1OVSA 2JG9C 2OQ6A 4A3EL 5HCHA 1R0HA 3WG3A 4TLGA 1VB2A 4XJUA 2RMU2 4QX7A 3T4HB 5LA0A 3S5AA 3CMGA 2TBVA 2FCVA 5FYMA 3HAXC 1CQ9A 1PMJX 2AH2A 3EBRA 2G9ZA 2JDKA 5A3WA 1HB1A 5A1FA 5JI9A 1ZX5A 1N1YA 5F32A 4O7XA 5FXVA 2QVSB 4BQ3A 2MNGA 3T30A 4GB33 5L36A 3JD71 3CJIA 4UAPA 4NAMA 3WF0A 1C8M1 1GQPA 2VNRA 5MFPA 1ALYA 1OUXA 3FBMA 3OF1A 4OI2A 4LR4A 4A44A 4ZHNA 1V0AA 1YEWA 4I02A 4BHPA 3E5QA 4ITCA 3CQZL 1O4YA 1U5ZA 1CX4A 1CAVA 3QACA 3SNMA 2WABA 1AXKA 3IAPA 1UZZA 5JVG1 2ZOEB 4RXNA 3NV4A 1I3HA 3NSTA 3HN1A 3UL2A 4GULA 2QQIA 4O9EA 2HWC3 2VPVA 1FMD3 1ASJ2 1V6OA 1KQRA 3ILFA 2XWBB 4YM0A 2WB1P 2JENA 5J3UA 2VCMA 3MO4A 4AQSA 5JXIA 1QOOA 3MW2A 2YU9L 2B39A 4YW6A 1QXJA 5FUNA 4A3IL 1H0BA 2JB8A 2ZMNA 3G7DA 5IY0A 2X5IB 5JMOA 3NNFA 1W2OA 1GOGA 2JWPA 3E5UA 4IV3B 1UMIA 4MGZE 3VBUC 3ZKYA 4Z2WA 3IB3A 4B7EA 4QXKA 4L8QA 5JXJA 5CA6A 1IRNA 2CDPA 2O1QA 2BGOA 4R4ZA 3K7AL 4A45A 4N8MA 4NHLA 4D6RA 1G86A 1T9QA 3AP6A 3QCWA 3ROUA 1XB9A 2XJUA 1PX4A 3IU3I 3OBRA 5M3FL 1ZZ6A 1OBNA 2C9KA 5JR2A 1VAVA 4XGHA 1XSQA 1RUF3 4HSJA 4D7YA 4IEZA 4Y5TA 3OPWA 1VMFA 5MGNA 3B94A 3IIAA 3PJQA 2HYXA 4AHZA 4GWIA 4QHBA 2VUAA 3WLUA 4C3IL 1RUH1 2XHKA 4XTPA 3WZ1A 2W1QA 4KWJA 3D3AA 2PHFA 3AMNA 2Q30A 3NVCA 2VOKA 4XUNA 2IFWA 2WNVC 3S14L 4OHWA 4Y4YA 1PIV3 2H6CA 4D8MA 2JD9A 3CL1A 3DN7A 2M4YA 3EQEA 4L99A 4BLJA 4YARA 5C3QA 1WLDA 1PZXA 3PURA 4INDA 3VLBB 4A3ML 4BOWA 4CU7A 1RUD2 1QDCA 2QZ3A 3GJAA 4J25A 1OI6A 3CDZB 5JPNB 1LCLA 3EXUA 4FFFA 4PF1A 3QH7A 3T2QA 4MGYE 4JGZA 1BK1A 3QOPA 4O65A 4M0NA 4OVEA 5FMCA 1LAJA 4FXGB 1ZRRA 2B9UA 2K2DA 4AR5A 5EP9A 2JDYA 2HWB1 4HOOA 5LA9A 3VBHC 2SLIA 3J26N 2JX9A 5EV7A 3POWA 2B7YA 3DV8A 1FI2A 5GM0A 5F3GA 4GQ7A 3J4UH 4Q4W1 1V9U1 3RZKA 1OQEA 1SG3A 4F7ZA 1H2MA 3B01A 3POIA 4I01A 3WNNA 2APOB 1XNKA 4BWOA 5I93A 5JZGA 1WD3A 1OD3A 1QKQA 3H99A 5F2WA 4ORFA 5FTTC 1DHKB 1OQDA 2V5DA 3PVOA 2O5JD 4NVPA 1XXNA 5FZIA 5JLVA 1W9WA 2P6HA 4LBKA 5APAA 4RS5C 2E7AA 3POGA 2FDJA 3MV11 3WD5A 2WNOA 4ZU4A 4Z92B 2BE5D 1GICA 2EIBA 2B9VA 4I3PA 2EAAA 3ZR5A 2XJQA 1BCXA 4Y4RA 1IQDC 1RUD3 3AKSA 5F5CA 1XQNA 3WCSA 1UQXA 5IYYA 2QCSB 3IWZA 3CIHA 3SH5A 2ZKLA 3AC0A 1JYCA 3FLTA 2Z3RB 5J7MA 3AMMA 2V0FA 3POBA 2EXHA 3HBZA 3JD72 3KV5A 5C8CC 1LB2A 2Y6FA 2WO1A 1C8M2 1D2SA 3HD8B 4H3WA 4XJ9A 4CUCA 1XE0A 4XDOA 1OOPA 5K0UB 1OSGA 5GLWA 1N1TA 2G4IA 3DPRC 2XJRA 1YHFA 3CZUA 4GA9A 1QJY1 3M3EA 1M4WA 3OYWA 3UGFA 2WZR3 2I74A 2CGNA 1XJAA 5MF6A 5BYNA 4W6YA 2Q1FA 4QB6A 3ZYBA 5A3NA 2WRAA 3MHZA 4A93L 2A75A 1H6YA 4Z2AA 3VBFC 1JTZX 1S24A 3BTZA 4IV1C 2Q8EA 4QQHA 1JYWA 4HG6B 1KS5A 4QPIA 4H7LA 3P6BA 1GSLA 4NWVA 5FOBB 2AR6A 4IGPA 4JDNA 3EB7A 4LBQD 3VD9A 2VZ1A 4QQLA 4C0HA 3I8TA 3V0AA 1OWCA 3BU0A 4MUVA 1LGBA 2W87A 1MACA 3IAQA 4JV4A 4K7JA 4XJ8A 2EXKA 3CJIB 5BNNB 4OI1A 1W3XA 2EIGA 3A4UA 1US2A 3AYEA 4UW4A 3TB0A 2R0HA 4COZA 5JCTA 2CGPA 5IVEA 1YI7A 3ZSMA 2GC3A 1ZA7A 5JMCA 1FAYA 4Q4Y1 4AEJA 4GJYA 4LBJA 5BNOA 4KL1A 3RPQA 5KXCA 2FDKA 1NE6A 4JGYB 1NA1C 4BXSV 2VUJA 1OF3A 3LSDA 5FZ9A 3U78A 4F3JA 3LIGA 5JAXA 2QKDA 4COVA 1XOYA 4YW7A 4ZY9A 5HV0A 4M01A 4IEXA 5DMYA 3QQCE 3AYDA 2HLEA 1RUH2 3FBYA 1AYN1 3A0KA 1W6PA 1YK4A 1OA2A 2CYFA 2RS51 4QPGC 5C4WB 1RWDA 1PNGA 1ULPA 1UKGA 2D97A 2DVBA 2JDHA 4XXBB 1OQ1A 4WVWA 4XDPA 5FZOA 4MGKE 1I5PA 4KQ7A 4NPRA 1HB3A 4MV2A 5TSWA 3I3MA 1S0FA 1QJU1 3AX4A 5DUUA 5FZEA 2DCYA 5C4XL 1RUC3 2HYKA 1QXPA 2OUJA 3IN9A 1WCSA 2R1BA 1DIWA 3SKVA 3BTYA 2HWB2 4HN1A 4DRVA 5DM61 4PBPA 5M0TA 1UX7A 1X8EA 5JSRA 1UY1A 2VMDA 2F17A 4AYBP 1MS9A 5IFTA 1A8MA 5JOXA 3NV3A 2CGOA 4S2HA 4DINB 2YU2A 2GC0A 5FLML 1V9U2 1YI9A 1LJ7A 4Q4W2 4LKDA 4Q26A 4QPYA 3MZHA 2BBVA 2RS33 3AZXA 1ZRCA 3D8CA 4OUMA 1T6BX 2E51A 3M2MA 4BU2A 3POYA 2UY9A 3ILRA 4XURA 5FO7B 1VBC3 3ME2A 4EWEA 3O1MA 1CWPA 4QIWP 3WWNB 1R083 1UAIA 2ID4A 1Y9GA 4FPEA 2XG3A 1H1MA 3JCIA 3K3NA 4JZRA 3WW2A 4B4QA 4CDQC 1FT9A 1RUH3 5FUIA 4A4AA 5F7UA 2FQPA 2PHLA 3WNXA 2X29A 5JWPA 2BBAA 2OPWA 2JG9A 3WWLA 1LEDA 1NXGA 1PGSA 1NQJA 1QOTA 3OBAA 4XHBA 5IK7A 1JN2P 4LBOA 3PL0A 2Y33A 5FZMA 4QKDA 3TN91 3FFQA 3JBG3 4LBLA 2WAOA 1IGOA 4EN0A 1JU3A 1VZGA 1Q43A 2E32A 1QHDA 2YHJA 3BVCA 4A7YA 2VJXA 2Z42A 3IIIA 3KSCA 3N9LA 4GXLA 5GLUA 4XW3A 3MLJA 1AJOA 1W9SA 2HWB3 2JB4A 4AFDA 2ZACA 5FZHA 3W9AA 1A78A 1AHSA 1EPZA 1GWKA 3N9QA 5FYIA 1H2KA 1DVBA 3SH4A 3NO8A 1KFXL 4AVSA 2D6MA 2AYHA 1B2JA 3MICA 5JZGB 2WWSA 1M06G 5F1RA 2V3BB 1QJY2 4BLIA 2N7GA 4P9WA 4Y22A 4CCCA 2W95A 1MS3A 3B69A 2D6PA 3KYVA 4QX0A 2ORXA 5M5YL 2WN3A 4LHKA 4YNIA 3GTPL 2VOWA 4AQ2A 4XF9A 1S30A 2W46A 1JZ7A 3E6CC 2RM21 1YWKA 5KR7A 5LY1A 1CN1A 2GP3A 4A2UA 1E5IA 3RWKX 3VV1A 3JR7A 2QQLA 5FY7A 3R4DB 3OD4A 2W91A 3FLRA 5FOJB 1ULOA 3VBUA 4BQXA 4A3XA 4COUA 3QBQA 2FDFA 2EA7A 4MOAA 1ULCA 1UXXX 4DXRA 1RC6A 5C71A 1G9CA 5G05L 1REEA 3E1F1 4FTSA 1XU2A 2CAUA 4IEUA 2B45X 1DQ0A 1HRI3 1HXS3 1YQ6A 2A6ZA 2BQPA 5L7OC 2E53A 1UZWA 5LBFA 2AQCA 2XR4A 3LEMA 3N7LA 1OOPB 2A6YA 3LA3A 1SFYA 4DXZA 5K9YA 3QD6A 5LRSA 2RHPA 4Q4Y2 4L97A 3HOWL 3M70A 3MPBA 4FQZA 5F3IA 1O3TA 3OBZA 5FYZA 2WWUA 4FOYA 1NLSA 1F5FA 3OUHA 2OYZA 2EALA 2VCBA 2D5HA 5FY4A 2VZPA 4UT5A 4IW3A 4AR3A 5JR7B 3S1NL 4YLZA 2DF7A 3HKZP 4NAOA 1POV1 5EPAA 2WNVA 1AYN2 5CG9A 2CDOA 2RS52 1UZ0A 3POEA 3KCCA 5EJ3A 1SLTA 2DCJA 2FMYA 3ZYGA 5I91A 4AGRA 1XRUA 4YWMA 4YW4A 2ZGNA 3TOJA 1RINA 2PHXA 3ZXDA 5A1LA 1CAUA 1RXFA 4HPKB 3V0AB 3E97A 1I5ZA 4B7KA 1F5JA 1DF0A 5AFBA 4ME3A 2FHRA 4CRQA 2PHWA 1QJU2 2P17A 5LEJA 4FOWA 4OZXA 1SBEA 4XF1A 5MLC3 1KGYA 3VBHA 3U10A 2JI3A 3JXSA 4AVAA 3OGVA 2C5DA 3THPA 5GAGc 1ZA4A 3RI8A 5C70A 1RJ8A 2P1BA 1BKZA 5T3NA 2IXIA 3I59A 2G9FA 4HVOA 4YVWC 1URXA 1K42A 4YG0A 2WO3A 2V73A 5CADA 1EP0A 3LDKA 1AR91 4FFIA 5D2AA 1BBT1 1REDA 1TME1 3J7LA 3UYJA 5CYYA 4CVUA 5LA1A 3IPVA 1PO11 3MIFA 1FPN1 5CU1A 2SBAA 3H1MA 1D2QA 3PUQA 4FXKB 2R6QA 1WLTA 1FX5A 5GLVA 1AR73 2Q8CA 3VKOA 4BMBA 1S2BA 1W6PB 1W2TA 2YBSA 4EN7B 5BNQA 2D3RA 2QJVA 3OB8A 2R043 1JUIA 1RDVA 5FZOB 1PFWA 1Y9MA 4AFAA 4Z8BA 4RS5A 3FJSA 3N4MA 5T50A 2ZTNA 1NCRB 4XCAA 2OS2A 3MIHA 2W1WA 1K5JA 5FIXA 1HLCA 4B1LA 2XKPA 3SISA 3WP3A 2NVQL 5FPAA 4WM7B 4IQPA 5A7NA 3TN92 4CCOA 4UXAA 2NVXL 1NKGA 5LBBA 1MS1A 3RZTA 1H30A 1U5XA 1YC61 2W3JA 4K20A 3IDEA 2AC1A 4OMDA 5SV8A 2VMHA 4BIFA 2IXCA 1QJU3 3E6DA 3BU7A 5SV5A 3ZYJB 2ERSA 4A3JL 1JYNA 4K8RB 1EUTA 2MHFA 5J98B 1Y43B 3OPTA 4QM8A 1W6NA 4NHMA 3UETA 5FZGA 3WDVA 1YRZA 2F4LA 1XNBA 3AP7A 4I0BA 1S0CA 3A21A 1GQHA 1RUE1 2HWF1 5FY1A 3I4ML 5FXXA 1AVBA 2PQQA 3UJOA 1AX1A 4CCLA 7RXNA 3O1RA 5D1IA 3VBFA 1YIFA 2XUEA 2ZCWA 2JG9B 2R073 3KF3A 4IV1A 5AC93 1O5UA 1BVVA 2HWE3 4XYXA 3WUDA 1RYQA 2RM22 4BBRL 2XOMA 5C9AC 5IAXA 3AMHA 1YFYA 2ZX2A 1NT0A 1GWMA 2NP0A 1SLAA 5CEHA 2CHHA 3ES4A 4UFJA 1RB9A 1O4ZA 3TN93 5LB6A 4E9KA 3GCWA 3M4FA 1YK5A 1SBDA 2VQ0A 4LITA 4RHV3 4Y1UA 2ZGRA 3IDBB 3ZSEA 1IU6A 2G1MA 4LUMA 4UYBA 2B63L 5B4NA 2YG0A 1YQ2A 3OOXA 1U0AA 2LCQA 4UW5A 4XHXA 4ZN1B 4AI3A 1J84A 5FPVA 1B71A 1NAEA 2XDVA 3THDA 1SFPA 1YJKA 2PVXA 3CF6E 4BXFA 1PVC1 4ZS3A 3WNOA 4AXOA 1QCVA 4Y22B 3VZNA 3R05A 1J58A 1DQ5A 1F4LA 1RVF3 3AP4A 4Y1YA 2BNMA 3UKNA 4AYUA 4EWDA 3QLQA 1NOVA 1OA4A 3WX5A 4BQWA 5L19A 4B4PA 2OA2A 3O0VA 4GALA 2CWMA 2YV8A 4U2AA 4JRAA 4CDWA 1WMEA 2BZDA 1O3QA 4QPGA 2UYAA 4EZHA 1LOFA 1TNRA 1WA4A 2VUCA 2Z5WA 3DL3A 2BGCA 4JGZC 2ZA9A 4RGGA 5FMDA 4XQDA 3RZDL 1PK6A 2VVDA 5FZ1A 1VMHA 3ZDVA 2DCKA 1C5HA 3J7HA 3VBUB 1CAWA 2C9AA 3MIDA 1TMF1 2NQYA 4R9CA 1I50L 3BALA 1WW5A 1VBA3 4OUEA 1X9TA 5CNAA 3AFKA 1VE0A 3KYWA 3HEIA 4IEWA 4LEJA 4QKNA 4DUXA 3CEWA 2QQUA 3CNAA 3KYXA 2DTYA 3K46A 3AL5A 4GMP1 2CL2A 4DY3A 4E4DX 4RD7A 4QB1A 2VE1A 3VL9A 3WDTA 3PUAA 4CP9B 1AR92 1W0OA 2R063 4IEOA 1OMIA 3IZOA 3WXPA 1BBT2 3EYPA 1TME2 5IAVA 4HXCA 5GZFA 2TEPA 1ODNA 1I3QL 1PO12 4R4XA 5CVRA 1FPN2 4YPJA 3MQKB 1SDWA 8RXNA 2AEZA 3H8RA 2ZEZA 2WNVB 3HQUA 5L9BA 3AKTA 4YZ5A 3LWCA 4CDQA 3FUOA 1H4HA 5A7SA 1UZVA 4AZZA 4AK3A 1DLLA 1UD1A 5A7WA 4DXSA 1POV3 5FPBA 3N35A 1PZ7A 3LWOB 1CAUB 4XFIA 1VR3A 3PO2L 2CNAA 2YBKA 5GZDA 3KZ4C 2Y0SP 3S0MA 3KQ4B 1CAXA 4PF5A 4AR4A 5FYTA 2JECA 1B2OA 4GH4C 3I54A 1JH5A 2A3XA 1S2KA 3VBHB 3ACLA 4D6QA 4OLLA 1U5IA 5FR3A 3C7GA 4E2SA 3PU8A 2A6VA 2A69D 2FZ2A 5FBJA 3I59B 1KRIA 4YZ2A 3LEIA 2JIJA 2MEV3 4OI4A 3HN3A 4Y20A 3RZZA 1LGNA 3GCXA 5FYYA 1ZREA 1D0HA 2OKXA 3IPVB 1UOBA 4GAZA 4Z1VA 2DSXA 4TN7A 4FPYA 2GMMA 2QQWA 3IDCB 1AR93 5FZ7A 4Y52L 1BBT3 2HWD3 1DGRN 2QUOA 2HEYF 3T3YA 3W5NA 1WGPA 4QAWA 1RUE2 5FWEA 2HWF2 4PLMA 4AE2A 1GUIA 1PO13 1FPN3 2VQUA 5E88A 3V0BA 3FWEA 3LD8A 2VZ3A 3WOGA 1HN1A 1KFUL 3C7OA 3MYXA 3BN6A 3C7FA 5DDJ1 1MZ5A 2RDSA 3KT1A 4FPLA 2RDVA 3VBSC 1IW7D 3E5XA 5LATA 1H6XA 2FCUA 3ZDSA 4UBGA 1AX2A 4K9FA 1NXMA 2RJKA 1VZHA 1HV1A 2P3IA 4Q0VA 4EE2A 3KHCA 2M6OA 1W8UA 3ZYHA 5FMOS 4BB3A 3D4KA 5C8CB 1IPKA 5L7OA 1YXWA 5FZ3A 5FV3A 4V2VA 5C3PA 1JZ3A 1UY0A 3T08A 4AFCA 1JU4A 4CCDA 1JYVA 5IK5A 2A3YA 3DPRB 5HXVA 1NCQC 3RNSA 2HEWF 2ZKNA 4D7SA 1HQLA 4Y7NL 3HMYA 1PVC2 1RMU1 2HJIA 4XFCA 2ZPXA 4JAAA 2PLV1 3M3QA 4AVCA 3VZJA 4P9LA 3M4OL 2VZOA 1CZSA 2XL7A 2WIIB 5HXMA 4XEZA 1LOEA 2M4VA 5GLZA 1Y7BA 5JDBA 5JXGA 1WKYA 1ZBA1 1EPWA 1WCKA 1O8PA 1UIKA 2JD4A 3VBFB 4PIZA 4YSFA 4IV1B 5FYUA 2ZMKA 1HB4A 3Q9OA 2EXIA 3N36A 1COV1 2DVDA 4BQ5A 2R7ZL 3UGGA 2VQTA 1GMMA 4NRQA 3H0OA 3IDAA 2OQ7A 3F95A 4IE4A 4M4RA 1UZYA 1TMF2 2ZGUA 5A3PA 1UO9A 3RYKA 5HCBA 3BIEA 1SBFA 5F2SA 5B2GB 2BOJA 1OD5A 2KA3A 3RS6A 4LPLA 2JI1A 4MGTA 4PQ9A 5F5IA 1WMFA 1KXGA 4OHVA 3ZX7A 5AI3A 5KHKA 2XVLA 4YVWA 2XJTA 5FWJA 1JZ2A 2ATFA 3LDBA 1JYIA 3I2IA 2A6ED 2GALA 4QGLA 3H3UA 1NA1B 3PNAA 4CP2A 4AHXA 1D7PM 2VQAA 1OT5A 3T2TA 1YCIA 4MZUA 4KU8A 4A3KL 3KWVA 3BTXA 5LEKA 2RG4A 1XPWA 1N3PA 1WLWA 4XXAA 3AJYA 4CU6A 3U1XA 4EYUA 4SLIA 4LBNA 5FLJA 4E4SA 4F83A 2ZGKA 1IROA 2VNOA 3PWFA 5F39A 4H14A 4A3DL 1CAWB 2AACA 5FPXA 1IS6A 3Q8FA 4I30A 3SITA 3MSUA 4N90A 5T5PA 1FATA 2R0FA 1N47A 3BPZA 1MEC3 2OZJA 1EAH2 4GKXA 5C3EL 4QHOA 3THTA 2WR9A 4XIOA 5A3MA 5M5WL 1CJDA 3PJYA 5E89A 4YZ4A 3MEPA 3W58A 4AF9A 4CDUA 2WBKA 1O5LA 1QJX1 3H9BA 4POFA 1FXZA 2HEVF 2Q4SA 3BCWA 2ES3A 3GTKL 3OGJA 3P5BA 3PLQA 4PCRA 5C44L 1U5YA 2NN8A 4LLOA 1OXCA 2PN5A 1A3KA 2V5YA 2MPFA 5GLTA 3WG1A 3JB4C 1DGWA 4M3CE 2C24A 3LA7A 3OEAA 5JVH1 3UESA 1Y1WL 2J22A 5FY8A 1E5RA 2GMPA 2J1AA 3CQOA 5GJ6A 4C91A 4UWDA 4QB2A 3TYJA 2GP5A 5ANQA 3OPZA 5BXXA 1OWBA 5A33B 2WYSA 2Y64A 4ONUA 5A7WB 3WF3A 4M00A 4GS7D 1F4HA 1OC1A 4MG2A 2W2IA 2QL0A 1BYHA 2PQSA 4R9DA 2RMU3 5C9AA 1CAXB 4MHRA 5LY2A 3ZN6B 1H8TC 1V6NA 5CFCC 4FPJA 4A42A 4AVVA 4UOJA 5DDJ2 4ZPIA 4WVVA 4AI1A 2WT0A 3Q8CA 1JOBA 3OBTA 3HJRA 2J1UA 5A7QA 1UKRA 5T54A 5CFDC 1BLZA 1ZRFA 1LGCA 4S2DA 1VPHA 3PMSA 4Q4X1 2O8QA 1ZNPA 2ZGLA 1ZZCA 2WSUA 2YROA 1WJVA 3HOVL 1UU4A 4Q5OA 4MLOA 4Y20B 2DUQA 3O7OA 1W06A 2JA8L 3FDJA 2Y8KA 3MUY1 2JIGA 5FMOL 1UYPA 1K5MC 3M3IA 1ENSA 3T1LA 3ZMNA 1Z78A 3FHIB 1KJLA 3KF5A 1TZOA 4LOSA 3WVJA 4BMEA 1UXZA 4Q1RA 1RMU2 2VY0A 4Y33A 5AVAA 4PHZA 2PLV2 2ZHKA 2E2JL 1OH4A 4LORA 3ON7A 4G9SB 2VVFA 3V0BB 1VALA 1ASJ3 2ZGMA 2VU9A 4R8HA 1V6KA 1ZBA2 1W6OA 3M3CA 3USSA 2W0XA 5FJ8L 1GZ9A 3R4UA 1XE8A 1IU5A 2E2HL 4MX3A 5HCFA 5JSPA 1F4AA 3KV6A 1YUZA 1COV2 3B0AB 2WFF1 2QDNA 2CWSA 5JOYA 4QX3A 4ARXA 4BDVB 2J1SA 5IK8A 4YFZA 1GKBA 2Y38A 3J7MA 3NJVA 4XUOA 5EYYA 5A7PA 2VTFA 1TWAL 3J7Y1 4WVZA 4XBLA 5IYBL 5L73A 5L7OB 3DUIA 2EVXA 2WKKA 2XVKA 2YGMA 4FPCA 4YZ1A 1BQ8A 1L7QA 5KHHA 4JVAA 1I1EA 3VZMA 4XMIA 2JDNA 3T09A 1V00A 2NVTL 1GOFA 2WL1A 3FX3A 4MO3M 2JDPA 5T5OA 2UYBA 4LA2A 1DQ2A 4HANA 1AR62 1MZEA 2DVFA 3LOIA 4ZXKA 1O4TA 2W08A 4JHZA 5FO9B 4IL7A 2H0BA 1KEXA 1RMU3 2XJPA 4X6AL 3TEXA 5KC6A 1BEV1 1S0GA 4ZKTB 2C4XA 1JS9A 3WF2A 1WUVA 4AGGA 4D6SA 3B9IA 4ZZ5A 5T5JA 3UT0A 4BQYA 1AL21 1ENQA 2P3KA 2XLGA 1DZRA 3TBDA 5KXBA 1UY3A 3HVDA 3QH6A 4WM8C 3S6PA 1RHI1 2AYJA 4LULA 2P5BA 5FCCA 3WG2A 2PPTA 4MHUA 2D3SA 5ACA1 5J48A 1RUOA 1ZZ9A 3ABZA 4GH4A 4TYSA 5CBLA 1LOAA 4G6BA 5FBZA 2UU8A 3LSEA 4JRLA 4YGCA 4HVQA 3AYCA 4DEQA 2P4EA 1F35A 4HFSA 1QJX2 3ZXKA 1AJKA 1MQTC 3W20A 4RFRB 2PAEA 3PIJA 3NJXA 2C6BA 2XHNA 3I2HA 4LIUA 2C6SA 2JG8C 5K2ME 2UWAA 3ELNA 3S7EA 2JE9A 2BWAA 3PUSA 3GTML 4RGAA 2PAKA 4I3GA 3Q8EA 2I45A 4ES9A 3NNMA 4GJZA 3WW3A 4FPHA 1PX3A 3VKLA 5LZ6A 3ITQA 4NRPA 1Y4WA 2LW8A 1Q8PA 3HT1A 3AFGA 3O1OA 5I8YA 1O3SA 5D21A 1Q8SA 5FY9A 5KHGA 4HSLA 3I3QA 5IYDL 1PO21 3I2FA 3K3OA 3FC0A 3VHPA 3VGIA 3VDDC 2JXAA 3DYMA 1PMIA 1MZFA 1KD7A 2EY4E 2A68D 1Q8QA 3FL7A 5B4XA 4LBMA 3ZXEA 3HOYL 3VBSA 4CEWC 3POJA 1WBFA 1YYNA 1V6JA 3H7JA 2QZ2A 4WVMA 4YVSC 4CDUB 5F3EA 5IP9L 4JDOA 3CZJA 5IHRA 4LO7A 3JD73 5BY5A 4E6YA 1CAVB 3SCHA 3RZ6A 1C8M3 4QQ2A 4Q4X2 4A7KA 4KGQA 1J1TA 1VBE1 5FLHA 4ZN3B 1SMMA 2VBDA 1RUJ1 1QJX3 3UGHA 4PDWA 1LENA 5LRRA 1C8NA 1NCQA 2NMOA 1MZ6A 3B93A 4XXPA 3RQ0A 4CDWC 3NFPI 1NYWA 4FQ4A 1A8DA 1WBLA 4C0BA 5A32A 3ZXAC 1LOFC 4AQTA 5K7PA 3T2PA 3HOZL 3P1IA 1GOHA 1QH7A 1PK6C 1FHHA 1U12A 1TG7A 1T6GC 2VOVA 2WINB 2XLAA 4I09A 4LKEA 1XYOA 1QNYA 1GYKA 3VZKA 3RZLA 5A80A 2D5FA 3KQRA 2IZWA 1UPSA 4N7UA 1JOPA 3MF9A 1JBCA 4IE7A 4IDZA 5C5UA 1C09A 4RR3C 4L9BA 4P5YA 3ZFFC 3BTAA 2WFF2 4LA3A 3ZMOA 2ZZQA 3ECQA 1G8WA 3GYDA 4ASLA 3K48A 3PVEA 3PHMA 2EICA 5EHDA 4PLNA 3SEEA 4BQ2A 5F5AA 4CPBA 1X9PA 2YDEA 2VMEA 3TWIA 3BI3A 2HBTA 3VHRA 1IPJA 4RQPC 2ZEYA 2C6AA 3T4VA 3H0GL 1QEXA 4TLFA 5I8TA 3MIEA 1GQGA 3WNMA 4CDXA 3LPGA 1LOBA 1MS5A 5C3OA 4ISQA 1FNZA 1PZ9A 1OLME 2VGDA 4G4FA 4YRDA 5FY5A 1OLQA 1F9KA 4LNVA 1Z92B 4BYYA 3D6EA 2BJSA 4A3LL 1PGW1 1X36A 3BOWA 2WO2A 1ZRDA 1NUKA 2WS91 4JGZB 1S2EA 1BEV2 1NG0A 1F15A 5CISA 4TTGA 1DDLA 4FPKA 4S2GA 4FFHA 3K77A 1AL22 1R1A1 2E31A 3KT4A 4FBFA 4D3WA 4CCNA 3VKMA 4FP3A 2ARAA 1RHI2 3RWNA 5ACA2 3OJBA 4CDUC 5BPXA 2Y6JA 4CUAA 3UV9A 1RGSA 1AX0A 3KMHA 1B35A 1W2NA 3WP5A 4BXXL 3S1ML 3EJKA 2R92L 2WYFA 2A73B 2PELA 4Q4W3 3HNMA 4UBHA 1C3HA 1V9U3 2O8OA 4NPMA 5IT6A 2WT1A 2GN3A 3HWJA 2QTWB 3ZLIA 1B09A 1ZRPA 2XONA 1W6MA 1W8FA 2GN7A 2WZEA 4LLFA 1J3PA 1QQP1 3EHKA 1OKQA 3PUHA 4QKBA 5C7GA 3N7KA 4NPLA 4QU2A 3QVDA 4FTEA 5FKCA 1LHOA 2BP6A 1LU2A 1T9OA 4XFHA 3ZN4A 3TEYA 4Q0UA 1XNAA 5A3TA 2D93A 3NW4A 2ZX4A 4NWWA 3SCGA 2VOTA 2XB6C 4UFKA 1DGRA 4ET7A 4QDRA 3TEWA 3HOBA 1ZRIA 2K46A 3VB9A 1BEV3 3HQRA 4K6BA 1PO22 3UJQA 3C3VA 5FZ0A 2JKXA 4B1MA 1H8TA 3NJZA 1CADA 2ZIXA 3KD4A 3OEBA 4GH4B 4CEYA 5CFCA 4E8CA 1R0GA 5CFDA 4AW7A 3ZSKA 3AP5A 4D7TA 1JZ6A 5FJKA 3FFZA 3PIO1 3VD5A 4QDQA 1IKQA 2YMZA 4C8DA 3WDWA 4A3BL 1WWYA 5FFOC 4HZFA 1QXRA 3KHBA 3LAGA 3OYWB 3V65A 4BZ4A 2GC1A 1VBE2 3U4SA 1NXD1 4AGVA 1RUJ2 1VBD1 2DDUA 1K5MA 3I2KA 3RRDA 3KM5A 2CSGA 4OQ9A 4UF0A 4Q29A 1J83A 1QJY3 1R091 4P14A 4Q0QA 4DIQA 1MS8A 4R9BA 2XBO1 3S57A 1NY72 5F3CA 1OLMA 5C8WA 3ZYRA 2E9QA 4QPIB 1DGWX 3KGLA 5DM71 4B8CD 3HOXL 3AZZA 1HQWA 4JQTA 5FLIA 2J42A 4A41A 4QQPA 4TZDA 1W0NA 1CAAA 3J8F1 3B08B 1CZVA 2A3WA 5D8AC 5EWSA 5A6ZA 5EFUA 2I2SA 1K45A 3A0NA 1BE7A 3RYPA 3VBSB 3ILNA 1YIPA 2W5FA 1PO23 2AUSB 2LM3A 4MXVA 4WZFA 4WVMB 3C7HA 1T2XA 4A3ZA 4DS0A 4UFHA 3ZXLA 2CKAA 1SFOL 2DYCA 1UU5A 5IVYA 4RFT0 2WNUC 3EO6A 2OZ6A 1YQCA 4LO6B 1ND2C 4X6QB 5EIYB 4META 1R1ZA 5BNOB 3ETQA 1AYM1 5H9PA 1IQAA 1TEIA 4A6SA 5GAEc 4QXCA 2JDZA 1ULEA 5FK8A 1NCQB 3OTFA 4Q4Y3 2VXJA 1E5HA 4Q8LA 1DZQA 1RUJ3 5A32B 1ST8A 3WNLA 4I2OA 4AEDC 2VUDA 4AI2A 4D94A 1SQ4A 1UOGA 2YC0A 4QHZA 1MPXA 4A3FL 1AYN3 2EIDA 3K4AA 4PT6A 3K4ZA 2RS53 1PGW2 2BTVC 1KS4A 3I4IA 4A6OA 1OPOA 2WS92 3WV6A 4HL0A 1D4VB 1GNYA 3SKJE 4IXLA 3JQXA 1GBGA 1QU0A 5HCAA 1R1A2 3O1PA 1SCRA 4WM8A 2FCTA 5LA2A 5ANNA 3RMYA 5A1AA 5L9VA 3G6JB 2ARXA 5IW0A 3RG0A 1QWRA 3EMRA 3WT3A 5EIOC 2B4KA 5J96B 2HR5A 2V4VA 3HIFA 3ZFEC 2ENRA 4BM8A 2JE8A 2E33A 1MR5A 4QT6A 5DAWA 3A22A 4XIKA 4UFMA 1ND3C 4K1ZA 4NE9A 1D0GA 1GZWA 1LTLA 1MQTA 3SXWA 2V09A 4JKMA 5DG1A 2BVVA 1JZ4A 1UMHA 5MFZA 2KKDA 3GTOL 4L0PA 4NIHA 1YQ5A 2JG8A 3ZYFA 5GZGA 4ZXEA 5I0UA 4AAXA 2UURA 1VJ2A 1QQP2 2JDAA 1W03A 3PL5A 3DECA 4QWNA 4FT8A 3T0DA 1KDKA 4Y5Z0 1EY2A 3GNEA 1VAMA 3ZXJA 2PYTA 3CJXA 4JGYC 2DVAA 4GIQA 1VLNA 2R1DA 1WW7A 5RXNA 3KCYA 4X8NA 2ZGPA 4DQAA 1UNBA 2PSMC 2QQOA 5C5TA 1DX8A 4IE0A 2WS93 3ZFGA 2ORZA 2VR4A 1EV12 3VDDA 4COWA 5DPNA 5C4WC 4CEWA 2BERA 3LOBA 2DCZA 2GNBA 5DN2A 2ERJA 2VECA 4YVSA 3OGGA 2VC9A 2VMCA 4N43C 3GTJL 2ET7A 4J1WA 1RUI1 3RZMA 1C57A 1HDKA 2IVIB 4RYDA 5J09A 1QGLA 3H97A 2XQXA 1QDOA 3LCPA 3MV01 2QFEA 1W6MB 4KBBA 1UOFA 1VBD2 1YFXA 5DXDA 3I3BA 2UWBA 3H7YA 3ZN5A 5KXDA 3PU3A 3C8XA 3I49A 1GZTA 1R092 2GNMA 3RZGA 3H8XA 2FD8A 4LHLA 2WDBA 2XBO2 4KI5M 4QXBA 1QQP3 2QQPA 1MS0A 3JUUA 1MVEA 4NRMA 1FV3A 1FHMA 1YO8A 2X10A 2RM23 5DABA 3WDUA 3O1SA 3J8F2 1H8TB 1JOJA 1MVQA 4P9GA 2BDRA 2RJ2A 4RR3A 4YW5A 5CFCB 3ZFFA 2ET1A 2VG9A 2B5ID 1NLRA 2AREA 4LQRA 1O59A 5CFDB 5AN9H 2PMWB 2Q8DA 1TQ5A 1HB2A 4ASKA 2GNTA 1JYTA 2WQ8A 3J7Z1 1CESA 1KDMA 2EXJA 1RUG1 2LALA 1QYBA 1T9PA 4MXWA 1O8SA 5LASA 2ZEXA 1AYM2 1DQ6A 4IEVA 4GB31 4RQPA 5C3SA 5I0RA 2GC2A 4IEPA 1HJFA 1K5MB 2BFUS 2BV4A 2DUPA 2NPIA 1Z7S1 3KVAA 3MFAA 4NHKA 4QDSA 2RDQA 2XQRA 2JEMA 1CX1A 3P2AA 5JIAA 5FMBA 4D69A 1DP0A 3H3VM 4L92A 1VBD3 4DEVA 3AB0A 4XVHA 4JC1A 3PTRB 1IHMA 1W6QA 1FYUA 2YFUA 3AMPA 1LHVA 4R9AA 5KBFA 1J3RA 2ETEA 1LU1A 2ZJCA 1R093 4XF4A 3AXEA 3T0AA 4DRRA 4AI0A 3PVNA 1ENRA 1STMA 3I3DA 1W8NA 3DKWA 2HWC1 2Y0OA 1DCSA 1FMD1 1US3A 2PFWA 2VNGA 4N53C 1G6NA 5M3ML 5CKMA 1EAH1 2YB7A 2O14A 1GR3A 3WNPA 1R0IA 2V72A 4BCUA 1NLQA 1QIQA 1E5SA 3S1RL 5CZKA 4BE3A 2I07B 2QDRA 1R0JA 3M3YL 2ZXQA 1WCML 1NX9A 4LBQA 5HI0A 1SLIA 5DG2A 4MGIE 5E6HA 4CTEA 4TVMA 3B00A 4XTMA 3NV2A 1LKOA 3SEPA 2IXKA 3AVRA 2X5IA 3OCPA 4HKOA 5A6XA 1DQ1A 3LNLA 2PA7A 5FZ6A 2EAKA 2PYAA 4ASMB 2IXJA 1NZIA 3ZIWA 4CPBD 3UNPA 3KYYA 4NOTA 4K21A 3WW1A 4XZUG 1TME3 1LOGA 1MS4A 1UU6A 5H9SA 5DZGA 2PMZP 1O3RA 3H9CA 1RUF1 1S0JA 3POSA 2H6BA 5AFEA 5KWRA 4RS5B 2IFRA 2JI2A 6RXNA 3GHMA 4XABA 5A3OA 1SEFA 3INAA 4KMQA 1LTEA 2IC1A 4FPGA 3I2DA 4XAEA 4FTBA 3K4DA 2DUOA 4CYDA 4NHYA 1PZ8A 3N9MA 4Y1VA 2DFCA 3GDBA 3USUA 1PIV1 2VM9A 1LR5A 4WM8B 3WUCA 1WZXA 5H9RA 1YUXA 5BNPC 2ARCA 1ONAA 3KLSA 2LTNA 2RFKB 4LHSA 3HJWB 5FZFA 2ZBJA 3A7QA 3T0BA 3CLPA 5GAHc 4DB5A 3BYWA 1S0BA 4PDWC 3LWPB 1W6NB 1GZWB 1XBFA 4CXWA 1MQTB 3A44A 3KB5A 2Y6GA 2XWJB 5JUVA 2D44A 2Q8OA 4EN9B 2HVYC 1RUI2 3KCXA 4RGKA 5A6QA 3U0ZA 4P9YA 2RDNA 4MYEA 1L7RA 2JG8B 5JXHA 1X82A 1GU3A 2LUWA 5A70A 3IT8A 2XJVA 3ZPYA 3LDRA 3W21A 2BYVE 4AI8A 4WZCA 5J36A 5J37A 1RUE3 2HWF3 2ZX0A 4I0WB 4P9IA 5EZWA 5CG8A 3VHNA 1DQ4A 3RYGA 4YM3A 4CCJA 5AI2A 5FP3A 4QGMA 2Q5TA 1Y3TA 1H4GA 3ETPA 1S0EA 3VBRC 3B9CA 4EN8B 2ADEA 3VZLA 2BPA2 5D8AA 1SLCA 4P00B 1S1AA 4L2NA 3VDDB 3J9SA 4IGOA 3OUIA 5CKQA 3GBGA 4CEWB 1W8HA 2BU9A 4M0HA 1O91A 4F8AA 4AEMA 4EV0A 3MBWA 4FFGA 4YVSB 5EYXA 4FPOB 5DUVA 1AUYA 5E8AA 5GZEA 4C90A 4IUGA 4RN5A 3RMXA 1W9YA 2WNUA 1NCRC 2FDIA 2VZVA 1ND2A 1RUG2 3B7MA 4JDMA 2M6PA 4CDXC 4JAEA 2BUKA 3E6BA 3GF6A 5FREA 4B29A 5IWFA 1W8ZA 1S0IA 3RFRA 3WQ1A 1AR61 1JYBA 1KJRA 1JUHA 3DCQA 3IMNA 4GB32 3T1MA 2VUML 1K3IA 4YGBA 1DYKA 4IEYA 1G9FA 1PVC3 1Z7S2 4LIVA 1BFYA 2E2IL 3OSDA 4CDWB 4KWLA 2VBPA 2BFUL 4XQ4A 4QPGB 1RIRA 2J1EA 5G04L 3H50A 1JW6A 4AEDA 1QJZA 1CIYA 4PI2A 1PM7A 2W9XA 3GZUC 2Q1ZB 1PK6B 3VUOA 4P5HA 2QNKA 2WZR1 3VBOC 4AFBA 3ZM8A 4KWKA 2JKBA 1YFWA 2FBEA 4HETA 2Z3QB 5FZCA 2WO7A 3S1QL 3K2OA 2AEYA 2HWC2 4RR3B 1FMD2 3HR9A 3R6SA 3AMQA 4AWDA 5K0UC 2WT2A 3ZFFB 2GH8A 4JHTA 3RSJA 5CKNA 1TMF3 1H1AA 2D6LX 1B35C 1RYTA 2O0OA 4HMZA 3VKFC 2VVEA 2P2KA 3ZIXA 1RUNA 4BBSL 1VRH1 1CPNA 1O7FA 2Z69A 4MXWB 3N9PA 3S5QA 1GP6A 3ZFEA 5ABJC 3APBA 2D6OX 2CU5A 4P02B 2ZEWA 4RQPB 1H2LA 5FJHA 1ND3A 4GMP3 2J9UB 1GP4A 1RUG3 4E4HA 2DU0A 3D5OA 1VRBA 2JDUA 1IPSA 4Y24A 2XVGA 3N3HA 5BNNA 1PNFA 1W39A 1R0FA 1ULFA 4C3HL 3HNBM 4BH9A 4JX0A 1Z7S3 2JA7L 1W6QB 1RUF2 2PAMA 5DQ0A 1ODMA 4CDQB 2FDGA 3VD4A 2EF6A 1BXHA 2XLFA 3D0SA 1Z0HA 3LWVB 5GALA 5LBEA 4CSWA 2CAVA 2L9LA 3OG2A 4NJ4A 4NHXA 4OUSA 5LBCA 4BY1L 2B42B 3BUCA 3BGAA 3Q8BA 4JGYA 4CEYC 4FAGA 3SS2A 5FZBA 4AQ6A 3DEMA 2QQVA 4QPWA 1VP6A 4QGNA 3H42B 1PIV2 1GANA 2VBBA 1UN1A 2XJSA 3NJYA 4DY5A 2NMNA 1HV0A 3AJZA 1OVPA 3ASIA 3OGRA 2YY1A 3AZWA 4QD2A 1EAH3 4LBQB 3VDCA 5C4WA 2FDHA 2NM1A 3MFCA 3CKHA 1ULDA 1IG0A 5FP9A 3SHRA 3WINE 2RS11 4NIAA 1HN0A 4PLOA 1RUC1 4K3UA 2YFZA 4BPZA 4CZSA 3RZJA 1SDDB 5IVJA 2JJ6A 4UW3A 4HKWA 4IERA 1BRFA 1RB8G 1OF4A 4Y3OA 4XQWA 5FZLA 1UIJA 4LK7A 3ZOIA 4AI9A 2NYDA 1W05A 2Z2SB 2BWCA 1YV1A 4XC9A 2TUNA 1H2NA 1W8TA 3I7DA 4UW6A 4ZONA 2ZGTA 1CD3G 2OIIA 4FPFA 2YU1A 2WNEA 4KGGA 3K35A 2RS31 4ZZ8A 5FXZA 2ZX3A 1LHNA 1XSRA 2ZS6B 1Q3EA 3SCFA 1SCSA 3A23A 3BOPA 4YG6A 3T2OA 1S0DA 1BMV1 3S16L 1G9BA 4U671 1VBC1 3NNJA 4Z07A 3S7IA 3HPNA 1E57A 1UYYA 5FKBA 1R081 3FLPA 3BKZA 3USUB 3PMEA 3AKQA 2E7QA 1PVXA 1SHWB 2GH2A 3RI9A 3U14A 4GWJA 4QX8A 2C0ZA 3AL6A 2BEOA 5DDJ3 3TNPB 1SPPA 2A6XA 3UKTA 5IATA 3NKGA 3GTGL 2XXZA 3VDAA 3ACFA 2ZGQA 2QQJA 3CHXA 3JBG1 5DZEA 2VMGA 5F5QA 1K12A 3N7JA 4MGQA 1A6CA 3LWRB 1G7YA 2NVYL 1WCQA 3PIGA 4XJAA 2XH6A 4AEKA 5LCWL 1WD4A 3POFA 4M3CA 2VULA 4NIIA 1H8VA 2X53S 5H1Sc 5FYSA 4XMAA 3HOUL 4N9HA 4XZPA 3H8OA 3B3QE 4XCBA 2PLV3 4NROA 3S2DL 2QBXA 4ZS2A 3U11A 2JDMA 1WCUA 5FQ0A 1Q5OA 2YC2A 4KWUA 1LRHA 4DPNA 1ZBA3 3LQCA 2XKOA 5FUPA 2D6NA 1S2ZA 2WZR2 3ZYIB 1XC6A 1UPIA 1VBB1 4N43A 5D8AB 4R52A 5LK5A 3WY6A 3N9OA 2AUYA 3MF6A 4N53A 1OLRA 1COV3 2GZWA 2WC2A 3LE0A 4LO4B 1ENXA 3SQOA 4CXXA 1AR81 2WA3A 2YYOA 4MADA 4ATFA 2BGPA 4IE5A 2IXLA 3B02A 1H9PA 2VH9A 1S4CA 1GZCA 1DGLA 2XMLA 4JQRA 4PQQA 4W4ZA 2WNUB 1UYXA 2ZZJA 4YVWB 2WZPP 1ND2B 1JZ8A 4DUVA 1VRH2 3O12A 3WDYA 1I6XA 3LEKA 1PMHX 2GSYA 3KT7A 4K9SA 4CUGA 4E8DA 1HJGA 1CZTA 4QXHA 4LE3A 3ZYPA 3NAPC 4DOUA 3LIHA 2A71A 1HRI1 3ACHA 1HXS1 2VXRA 3VPBE 3P3PA 5HPOA 4WBBA 4CP0A 4CP1A 3ZKUA 1ZBE1 2ZGOA 1RYYA 2EIEA 1AR63 5FXWA 3ORJA 3VD7A 4DO0A 4AEDB 1DBNA 1PM4A 2A70A 2X05A 2PXJA 4YGEA 3J7NA 1HIXA 2DBNA 1WLCA 2GAUA 4YGDA 5FYHA 2OXBA 4KH9A 4OQ8A 4O9GA 4Y1ZA 3OY8A 3ZFGC 1W90A 4KU7A 5FP8A 1DU3D 1ACCA 4GZ9A 4W65A 5C4JL 5ISLA 3MW4A 3C7EA 2Q0AA 3WSOA 4IEQA 2R93L 5E16A 4FAHA 3NNLA 3X29B 5FZDA 3S2HL 5BNPA 2WJSA 1YQ8A 4COYA 3FZ3A 2RE9A 5GZCA 2YGLA 1RXGA 1W8OA 4KG0A 2BNNA 3GGLA 3I4NL 4YWAA 3SC7X 1IKPA 3ZFEB 4X8PA 1R9TL 4FOVA 4HBNA 5E1RA 2RJLA 4OCTA 5T52A 2RS12 1ND3B 2V4AA 1RUC2 3W59A 4DZGA 3AYAA 4Y1XA 1VRH3 5T55A 1C4RA 1DYOA 4W50A 2P37A 4HPKA 1OUSA 2W39A 3NRUA 1WW6A 3I2GA 1ZZBA 3KVBA 4PIYA 2DFBA 1NY71 3H9AA 4BQ4A 3LPFA 2CY6A 5EJ1B 5DUXA 1UWWA 4YW2A 3S15L 4XFBA 5M5XL 4CCKA 1JYXA 2GU9A 2D6KA 1P8JA 4HN0A 2AZ5A 2RS32 2VTXA 3CU7A 2VTXJ 3GBWA 3GALA 1OH3A 4LMFA 3BB6A 5C9AB 1BMV2 2ZAHA 2ARBA 1AR71 3ZO0B 1VBC2 2J1TA 4N9IA 2R041 1R082 3VBRA 5A3UA 4ARYA 1BK0A 1J3QA 3UK9A 4FP2A 2OT7A 4TXWA 1HX6A 5DAVA 2ADDA 3NWKA 2DTWA 2PHUA 3MPPG 1SFNA 3NKTA 4JCKA 1RTVA 4Q0PA 4QKFA 3IKWA 4URTA 4XUPA 1CONA 5CB7A 4YM1A 3VZOA 4FSJA 4L11A 1WW4A 1YJLA 1YLLA 1NCRA 3JBG2 3LEGA 4P9JA 4XE9A 4Q4X3 4XAAA 4DFSA 2RS13 5IJRA 1VZIA 5JOZA 1L3JA 4WM7A 4E4ZA 1YUDA 4H2AA 4JADA 1ODHA 3N9NA 2LROA 4YYOA 3WF4A 1JHNA 3O14A 3OGSA 2NYYA 4HONA 4IGQA 4LE4A 4Q0SA 1W6OB 2WWJA 4S2FA 1XE7A 1LKPA 1POV0 3P3NA 1CR7A 3TRSB 3I2JA 4CCEA 4DUWA 3KS7A 4C3JL 2DV9A 4HK8A 2BVBA 3WHTA 1C28A 5JI7A 4WV8A 3VBOA 5K8SA 3RYRA 3M3OA 3HAGA 4XUQA 4FO9A 2C1FA 5C33A 1SMVA 1VBB2 2WQZC 3LF7A 1SMUA 3ACIA 4POGA 5K0UA 5FPLA 2VCCA 2V0EA 5JOWA 2R071 1TVGA 5KHIA 2WFF3 5AC91 2HWE1 1SPPB 1HW5A 1AR82 1S55A 4XDQA 5FK7A 2GMGA 2K2SA 4KBZA 1DG6A 5JPMB 2X5IC 4A3CL 1AL0G 1CJPA 1OURA 3AVSA 5FRAA 5HBAA 3I97A 1D4M1 4Q27A 3H8UA 3UKVA 4IV3C 2DCTA 1X8MA 1PFUA 1HQNA 4QM9A 2L0ZA 5ABJA 4YFWA 3GBFA 2D43A 5KXEA 4M4PA 4M3CB 4XFAA 2RVAA 2F6BA 4BK4A 2ZHMA 4LOTA 3MW3A 3WNKA 4OHXA 4RHV1 2VL4A 4XJWA 1J59A 2MS3A 2QQMA 5EXOA 3MGUA 1HRI2 1HXS2 5FO8B 4W8JA 2E6VA 2VD7A 3URFA 1ZBE2 1VMJA 3O0XA 4QX1A 3IMMA 4EWAA 1UYZA 1LNSA 4HKLA 4ISRA 3LPEB 4HLTA 5FQ0B 4P08A 1LECA 2WAAA 4LXLA 2W52A 4EQVA 1RVF1 3ZPOA 5FP4A 4N43B 1EV11 1UOJA 3DGTA 1WCDJ 4IE6A 3BIWE 4N53B 1ZZ7A 1TNFA 4UFIA 1JI6A 1Y1VL 4WFN1 1AL23 3FHAA 5IVCA 1OA3A 2DWRA 4Q4V1 4RA0A 4XFGA 3MDPA 5JVVA 1VBB3 3CO2A 3O1UA 1RHI3 5HV4A 2B46X 5IVBA 5ACA3 1CGPA 1VB4A 5FYVA 1Y9QA 4AL9A 4Q8KA 2D40A 3MIGA 2J1RA 3DXUA 2Q1MA 1AR83 1HKDA 3AXDA 1FOD1 4QQOA 3MIBA 1HRV1 2VZQA 1W28A 1O6UA 1V6MA 1VBA1 4LO5B 3U37A 3LGRA 1UMZA 4CCMA 2WFPA 2DURA 3D82A 4XUTA 2XUMA 3WR0A 3WEZA 2RDRA 4UFLA 2K0GA 5GADc 2Y0IA 5IK4A 3VL8A 4B3NA 1WMXA 5GKAC 2JA5L 1QOSA 2ZAAA 1XNTA 3VKNA 2D98A 2R061 2ZABA 3R0RA 1UW8A 1W8WA 4JKKA 1ZBE3 1SACA 5FPZA 3K75B 5L9RA 1N1VA 2PHRA 3DKQA 2XPJA 3GZEA 4K40A 4Q1PA 2ZX1A 3OY8B 2OPKA 4CP9A 1GV9A 1DYPA 2P3JA 1XYPA 1W99A 1ZZ8A 5FZ8A 1BVP1 2IXHA 2QQNA 2QE3A 4BQ1A 2W94A 4C1WA 1AR72 3BPSA 3I2OA 4NN0A 2R042 4E27A 1IS5A 4XBQA 3VD3A 5BNPB 5BV6A 1GWLA 2OUHA 3LB9A 3MUZ1 5LK7B 5FZKA 3S30A 3L2YA 1SMWA 1ZYBA 5DUWA 1W9TA 3ATGA 2WN2A 5A6YA 1L7LA 4A3GL 4M3CF 3PIP1 5C6CA 1DZTA 2B8MA 4URAA 1IS3A 1UY2A 4LKSA 4PDWB 3DF0A 4JAGA 4B4RA 1TWHL 2RR11 5IFPA 2VZUA 3LWQB 1I9RA 3AP9A 3NV1A 1C5IA 1VBE3 4X6RB 1QNWA 4OI0A 3WDXA 1IG3A 1LHUA 1UF2C 1POQA 1PFYA 2E26A 2XGXA 2Y6HA 3WQ0A 5J1XA 3ZXGA 2AENA 2R16A 2AGSA 2MEV1 3THCA 2H0VA 3ZSJA 4A7ZA 5F9TA 3PUIA 2HBUA 4MSVA 4W6WA 1JMUB 3L2HA 3JU9A 3JZVA 3M1HA 4MGSA 1OKOA 1X7NA 2HWD1 4CU9A 4YM2A 3VBRB 2A7AA 1TWCL 1BQPA 4Z82A 2OW4A 4JAFA 2BOIA 4PIXA 4LKFA 4V1PA 1JODA 2D3PA 2R072 4H7MA 1UY4A 5JIUA 5AC92 1OFNA 4BIOA 1AXZA 2UWCA
chains in the Genus database with same CATH topology
2Y26A 4DMIA 4GMP0 1V6IA 1D4M2 3H1YA 4MVTA 3V64A 4CDXB 2PTMA 3RJ2X 3FMGA 4P9XA 1Q8VA 5BNNC 3CJIC 3NAPA 1X50A 2R30A 2E7TA 4RHV2 1GNZA 3K51A 2WA4A 2ILMA 3PVBB 4N7IA 1LOCA 3MI8A 1Q56A 3WG4A 5C8CA 2YPJA 5EINC 3LKJA 3FE5A 4V196 1XNCA 3PTYA 1NZCA 3VBOB 4FVVA 5CIRA 1RVF2 3WP6A 4QMAA 1F8VA 1X33A 3DPRA 1OHFA 4JTOA 2ERFA 4HVRA 2W68A 3GZAA 4YW3A 3V56A 5K0UB 1UCXA 1AF9A 1UL9A 2IWGB 3MLLA 1R1A3 4Q4V2 3IBMA 4Y26A 3RJRA 3ZSLA 1FV2A 1B35B 5F6KA 2GNDA 4TSVA 2GMEA 2WLQA 4I0AA 3ZVXA 1LKNA 4BA6A 5ABJB 1RITA 1FOD2 1HRV2 4ZU7A 4NO4A 3TNQA 1VBA2 1D4M3 1Q8OA 1LKMA 3SH3A 5T5LA 2ZGSA 3ST7A 4XBNA 3U07A 2FMDA 3GHNA 5IUQA 3L9JT 3AKRA 4LUKA 4C1XA 1J1LA 1H9WA 1OFSA 2NLRA 5H9QA 2R062 4RL7A 2VOXA 2F4PA 4TPUA 3NL1A 1VCXA 4PJYA 5I8SA 4H55A 1QY4A 4FOQA 1NA1A 4QX5A 4CEYB 1NNQA 4LTAA 4XETA 1QMJA 2K9ZA 3WQ7A 4KG8A 1EV13 2YUEA 4U36A 1ZVFA 3R4SA 3WHUA 4B8EA 3ES1A 1RL3A 1H7VA 4Q4V3 2CKCA 1DFQA 1YNAA 3ENRA 4EJRA 5KC5A 3H1WA 1SLBA 3ZXFA 3ZG6A 4XPVA 4J6GA 1MEC1 1WMDA 1PGL1 1FOD3 2R32A 1HRV3 2RR12 1GNHA 2H12A 1SLLA 4LHNA 2ZHLA 4OFGA 3SLIA 1EYBA 2HKXA 2UY8A 3JB8A 5AVPA 2MEV2 3WP4A 1BJQA 2VW1A 2BW8A 4W6XA 2XBO3 2PHDA 2GDFA 4TWTA 5JZGC 2VMIA 1N3QA 4OHZA 2HWD2 1LESA 1BZWA 2X8KA 4OHYA 3J8F3 4XFFA 3KYUA 1TE1B 4JTNA 3LZZA 4UY81 4DNYA 3AZYA 5FDBA 1E8JA 3KGZA 4ZU5A 2RMU1 4YZ3A 5A33A 1LULA 1RJ7A 2VW2A 1QH6A 3PZAA 1BQ9A 4XJZA 4IESA 1LEMA 5FAXA 2VW0A 4XILA 4IV3A 5F6LB 4KNCA 1C1FA 1G9DA 2FZ1A 1GFF2 1AYM3 2P34A 4YW1A 1CVNA 2YZ4A 3ZN6A 4J1XA 1VIWB 4FCAA 2BNOA 2RR13 4IETA 2TNFA 4XF0A 1PHMA 3H3ZA 4AR6A 1GLHA 4RSUA 2A6WA 5I0TA 1OOPC 4EROA 1IZ3A 2VL6A 4E2GA 1N1SA 4SBVA 1W0PA 4HT1T 4Q2FA 3TAYA 1ASJ1 3HQXA 3ALQA 3VN4A 1N3OA 1V70A 2CR8A 2CTVA 3M8LA 2E63A 5I0SA 4YG3A 4QPIC 1IS4A 1ZM1A 1KITA 4AG4A 4GWNA 3PKIA 1FNYA 1UX6A 1C1LA 3AM2A 3HT2A 2KXLA 1RDGA 3N7MA 1H1IA 3AZVA 3NAPB 1XNDA 2YXSA 4K1YA 3VHOA 4E2QA 4AHWA 3P8BA 1LODA 4EN6B 1CPMA 3WCRA 5JSOA 3O5SA 2WQ4A 4YWLA 4OULA 4ATEA 4XF3A 3SMHA 5BNOC 1OPMA 4K8FA 1CIWA 1XYNA 4PBOA 2PVEA 3FUQA 5BUVA 3ZFGB 1B13A 5DZFA 4AVTA 1ULGA 3OD0A 4LT5A 2G9GA 1AXYA 5KHJA 2KN9A 2PHTA 1NXEA 3B5LB 3JQWA 3RDIA 4LO8A 2KM2A 3MLKA 2WSVA 5CAZA 1YFUA 1RUD1 3VUOA 3U4XA 2WLPA 5A3LA 1APNA 2XL9A 1F31A 1F2NA 3D0JA 2DU1A 2B5HA 2ZMLA 1VAKA 2CV6A 2Z79A 3C2UA 2OVUA 4WM7C 1G9AA 3M7AA 3AKPA 3AK0A 1MEC2 1PGL2 1RUI3 3WW4A 4AFMA 3O0WA 2JICA 1AZDA 4AVBA 4GKYA 2A6HD 2D7FA 1NE4A 4ES8A 4GWMA 1W2UA 3IM0A 1XU1A 1QF3A 4AHYA 3LA2A 2R49A 4NR1A 3PKJA 1REFA 1IOAA 3GZTB 1LHWA 1NQDA 2JE7A 1V6LA 3BODA 2ZHNA 4HK9A 2A5ZA 2NZ9A 2DVGA 4XOGA 4MH0E 3MPSA 1JXNA 4G3YC 2JG9C 1R0HA 3WG3A 4XJUA 1VB2A 2RMU2 2TBVA 1CQ9A 3EBRA 2AH2A 5JI9A 1ZX5A 1N1YA 2QVSB 2MNGA 4GB33 5L36A 3JD71 3CJIA 1C8M1 2VNRA 5MFPA 1ALYA 3FBMA 3OF1A 4OI2A 4LR4A 4BHPA 4I02A 3E5QA 4ITCA 1O4YA 1U5ZA 1CX4A 1CAVA 3QACA 3SNMA 1AXKA 1UZZA 5JVG1 2ZOEB 4RXNA 3NV4A 1I3HA 3NSTA 3HN1A 3UL2A 4GULA 4O9EA 2HWC3 2VPVA 1FMD3 1ASJ2 1V6OA 1KQRA 3ILFA 2XWBB 4YM0A 2JENA 5J3UA 4AQSA 1QOOA 3MW2A 2B39A 1QXJA 1H0BA 2ZMNA 3G7DA 5IY0A 2X5IB 4IV3B 3E5UA 4MGZE 3VBUC 4Z2WA 4B7EA 4QXKA 4L8QA 5CA6A 1IRNA 2O1QA 4R4ZA 4NHLA 1G86A 1T9QA 3AP6A 3QCWA 3ROUA 2XJUA 3IU3I 3OBRA 1ZZ6A 1VAVA 4XGHA 4HSJA 1RUF3 4D7YA 4IEZA 3IIAA 5MGNA 3B94A 3PJQA 4AHZA 4QHBA 2VUAA 3WLUA 1RUH1 2XHKA 4XTPA 3WZ1A 4KWJA 2PHFA 3AMNA 2Q30A 3NVCA 2VOKA 2IFWA 2WNVC 4OHWA 4Y4YA 1PIV3 2H6CA 3CL1A 3DN7A 2M4YA 3EQEA 4L99A 4BLJA 4YARA 1WLDA 4INDA 3VLBB 4BOWA 1RUD2 1QDCA 2QZ3A 1OI6A 5JPNB 1LCLA 3EXUA 3QH7A 4MGYE 4JGZA 1BK1A 3QOPA 4M0NA 4OVEA 4FXGB 1ZRRA 2B9UA 2K2DA 4AR5A 2HWB1 3VBHC 2SLIA 3J26N 2JX9A 5EV7A 3POWA 2B7YA 3DV8A 1FI2A 5GM0A 4GQ7A 3J4UH 4Q4W1 1V9U1 1OQEA 4F7ZA 1H2MA 3B01A 4I01A 1XNKA 4BWOA 5I93A 5JZGA 1WD3A 1QKQA 4ORFA 5FTTC 1DHKB 1OQDA 3PVOA 2O5JD 4NVPA 1XXNA 5JLVA 4LBKA 4RS5C 2E7AA 3WD5A 4ZU4A 4Z92B 2BE5D 1GICA 4I3PA 2EAAA 1BCXA 2XJQA 1RUD3 3AKSA 1XQNA 3WCSA 2QCSB 3IWZA 3SH5A 2ZKLA 1JYCA 3FLTA 2Z3RB 5J7MA 3AMMA 2V0FA 2EXHA 3HBZA 3JD72 5C8CC 1LB2A 1C8M2 1D2SA 3HD8B 4H3WA 4XJ9A 1OOPA 1OSGA 5GLWA 1N1TA 2G4IA 3DPRC 2XJRA 1YHFA 4GA9A 1QJY1 3M3EA 1M4WA 3OYWA 2WZR3 2I74A 2CGNA 5MF6A 5BYNA 4W6YA 2A75A 3VBFC 1JTZX 1S24A 4IV1C 4QQHA 1KS5A 4QPIA 4H7LA 1GSLA 4NWVA 5FOBB 2AR6A 4JDNA 4LBQD 4QQLA 4C0HA 3I8TA 3V0AA 1OWCA 4MUVA 1LGBA 1MACA 4JV4A 4K7JA 4XJ8A 2EXKA 3CJIB 5BNNB 4OI1A 3TB0A 2EIGA 3A4UA 3AYEA 4UW4A 4COZA 2R0HA 5JCTA 2CGPA 1YI7A 3ZSMA 2GC3A 5JMCA 1FAYA 4Q4Y1 4AEJA 4LBJA 5BNOA 4KL1A 3RPQA 5KXCA 1NE6A 4JGYB 1NA1C 2VUJA 3LSDA 5JAXA 4F3JA 2QKDA 4COVA 4M01A 4IEXA 3QQCE 3AYDA 1RUH2 3FBYA 1AYN1 3A0KA 1W6PA 1YK4A 1OA2A 2CYFA 2RS51 4QPGC 5C4WB 1RWDA 1PNGA 2D97A 1UKGA 2DVBA 4XXBB 1OQ1A 4WVWA 4MGKE 4KQ7A 4NPRA 4MV2A 5TSWA 1S0FA 1QJU1 3AX4A 5DUUA 2DCYA 1RUC3 2HYKA 1QXPA 2OUJA 3IN9A 1WCSA 2R1BA 1DIWA 2HWB2 4HN1A 4DRVA 5DM61 4PBPA 5JSRA 1X8EA 1MS9A 1A8MA 5JOXA 3NV3A 2CGOA 4S2HA 4DINB 4Q4W2 2GC0A 1YI9A 1V9U2 4Q26A 1LJ7A 4QPYA 3MZHA 2BBVA 2RS33 3AZXA 1ZRCA 3D8CA 4OUMA 2E51A 3M2MA 3POYA 2UY9A 3ILRA 5FO7B 1VBC3 3ME2A 4EWEA 3WWNB 1R083 1UAIA 4FPEA 2XG3A 1H1MA 3JCIA 3WW2A 4B4QA 4CDQC 1FT9A 1RUH3 2FQPA 2PHLA 3WNXA 2X29A 5JWPA 2JG9A 3WWLA 1LEDA 1NXGA 1PGSA 1NQJA 1QOTA 4XHBA 5IK7A 1JN2P 4LBOA 3TN91 3FFQA 3JBG3 4LBLA 1IGOA 4EN0A 1VZGA 1Q43A 1QHDA 2YHJA 4A7YA 5GLUA 2Z42A 3KSCA 4GXLA 4XW3A 3MLJA 1AJOA 2HWB3 4AFDA 2ZACA 3W9AA 1A78A 1AHSA 1EPZA 1H2KA 1DVBA 3SH4A 3NO8A 1KFXL 4AVSA 2D6MA 2AYHA 1B2JA 3MICA 5JZGB 2WWSA 1M06G 5F1RA 2V3BB 1QJY2 4BLIA 2N7GA 4P9WA 4Y22A 3B69A 1MS3A 2D6PA 3KYVA 4LHKA 4YNIA 2VOWA 4AQ2A 4XF9A 1S30A 3E6CC 2RM21 1YWKA 1CN1A 4A2UA 3VV1A 3R4DB 3OD4A 3FLRA 5FOJB 3VBUA 4A3XA 4COUA 3QBQA 2EA7A 1ULCA 1G9CA 4FTSA 1RC6A 1REEA 1XU2A 2CAUA 4IEUA 2B45X 1DQ0A 1HRI3 1HXS3 2A6ZA 2BQPA 5L7OC 2E53A 3N7LA 1OOPB 2A6YA 3LA3A 1SFYA 4DXZA 5K9YA 3QD6A 5LRSA 2RHPA 4Q4Y2 4L97A 3M70A 3MPBA 4FQZA 1O3TA 4FOYA 1NLSA 1F5FA 2OYZA 2EALA 2D5HA 4AR3A 5JR7B 4YLZA 2DF7A 1POV1 2WNVA 1AYN2 5CG9A 2RS52 3KCCA 5EJ3A 1SLTA 2DCJA 2FMYA 3ZYGA 5I91A 4AGRA 1XRUA 4YWMA 4YW4A 2ZGNA 3TOJA 1RINA 2PHXA 3ZXDA 1CAUA 4HPKB 3V0AB 3E97A 1I5ZA 4B7KA 1F5JA 1DF0A 5AFBA 2FHRA 4ME3A 4CRQA 2PHWA 1QJU2 2P17A 5LEJA 4FOWA 4OZXA 1SBEA 4XF1A 5MLC3 3VBHA 3U10A 2JI3A 4AVAA 2C5DA 3THPA 5GAGc 1ZA4A 3RI8A 1RJ8A 1BKZA 5T3NA 2IXIA 3I59A 2G9FA 4HVOA 4YVWC 1URXA 4YG0A 2V73A 5CADA 1EP0A 1AR91 1BBT1 1REDA 1TME1 3IPVA 1PO11 3MIFA 1FPN1 5CU1A 2SBAA 3H1MA 1D2QA 4FXKB 2R6QA 1WLTA 1FX5A 5GLVA 1AR73 3VKOA 4EN7B 4BMBA 1S2BA 1W6PB 5BNQA 2D3RA 2QJVA 2R043 1JUIA 1RDVA 4AFAA 4Z8BA 4RS5A 3FJSA 3N4MA 5T50A 2ZTNA 1NCRB 3MIHA 1HLCA 2XKPA 3SISA 3WP3A 4WM7B 4IQPA 3TN92 4UXAA 1MS1A 3RZTA 1H30A 1U5XA 4K20A 4BIFA 3IDEA 5SV8A 4CDUC 2VMHA 2IXCA 1QJU3 3E6DA 3BU7A 5SV5A 3ZYJB 2ERSA 2MHFA 5J98B 1Y43B 4QM8A 1W6NA 4NHMA 3WDVA 1YRZA 1XNBA 3AP7A 4I0BA 1S0CA 1GQHA 1RUE1 2HWF1 1AVBA 2PQQA 3UJOA 1AX1A 7RXNA 5D1IA 3VBFA 1YIFA 2ZCWA 2JG9B 2R073 4IV1A 5AC93 1O5UA 1BVVA 2HWE3 4XYXA 3WUDA 1RYQA 2RM22 5C9AC 3AMHA 1YFYA 2ZX2A 2NP0A 1SLAA 3ES4A 1RB9A 1O4ZA 3TN93 4E9KA 3M4FA 1YK5A 1SBDA 2VQ0A 4RHV3 4Y1UA 2ZGRA 3IDBB 3ZSEA 1IU6A 4LUMA 1U0AA 2LCQA 4UW5A 4XHXA 4ZN1B 4AI3A 1B71A 1YJKA 2PVXA 3CF6E 1PVC1 4AXOA 1QCVA 4Y22B 3VZNA 3R05A 1J58A 1DQ5A 1RVF3 3AP4A 4Y1YA 3UKNA 2BNMA 4AYUA 4EWDA 3QLQA 1NOVA 1OA4A 3WX5A 5L19A 4B4PA 2OA2A 3O0VA 4GALA 2CWMA 2YV8A 4U2AA 4JRAA 4CDWA 1WMEA 1O3QA 4QPGA 2UYAA 1LOFA 1TNRA 1WA4A 2Z5WA 3DL3A 2BGCA 4JGZC 2ZA9A 4RGGA 4XQDA 1PK6A 2VVDA 2DCKA 1C5HA 3VBUB 1CAWA 2C9AA 3MIDA 1TMF1 2NQYA 4R9CA 3BALA 1WW5A 1VBA3 5CNAA 3AFKA 3KYWA 4IEWA 4LEJA 3CEWA 3CNAA 3KYXA 2DTYA 4GMP1 2CL2A 4DY3A 4E4DX 4RD7A 3VL9A 3WDTA 1AR92 1W0OA 2R063 4IEOA 1OMIA 3WXPA 1BBT2 1TME2 5GZFA 2TEPA 1PO12 4R4XA 5CVRA 1FPN2 1SDWA 8RXNA 2WNVB 3AKTA 4YZ5A 3LWCA 4CDQA 3FUOA 1H4HA 4AK3A 1DLLA 1UD1A 1POV3 3N35A 1PZ7A 1CAUB 4XFIA 1VR3A 2CNAA 5GZDA 3KZ4C 3S0MA 1CAXA 4PF5A 4AR4A 2JECA 1B2OA 4GH4C 3I54A 1JH5A 2A3XA 1S2KA 3VBHB 3ACLA 4OLLA 1U5IA 4E2SA 2A6VA 2A69D 2FZ2A 3I59B 1KRIA 4YZ2A 2MEV3 4OI4A 4Y20A 3RZZA 1LGNA 1D0HA 3IPVB 4Z1VA 2DSXA 4FPYA 2GMMA 3IDCB 1AR93 1BBT3 2HWD3 1DGRN 2QUOA 2HEYF 1WGPA 1RUE2 4AE2A 2HWF2 4PLMA 1PO13 1FPN3 5E88A 3V0BA 3FWEA 3WOGA 1KFUL 3MYXA 5DDJ1 1MZ5A 3KT1A 4FPLA 2RDVA 3VBSC 1IW7D 3E5XA 3ZDSA 4UBGA 1AX2A 4K9FA 1NXMA 2RJKA 1VZHA 1HV1A 2P3IA 4Q0VA 2M6OA 5C8CB 5FMOS 3D4KA 1IPKA 5L7OA 1YXWA 4AFCA 5IK5A 2A3YA 3DPRB 5HXVA 1NCQC 3RNSA 2HEWF 2ZKNA 4D7SA 1HQLA 5GZGA 3HMYA 1PVC2 1RMU1 2HJIA 4XFCA 2ZPXA 4JAAA 2PLV1 3M3QA 4AVCA 3VZJA 4P9LA 2XL7A 2WIIB 4XEZA 1LOEA 2M4VA 5GLZA 1Y7BA 5JDBA 1ZBA1 1EPWA 1WCKA 1UIKA 2JD4A 3VBFB 4PIZA 4YSFA 4IV1B 2ZMKA 3Q9OA 2EXIA 3N36A 1COV1 2DVDA 3H0OA 1UZYA 1TMF2 2ZGUA 3RYKA 5HCBA 1SBFA 5B2GB 1OD5A 2KA3A 3RS6A 2JI1A 4PQ9A 1WMFA 1KXGA 4OHVA 3ZX7A 5AI3A 5KHKA 2XVLA 4YVWA 2XJTA 2ATFA 1JYIA 2A6ED 2GALA 4QGLA 3H3UA 1NA1B 3PNAA 4CP2A 4AHXA 2VQAA 3T2TA 1YCIA 4MZUA 4KU8A 5LEKA 1N3PA 1WLWA 4XXAA 3AJYA 4SLIA 4LBNA 5FLJA 4E4SA 4F83A 2ZGKA 1IROA 2VNOA 3PWFA 4H14A 1CAWB 5FPXA 1IS6A 4I30A 3SITA 3MSUA 4N90A 5T5PA 1FATA 2R0FA 1N47A 3BPZA 1MEC3 2OZJA 1EAH2 4GKXA 3THTA 3ZN5A 4XIOA 5A3MA 1CJDA 3PJYA 5E89A 4YZ4A 3MEPA 3W58A 4AF9A 4CDUA 1O5LA 1QJX1 4POFA 1FXZA 2HEVF 2Q4SA 3BCWA 3OGJA 2ES3A 4PCRA 3PLQA 1U5YA 2NN8A 4LLOA 2PN5A 1A3KA 2V5YA 2MPFA 5GLTA 3WG1A 3JB4C 1DGWA 4M3CE 3LA7A 5JVH1 2GMPA 5GJ6A 4C91A 3TYJA 3OPZA 5BXXA 1OWBA 5A33B 4ONUA 4M00A 4GS7D 2QL0A 1BYHA 4R9DA 2RMU3 5C9AA 1CAXB 3ZN6B 1H8TC 1V6NA 5CFCC 4FPJA 5DDJ2 4WVVA 4AI1A 2WT0A 5CFDC 3OBTA 1UKRA 5T54A 1ZRFA 1LGCA 4S2DA 3PMSA 4Q4X1 2O8QA 1ZNPA 2ZGLA 1ZZCA 2WSUA 2YROA 1WJVA 1UU4A 4MLOA 4Y20B 2DUQA 3O7OA 3S6PA 5FMOL 1K5MC 3M3IA 1ENSA 3T1LA 3ZMNA 1Z78A 3FHIB 1KJLA 3WVJA 4BMEA 4Q1RA 1RMU2 2VY0A 5AVAA 2PLV2 2ZHKA 4G9SB 2VVFA 3V0BB 1VALA 1ASJ3 2ZGMA 2VU9A 4R8HA 1V6KA 1ZBA2 1W6OA 3M3CA 3USSA 2W0XA 1GZ9A 3R4UA 1XE8A 1IU5A 5HCFA 4MX3A 5JSPA 1YUZA 1COV2 3B0AB 2WFF1 2QDNA 2CWSA 5JOYA 5IK8A 4YFZA 1GKBA 2Y38A 5EYYA 4WVZA 3J7Y1 4XBLA 5L73A 5L7OB 3DUIA 2EVXA 2WKKA 2XVKA 2YGMA 4FPCA 4YZ1A 1BQ8A 5KHHA 4JVAA 1I1EA 3VZMA 4XMIA 1V00A 5T5OA 3FX3A 2WL1A 2UYBA 4LA2A 1DQ2A 4HANA 1AR62 1MZEA 2DVFA 3LOIA 4ZXKA 1O4TA 2W08A 5FO9B 4IL7A 2H0BA 1RMU3 2XJPA 5KC6A 1BEV1 1S0GA 4ZKTB 1WUVA 4AGGA 3B9IA 5T5JA 1AL21 1ENQA 2P3KA 2XLGA 1DZRA 3TBDA 5KXBA 3QH6A 4WM8C 1RHI1 2AYJA 4LULA 5ACA1 5FCCA 3WG2A 2PPTA 5J48A 2D3SA 1RUOA 1ZZ9A 4GH4A 4TYSA 5CBLA 1LOAA 4G6BA 5FBZA 2UU8A 3LSEA 4JRLA 4YGCA 4HVQA 3AYCA 4HFSA 1QJX2 3ZXKA 1AJKA 1MQTC 2PAEA 2C6BA 2JG8C 5K2ME 2UWAA 3ELNA 3S7EA 2JE9A 2BWAA 4RGAA 2PAKA 4I3GA 2I45A 4ES9A 3WW3A 4FPHA 3VKLA 1Q8PA 3HT1A 3AFGA 5I8YA 1O3SA 1Q8SA 5KHGA 4HSLA 1PO21 3FC0A 3VHPA 3VGIA 3VDDC 2JXAA 1PMIA 1MZFA 1KD7A 2A68D 1Q8QA 4LBMA 3ZXEA 3VBSA 4CEWC 1WBFA 1YYNA 1V6JA 3H7JA 2QZ2A 4WVMA 4YVSC 4CDUB 4JDOA 4LO7A 3JD73 5BY5A 4E6YA 1CAVB 3SCHA 3RZ6A 1C8M3 4QQ2A 4Q4X2 4A7KA 4KGQA 1J1TA 1VBE1 5FLHA 4ZN3B 1SMMA 1RUJ1 1QJX3 4PDWA 1LENA 5LRRA 1C8NA 1NCQA 2NMOA 1MZ6A 3B93A 4XXPA 3RQ0A 4CDWC 3NFPI 1NYWA 4FQ4A 1A8DA 1WBLA 4C0BA 5A32A 3ZXAC 1LOFC 4AQTA 5K7PA 1QH7A 2VOVA 1PK6C 1FHHA 1U12A 2WINB 1T6GC 4I09A 2XLAA 1XYOA 1QNYA 1GYKA 3VZKA 2D5FA 3KQRA 2IZWA 1UPSA 4N7UA 3MF9A 1JBCA 1C09A 4RR3C 4L9BA 3ZFFC 3BTAA 2WFF2 4LA3A 3ZMOA 2ZZQA 3ECQA 1G8WA 3GYDA 4ASLA 3K48A 3PVEA 3PHMA 4PLNA 2YDEA 3TWIA 3VHRA 1IPJA 4RQPC 2C6AA 4TLFA 5I8TA 3MIEA 1GQGA 4CDXA 1LOBA 1MS5A 4ISQA 1FNZA 1PZ9A 2VGDA 4G4FA 4YRDA 1OLQA 1F9KA 4LNVA 1Z92B 4BYYA 3D6EA 1PGW1 1X36A 3BOWA 1ZRDA 2WS91 4JGZB 1BEV2 1NG0A 4FPKA 4S2GA 1AL22 1R1A1 <