4AHWA

Flo5a showing a heptanuclear gadolinium cluster on its surface
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Complex Gadolinium-Oxo Clusters Formed Along Concave Protein Surfaces.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Sugar binding protein
total genus 59
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4ahwA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ahwA01
4AI3A 4COZA 2XJRA 4AF9A 4AFCA 2XJTA 4AHXA 4LHKA 2XJSA 4COWA 4CP2A 4A3XA 4AHYA 2XJVA 4COUA 4AI1A 2XJQA 4AHZA 4AI0A 2XJPA 4AI2A 4D3WA 4LHLA 4CP1A 4AFAA 4GQ7A 4COYA 4ASLA 4AHWA 2XJUA 4LHNA 5A3LA 4COVA 4AFBA 5A3MA 4CP0A
chains in the Genus database with same CATH superfamily
4HANA 1A34A 5GAHc 4C1XA 2KR2A 4Y5TA 3HIFA 3KHCA 2BERA 4N43B 1J3PA 1XBFA 2CTVA 4IE5A 1OWBA 2I2SA 5T52A 4EN9B 4IEXA 4LO6B 1NZIA 3ACFA 3O1OA 1XSRA 2FCVA 1AXKA 1D0HA 1NA1B 1NXD1 3CJIB 4ITCA 5ERLA 1DGRA 5G05L 5FO8B 5J37A 3RZTA 1RVF2 1AZDA 2C6SA 3PUAA 2MEV2 3THPA 1ZZ6A 3AP9A 2WO7A 3B3QE 1ASJ2 4E8DA 4UOJA 1C8M2 2FDKA 4WM7C 4XUPA 1REDA 1SHWB 3LWQB 4EWEA 2ZZJA 5DUUA 5BPXA 1QNWA 1QEXA 5KHHA 2XHNA 5J98B 2NM1A 2WIIB 1H2KA 1VAKA 1X8EA 2V5YA 1XB9A 1RTVA 2ZXQA 2BGCA 5FP3A 5J96B 3RDIA 3D6EA 3H3VM 1AR61 2V4AA 3E5XA 3VDBA 3JU9A 3CQOA 3ZYJB 2IXJA 2W46A 4W50A 2VBBA 4ARYA 4CEYC 5BNPA 5CIRA 1DHKB 3ZFFB 1NG0A 4AI1A 2R32A 4YGCA 5C3QA 2VNRA 3RSJA 4GJYA 3P3PA 4G9SB 5A3UA 4Q26A 5FO9B 3JB4C 4CPBD 4AFAA 1ZX5A 1N47A 1QKQA 1W9WA 2P5BA 3BTYA 4ET7A 4FTEA 1PVC1 2QQWA 3UV9A 2HLEA 3TWIA 3BI3A 1QF3A 4DEVA 2A6XA 1PK6C 3AB0A 4OUSA 1PVXA 3ZO0B 3MBWA 4COVA 3KYXA 4HOOA 5JOYA 4PF1A 2R041 3T4VA 1VBC1 3H3UA 2CWSA 1VBB3 4HFSA 1UY3A 4UFMA 5FAXA 1LRHA 3T30A 1OURA 4XZPA 3NNGA 5FUNA 4W65A 3VZLA 4MGSA 1BQPA 4ZZ5A 5IW0A 2VW1A 4FPYA 4WVZA 3MUY1 1Y4WA 1QQTA 2VZVA 3S5QA 2VOWA 3GTQL 5LATA 4UFHA 4CDQC 1RUI3 1UIKA 4JAGA 2A6ZA 2YBPA 3H7JA 3H7YA 4PHZA 3SCGA 4YWAA 3ZLIA 4BM8A 1HRI1 2AGSA 3PVNA 4AVBA 2VNVA 4INDA 1H7VA 1XNKA 4XCBA 4XIKA 5GZGA 1HX6A 3WXPA 1PZXA 4JQRA 4Z8BA 2HWB3 3J7Y1 1MS1A 1ZZ9A 1CZVA 1B2OA 1YI7A 3JD73 4J1XA 4JV4A 2ZA9A 3FMGA 5FZGA 4CUAA 2OZJA 2Y60A 4NUBA 2Y8KA 4CEWB 1L3JA 2YROA 1BEV1 4OULA 4FPOB 4ZXKA 1MS9A 1PZ7A 1U5ZA 4XMIA 2P6HA 3A4UA 1NCRA 4GH4C 2ZGOA 4M3CE 4KGQA 1JYNA 2PFWA 4GXLA 4HPKB 4LHKA 5FZFA 4A3ML 1VBB2 2PHDA 3CF6E 5GLWA 1F4LA 1KD7A 1DGWA 1PZ9A 2F6BA 2XOMA 4GWJA 2PTMA 3FUQA 1NLRA 3POWA 5E89A 1B09A 3MW3A 3SCHA 1LEMA 1YNAA 2PXJA 1UMIA 1ND3B 3N3HA 4IV3B 2QE3A 4MO3M 1GOGA 4E2SA 1OFSA 3Q8AA 3MSUA 3MQKB 2W3JA 1IG3A 2VQUA 2PMZP 4BE3A 5JIUA 5DAXA 2A6WA 2BW8A 1GZWA 1RUI2 2O8OA 2HEWF 5EYYA 5BNOB 1WCML 5DAPA 2QNKA 2VMHA 3O12A 3O5SA 3ZKUA 5AN9H 3IZOA 3CNAA 2MHFA 2WA3A 4CP0A 1XYOA 5HV0A 2R063 5CZKA 1R082 5MLC3 2HWB2 4N43C 4TLGA 3JD72 4WV8A 3ZXDA 3ZYPA 3VBFB 5IYBL 2P17A 3MF9A 2DSXA 1SEFA 3VBHB 4W8JA 1Z7S3 2VVFA 2W95A 1QH7A 1REEA 1NA1C 1Q8QA 2IXCA 3CJIC 5H9RA 5FRAA 3FKIL 1C5IA 3O14A 3OEAA 1AJOA 4COUA 2YC4A 4CU9A 5K8SA 3GTGL 3HOVL 1QJZA 1ACCA 1LHOA 4PQQA 3U1XA 1AJKA 2IFWA 1RL3A 1NE4A 3R4UA 4N53C 5JPMB 1WBLA 2PQSA 4NIAA 2ILMA 2R073 3I59A 4LPLA 2E53A 3APBA 2R7ZL 1Y7BA 2ATFA 3D82A 3O1MA 1W6MB 1R0GA 4D6SA 2CL2A 2CKAA 1PO13 2CV6A 3ATGA 3DEMA 3NAPA 1JU4A 3POIA 1RJ7A 4COZA 2EXHA 2Y38A 5IHRA 5E6HA 1AUYA 2R062 1X8MA 5A7SA 2EY4E 3VHRA 1OKOA 1WCQA 5LCWL 2ZMLA 1RB8G 2JECA 1SPPA 3ZFFC 3VHOA 4MVTA 2A3YA 2A6YA 3C7FA 3RJRA 4GAZA 1GYKA 1Z7S2 2XG3A 2VVEA 2D6LX 3DV8A 1U5IA 5FPAA 5K4LA 4AQ6A 2VTXA 5GLTA 4FPLA 1ENSA 2XB6C 3ZXJA 1S0JA 1PM4A 1S0DA 4LEJA 5FZ4A 4BPZA 1UY0A 5KHIA 5AVPA 2QTWB 1LU2A 1PGL2 3N7KA 3ZSKA 1X9TA 2DVFA 2R072 4P9IA 1E5IA 2DCTA 2GMMA 1QJU3 4DXTA 2JG9B 2R0HA 4XMAA 2ET1A 4BQ3A 5K7PA 1YJKA 4L9BA 4FFHA 3CZUA 3N7MA 4XUNA 5EINC 2E9QA 3H8OA 3S30A 1PO12 1W6NA 4LITA 4KBZA 4ORFA 5JR7B 3ES1A 1R1ZA 4NMIA 3JQWA 1OLRA 4CEYB 1NLQA 3B94A 3OPWA 5C9AB 1HRV3 1KS4A 3LWCA 4K8RB 1RUJ3 2QQOA 3FE5A 3ZYGA 5C5UA 3WX5A 3WG1A 2IUWA 3IM0A 4QXBA 1N3OA 5EJ3A 1H8VA 3RS6A 1K42A 3WW2A 1GKBA 4C3HL 1IPJA 4IEVA 4DZGA 3ELNA 2G9GA 5DUVA 2ZX1A 3B93A 1Y1WL 1ZBE3 1AL0G 5HXVA 1QJX1 4EWDA 4QHBA 4CEWC 1RGSA 3I2DA 3OD0A 5CFDA 2Y6GA 1W9TA 2ZGKA 1KFUL 5KC6A 4NJ4A 1TWGL 3QCWA 5A33A 2PA7A 1DP0A 4AGRA 1QJU2 1AR93 2B45X 4F7ZA 2VOVA 1JW6A 4DPNA 4HVQA 1FHMA 4IV3C 2W9XA 1ND3C 1V6LA 2M6PA 4UFLA 3WCRA 1FMD1 4D0QA 4LO8A 1TG7A 1W06A 4QX5A 4R4XA 3AFKA 4E4DX 2LUWA 1HRV2 3OGSA 2G4IA 3H9BA 1RUJ2 1TME3 2WS91 3GGLA 3SEPA 5BNOC 5CISA 1NY72 3ZN4A 1V6NA 1XE7A 1O7FA 3BPSA 3R4DB 2WBKA 4PI0A 1Y9GA 3LA3A 4Y33A 4MGQA 2L0ZA 5IP7L 3S15L 3M8LA 4X6RB 4WVMA 5JXJA 4K9SA 2HVYC 4BLIA 2LS6A 1UQXA 3BIEA 5F3GA 5GZFA 2ERFA 5FZOA 1ZBE2 3HAGA 1X50A 2GALA 3VBFC 3ALQA 2A6HD 1W05A 2TBVA 3AMHA 4HZFA 3LD8A 4QM9A 2RDSA 3VBHC 5FPBA 4WM7A 1RITA 3AKTA 3NNJA 1M4WA 3DKQA 2AH2A 3RWNA 2G9ZA 4M01A 3OGJA 1D2SA 4KU8A 3J9SA 1AR92 3ZX7A 5JWPA 2BWAA 3PL0A 4UW5A 1IS5A 4LA3A 3BKZA 3MIBA 4XAEA 3ZIWA 4OQ8A 3SLIA 2BVVA 4ATFA 4LK7A 2Z69A 1RUOA 3H1MA 2NP0A 1YIFA 3RZKA 3HN1A 5M5XL 1TME2 1ZRDA 1QJY3 4CUGA 1LOFC 3PIJA 2HWC3 5AC93 4E8CA 1T9QA 2MS3A 5LASA 5DDJ1 3UKVA 1Z92B 1SLIA 2E7TA 5LB6A 3C8XA 1E8JA 3KD4A 2XJRA 4PLNA 4YW4A 5FMCA 3KV9A 2VMEA 5FZBA 5IK5A 1CAUB 1HB1A 4IE4A 1VBE3 1KDKA 1PK6A 2J22A 4QXKA 3WNNA 1X36A 2TNFA 2W91A 3MW2A 3KV6A 2B39A 1KDMA 4MGZE 2ZMNA 1LU1A 2WS93 3VN4A 1ZZCA 4UXAA 4FSJA 5C8WA 2ZHKA 1DYKA 4MXWB 1OKQA 5FXXA 2WR9A 2G1MA 4P9LA 2VQAA 1S0IA 2E32A 2JG9C 4OVEA 5JIAA 4CDQA 1COV1 2Z2SB 1QJY2 4C3IL 2JA8L 1E5HA 4UY81 1H2LA 2ET7A 3UKNA 1CAXB 2HWC2 5A6QA 3E6DA 3KLSA 5AC92 3VD5A 3SITA 3MDPA 3P1IA 3SCFA 2OUJA 1YQCA 2VAUA 2Y6LA 3LQCA 1W2AX 1UYYA 3KS7A 1GWLA 4FPJA 4LBJA 2QVSB 2A3XA 2R1DA 3GBFA 2MNGA 5EFUA 5C9AC 1MS4A 4AVTA 3HPNA 1BJQA 1J83A 4AEJA 4AE2A 4Y20B 5HCFA 3MPBA 2H0BA 2W47A 1SMUA 1WBFA 1VBE2 5FLIA 5IWFA 4BZ4A 3CZJA 1XRUA 3BU7A 4OI2A 2A1XA 2JI1A 4GH4A 2WNOA 1RWDA 3GHMA 1HB4A 5GJ6A 3TRSB 3E5UA 1DDLA 4GWNA 4XACA 3J7Z1 4DS0A 3ACGA 3VBRB 3BU0A 4X8PA 4A7YA 4A3LL 3MI8A 5C3EL 4BBRL 1LKNA 4V1PA 2IWGB 2DUQA 1NCQB 1S30A 3LKJA 1W2OA 3N9PA 2B4KA 2BE5D 3H8UA 2EIGA 1SBEA 4DMIA 2DUPA 4AL9A 4HLTA 1R1A1 3FBYA 2H12A 4Q0PA 5A7NA 3PVBB 3LB9A 1HW5A 2NVTL 5JPNB 1ND2B 5K2ME 4MGIE 3T0BA 4JGZB 1BXHA 3AL6A 2ERSA 1UKGA 4JRLA 3OPZA 4NVPA 4N43A 1Q8SA 3GTLL 4TLFA 4NHMA 4Q8LA 3HAXC 3RMXA 1JYBA 2P3KA 2YXSA 1TE1B 2VZPA 1V6KA 4D7TA 4MUVA 4B1LA 2VZQA 2V5DA 4JKKA 1NA1A 2D3PA 3CJIA 1O8PA 3KYWA 5FREA 3AP6A 2VJXA 2W1WA 1CAWB 3BIWE 4XQ4A 4U2AA 3RVHA 3K48A 4EN7B 4E27A 3F2ZA 2P1BA 1RXFA 3IMMA 2QQKA 4HG6B 1TVGA 1I6XA 2OT7A 2TUNA 4N53A 5EV7A 4YW1A 5FJKA 1H1AA 4CU7A 1APNA 4O61A 2HJIA 3J8F1 5LBFA 2YU1A 1I3QL 4I3GA 5C8CB 2YB7A 1RMU1 4M0HA 2ZEWA 4AI8A 4OZOA 1SFYA 5F1RA 5J09A 3GJBA 3HQUA 5FP7A 2QZ2A 5JI9A 3LNLA 3LFMA 1W8UA 5FZ1A 1A3KA 5IVCA 1HKDA 3NRUA 2HWE2 4XILA 1AHSA 2V09A 1UYZA 2VW2A 4IGPA 3ZFFA 3I8TA 1C1FA 3J4UH 2RDVA 1CN1A 3K3NA 4O7XA 1W6OB 4AYBP 2AEYA 2ARBA 4FO9A 5ISLA 2DCYA 3HNMA 1O8SA 2DVAA 4L2NA 4IV1B 4RQPB 3MFCA 1HLCA 2DU1A 1CIWA 3AMNA 3OUHA 3ME2A 4N7IA 4BQXA 4F3JA 3T0DA 2X10A 3Q8CA 3MICA 1CONA 3NFPI 2CSGA 1WW5A 3DXUA 3KCCA 5FIXA 4AXOA 1LB2A 4A3CL 2HYKA 3N9NA 4RHV1 4COWA 4L11A 2IVJA 1B13A 1N1YA 2JE9A 2IC1A 4WVWA 3VKMA 4YM3A 5J36A 4LIUA 4I30A 4ZKTB 3KYUA 3H1YA 5JSRA 4PIXA 2OW4A 2JDZA 2B8MA 2Q5TA 3T08A 3PO2L 5J7MA 2QQNA 1MS3A 1ZRFA 5FTTC 1VZIA 4LKDA 1WLCA 2AUYA 1ST8A 3BN6A 1FV2A 1RMU3 2GP3A 3GHNA 2W52A 3WF3A 2BV4A 2OPKA 5CVRA 1AR73 4RGAA 5A3WA 3LE0A 2BBAA 2ZOEB 2VMGA 2JI2A 4CEWA 2VNGA 1FAYA 3UKTA 5KXCA 4TZDA 2BZDA 2HKXA 3LSDA 4K9FA 1J58A 4MHRA 1LGCA 3OGGA 4P9GA 2CKCA 2YC0A 3UJQA 4AVSA 3O1PA 3VKFC 1FXZA 1IQAA 4HPKA 3LOIA 3WEZA 4FBFA 1NLSA 1KRIA 3VBRC 4BQ2A 2WNUB 2P37A 1VBA3 1EAH3 2J7MA 4IV3A 1ND3A 1ULOA 2WT1A 1NCQC 1FX5A 1S2KA 3O0XA 4OUEA 5IK8A 4FTBA 1FPN1 2CNAA 1LECA 3WY6A 3FLTA 4Y1VA 5L73A 5FZLA 1BZWA 4A3GL 5BNOA 3ZYRA 1YYNA 1LHWA 3L2YA 2LCQA 3LDBA 2YGLA 1ND2C 4D6QA 3WD5A 3WP5A 1VALA 3W20A 2XWJB 1FNZA 1UPSA 4JGZC 4KGGA 1RMU2 1SLTA 3ETPA 5JUVA 1JZ8A 3I4ML 3AKQA 3GM8A 1QY4A 5CKMA 3N9MA 1AR72 2UYBA 1HV1A 2QDNA 4MGYE 3CQZL 3VBFA 5LY2A 3KGLA 1RUF3 3VBHA 4A7KA 1GQGA 4EV0A 2I74A 1UPIA 2ZEZA 3LFIA 1XNAA 3EYPA 5LK5A 5FPXA 1K5MB 2I45A 3PKJA 1PFUA 1T6GC 5A3TA 3U4XA 4NWVA 4LLOA 3A23A 5F2WA 1TMF3 1W9SA 1MEC1 4QQ2A 1C8NA 2NVXL 1VBA2 1EAH2 2NPIA 2VOTA 3LEIA 1UMHA 4HBNA 2WZEA 1BQ9A 1QWRA 3H3ZA 4IUGA 4YG6A 4YSFA 5IVBA 5C8CC 5HBAA 4RGKA 1C28A 2HBUA 3PUQA 3T2OA 2VCBA 3VDAA 3H9AA 1XYNA 4QX8A 1W6MA 3U10A 4AEMA 1LOFA 1W04A 1GOHA 5FXVA 5BYNA 4C91A 3FBMA 3VDCA 2GC3A 3FLPA 4FI9A 1XQNA 3MGUA 2ZAAA 2WO1A 4JX0A 5F39A 1W3VA 4D69A 4DUWA 2XPJA 4ZU7A 4LLFA 2QBXA 2VO5A 3GBWA 3VKNA 3ZN5A 2D6NA 1RUF2 1QQP3 5M5WL 4Y5SA 4AYUA 4F83A 4Y22B 4QXCA 3C7OA 4AGVA 4IV1C 4RQPC 5IVJA 3MLKA 1AX2A 4X6QB 1CQ9A 1UZVA 1VBD1 3H50A 2FMYA 1GR3A 1QNYA 2K2SA 3TBDA 1TMF2 1XNDA 3OBTA 5F5CA 4Q0SA 3S1ML 4AG4A 1G9AA 5FUIA 2BP6A 4Q4X1 3RRDA 2WJSA 5KC5A 2IXIA 3H97A 2JG9A 2B5ID 3TEZA 5FZ7A 5IYYA 1D0GA 1K45A 5GAGc 1A8DA 2NYYA 3JBG1 4E9KA 3N35A 4IE0A 4QQPA 3VUOA 1R0IA 2V72A 4Y4YA 4XF0A 2C24A 1S1AA 4QQOA 2FDFA 1AR83 4CEYA 1NE6A 3EXUA 1WW4A 4G4FA 4MX3A 5C9AA 1CJDA 2C9AA 3PZAA 4HKWA 1MEC3 4K1YA 4BQWA 3G6JB 1YK4A 1F9KA 1SMWA 2ZGSA 2PYTA 3ZDVA 4E2GA 2UY8A 1K12A 5IYCL 2DVBA 2O8QA 2D6PA 1RUD3 4W4ZA 5GZDA 1QQP2 3VHNA 3LF7A 1GV9A 5C3PA 2PVEA 1JH5A 3ASIA 5C4JL 3RZ6A 3NJVA 4MH0E 4EQVA 3ZG6A 2E31A 2OIIA 3WDXA 3ACHA 4AF9A 4LK6A 2ZEXA 2VQTA 5TSWA 5CG9A 4OHWA 1VE0A 1JODA 1WGPA 5LW9A 4YG0A 3GTPL 5E16A 5FYSA 3NNFA 4YRDA 4CVUA 3CIHA 3P5BA 1AVBA 4PBPA 2JENA 1QGLA 3ILRA 4I01A 3U37A 1QCVA 1RVF1 2OQ6A 5A3PA 2GMPA 4AI2A 2MEV1 2WNUC 4LJHA 4MADA 4XC9A 4YGBA 4GB33 5FZEA 1ASJ1 2PSMC 1KQRA 1UY2A 3GF6A 1AR82 1C8M1 2BVBA 3WZ1A 4Q1RA 2DTWA 4HETA 4QD2A 4SBVA 1QXPA 3O7OA 5DUWA 1F5FA 1MEC2 3R0RA 1OQEA 2RS13 4META 5FZ8A 4AFDA 3VKLA 1RUD2 1TWCL 3I3QA 3AP4A 4XJ9A 1Y9MA 3AZVA 2VPVA 3PDQA 4BH9A 5A3NA 1WA4A 2GP5A 2NN8A 4UFJA 2Y6HA 3ORJA 4LO5B 4BISA 1O5UA 3DCQA 1URXA 5MFZA 3LA2A 3O0WA 2JEMA 2YPDA 2KM2A 4JHTA 1U5XA 4M00A 4A45A 1VRH3 2ZX4A 2BDRA 2XDVA 3PNAA 2B63L 3IMNA 5EHDA 1U0AA 1K5MC 4QM8A 3SMHA 4LBNA 3GBGA 4DUVA 7RXNA 4OZXA 5BY5A 2RM23 5JZGB 3KYYA 2ES3A 2P3IA 2ERJA 1OF4A 5HXMA 3WWNB 4GB32 2R92L 2BFUS 2PHXA 3CLPA 4R4ZA 4A4AA 3S5AA 5L19A 1QIQA 1CR7A 1LR5A 5JDBA 1R091 2VMCA 1IKQA 2QZ3A 1ULEA 1NX9A 2XUEA 3PVEA 2RS12 4K40A 3ZPYA 4CUCA 2EXJA 1E5RA 5I0RA 2QDRA 2E51A 2UY9A 1UZ0A 3M3IA 4XDQA 1AYN3 1IHMA 1V6OA 2NLRA 2D43A 3BVCA 1X82A 2ZACA 1GZCA 4IETA 2VZTA 3IWZA 2P4EA 4Q4W3 5F6LB 3OBAA 4QKFA 5JMCA 1CAUA 4YM1A 1BE7A 1VRH2 3ETQA 3RPQA 2XWBB 2C6BA 1H30A 5JXHA 2RDQA 1GNHA 4MLOA 4AVCA 1ZRCA 2RVAA 1HN0A 1LULA 4LXLA 4ZN3B 2RM22 4MXWA 3ZSJA 2RR13 2WINB 1LAJA 1C4RA 3SS2A 1DQ4A 4MG2A 2BNNA 3BOWA 4IDZA 2XXZA 4YM2A 4JAFA 2ZS6B 3PJYA 5LWBA 2CDPA 1VBB1 3H9CA 1CAXA 4IGQA 1W39A 2GN3A 1O3RA 3CBNA 4XQWA 4Q4V1 2ZGLA 3QQCE 4NN0A 5FOJB 3R05A 5I0TA 4EN0A 1AYN2 4QT6A 2EIDA 1YQ6A 2GSYA 2WO3A 1UX6A 4Q4W2 4Y20A 2D7FA 5HPOA 1UN1A 4CCMA 4NPRA 1GWKA 1RUI1 2JWPA 4Q1PA 1GICA 1R093 1SZBA 3BPZA 3U0ZA 2FQPA 1GZ9A 2RG4A 2OQ7A 4P08A 1G9FA 1O6UA 3UL2A 3HWJA 3FFZA 3QBQA 4IEUA 3VBRA 2P3YA 1R081 2C5DA 2FZ1A 2EXIA 2HWB1 1IS6A 2XGXA 2J1EA 3JD71 4WVVA 3LGRA 1NCQA 2RR12 4E4ZA 2WYSA 5JOZA 4YW5A 2GN7A 1DQ1A 1WLTA 2AYJA 2F4PA 2ZX2A 2VD7A 1IROA 3BOPA 2JDMA 1BBT3 2VUAA 2DTYA 1V0AA 1I5PA 4XFIA 1W3XA 2RS53 3WF4A 2C0ZA 3EO6A 1CGPA 1ND2A 2OUHA 2ZGNA 3NKTA 3SQOA 1PMHX 4JGZA 1Y1VL 1R0HA 3AKSA 4FQ4A 1U12A 2DBNA 4OI1A 3LAGA 1W8OA 1YV1A 4LUMA 2XVGA 3MLLA 4AR6A 2Z5WA 4RSUA 2J1AA 1IPSA 4P9YA 1ULDA 5KXDA 3E5QA 3U14A 1F8VA 3DL3A 2OZ6A 1T2XA 4P14A 3VDDB 1BYHA 1JZ4A 1R092 3OGVA 4XTPA 3KYVA 1UOBA 1SFNA 4KL1A 4PCRA 3NL1A 3VZMA 5CBLA 5IVFA 1BK0A 1CAWA 1YI9A 2XBO3 4ZS2A 4DB5A 1LHUA 2A75A 5FYYA 1OHFA 2DCKA 3DXTA 4CDUB 2R061 3USSA 4AHXA 3J7LA 3NV4A 4HMZA 4Q4V3 1BMV2 3KCYA 3RYGA 1OA3A 2QQMA 3Q8FA 1CX4A 2GNTA 1KJLA 3VBSB 3WVJA 4EE2A 4Q8KA 5C8CA 1RUG1 1Z7S1 2WRAA 3PJQA 1BBT2 1BK1A 2GAUA 3LEKA 5JZGC 1JZ3A 2VZRA 2WQZC 2D3RA 2RJLA 2RS52 1OBNA 2R16A 3UGFA 1NYWA 2V73A 5DG1A 3QACA 2A7AA 3WNMA 4HL0A 5A80A 2K9ZA 1PGL1 4QQLA 1OFNA 2FCTA 4NRMA 4ZU4A 1R083 3D0SA 1JXNA 4S2FA 5A3MA 2R071 4ISRA 1BKZA 1Y43B 2X09A 4KBBA 1W8NA 4M4PA 4W6WA 2XR4A 4XFCA 4CE8A 1HXS3 2QQJA 2W08A 3IU3I 3B69A 3BODA 1KXGA 4QX1A 4BIFA 1HIXA 1W6OA 2Q8EA 5AI3A 4V196 2XUMA 1PO11 3VB9A 1H4HA 4IV1A 4RQPA 4R9CA 4YVWB 2XBO2 1FV3A 3S7IA 3WG4A 3I49A 4RFRB 2WLQA 4CSWA 3WNLA 1DF0A 1FOD1 1JHNA 4Q4V2 3U4SA 2B9VA 1W6PB 2HWD3 4KG8A 1SDDB 1UZWA 2PYAA 2RDRA 3FX3A 1IOAA 3LA7A 4Z92B 4AHWA 2CAVA 1GP5A 2ZKLA 5JVH1 1YIPA 5EXOA 4WM8B 1SLBA 2E7QA 1GFF2 2D5HA 1OPOA 4UW4A 2OVUA 3USUA 4YW3A 4P9XA 4QGMA 4QMAA 2AZ5A 1GLHA 5LA1A 3IKWA 1CX1A 2ZIXA 4QB6A 4L8QA 1BVP1 1S2EA 3ZVXA 4AAXA 1T6BX 1MZEA 2HBTA 3ZR6A 3V56A 1QJU1 1VAVA 2GNMA 4XUOA 5IVYA 1HXS2 1JMUB 1RUG3 1V70A 2J9UB 4B8CD 2Y64A 1LESA 3POFA 4IESA 1FT9A 4QB1A 4XOGA 3RZOL 3W59A 4CYDA 3VL8A 1WCDJ 2W94A 2WSVA 4A93L 1D4M3 4XUTA 4Y24A 4LE4A 1VPHA 1HRV1 3A0KA 5GLUA 5CNAA 1RUJ1 5AVAA 5FP9A 4ZY9A 3MO4A 1NY71 2HWD2 1JUIA 2E2JL 4FFFA 3ZSMA 4IGOA 1TNFA 5ANNA 1PFVA 4XW3A 3RI8A 3WP4A 5J48A 1QJEA 4Y1YA 2WN3A 3TYJA 1GWMA 1CD3G 2WNUA 1NQDA 2VMDA 1ZBE1 1VB2A 2BFUL 3ZDSA 4DOUA 5BUVA 1US2A 3IB3A 4ES9A 4BY1L 5FJHA 2Y33A 2WN2A 1FOD3 4YWMA 1VR3A 2W92A 3Q9OA 2CAUA 3IT8A 4QHZA 5DABA 1AR91 5I91A 3HVDA 2XQXA 2Q30A 3POSA 4XXPA 1RUG2 4QPGB 2V0EA 5H9QA 2VCCA 3DPRB 4KMQA 2RJKA 1G9DA 2CU5A 3IDBB 4OI0A 4IEYA 1N1VA 1D2QA 2QKDA 4DFSA 1D4M2 4EN6B 5KR7A 2EXKA 3K4AA 4YM0A 3VDDC 2ZHMA 1I5ZA 1TME1 2M4VA 4PF5A 3OD4A 4C90A 4NHLA 1H6YA 3BTAA 2Y0OA 1W2TA 3PVOA 2VZSA 5CYYA 1K5MA 3ZN6B 1VRBA 1SCRA 5C44L 4CDUC 3KVAA 3NJZA 1KJRA 4I0WB 1H9WA 2Q1MA 3N7LA 5CKQA 1ZRIA 1Y3TA 5A7OA 4EZ4A 5LK7B 2WFPA 2ZABA 4V2WA 2AEZA 5D8AB 4A6OA 1GSLA 3VBSC 3IBMA 4HK9A 3NSTA 5F6KA 4YPJA 1XXNA 2C6AA 5A1LA 5DZGA 5J1XA 3ACLA 1FOD2 3HKZP 2BEOA 4PBOA 4QXHA 2OA2A 2W0XA 2Z79A 2A3WA 2VQ0A 1RUC3 2XHKA 3HBKA 4KQ7A 2WWSA 2BJSA 2VZ1A 4NAOA 2KXLA 4XABA 4FAHA 4ASMB 3EMRA 5EJZB 5BV6A 2LM3A 4B4RA 1P8JA 4CPBA 1ZBA3 3OOXA 1UNBA 2YGMA 2JXAA 2NMNA 3CJXA 3PURA 5T5OA 4P5YA 3V65A 2W2IA 4B3NA 5KXEA 5HCAA 3FHIB 2VCAA 1J3QA 3KWVA 4C1WA 3PMSA 5HV4A 3KT1A 3SH4A 1HJGA 2OXBA 1MPXA 1MZ5A 1QJY1 4P02B 4X8NA 1DQ5A 1DQ0A 2HWC1 4Y22A 5AC91 2O14A 3B9IA 5DAVA 4YVWC 2AACA 1LOGA 3E6BA 3LCPA 4XJ8A 3X29B 5BXXA 5KWRA 1ENQA 3GXUA 2RE9A 5FPVA 5DAWA 1VMFA 4BMBA 1OD3A 1VBE1 4O65A 1O4YA 1C1LA 3VZKA 5JOXA 3GJAA 5FDBA 2YBKA 5FYBA 4BB3A 2CGPA 2FD8A 2R1BA 1UWWA 5FBZA 4Q0VA 1RUC2 1AYM3 3C3VA 4WM8C 3VZJA 3WQ0A 4LQRA 3K7AL 4DQAA 1LKOA 5JLVA 1HQWA 3I7DA 1YFYA 4XBQA 3T1LA 1ZBA2 2R30A 3LIGA 1D7PM 1CAVA 5H9PA 4LIVA 1DBNA 4J1WA 5F5IA 2J1SA 4QDQA 4C0BA 1TWAL 2G9FA 2AUSB 1RUH3 2QCSB 3C2UA 3AVSA 5T5LA 5IVVA 2YV8A 3OY8A 1MQTB 1CVNA 2WA4A 4V2VA 3ZSLA 1WLDA 1XE8A 3LEMA 3LWPB 3B0AB 4EWAA 1D4VB 3K51A 4BA6A 4XXAA 4YARA 5AFBA 3DUIA 5M5YL 5IP9L 4IEOA 3T0AA 5FYIA 4BK4A 3G7DA 4H3WA 1W0NA 5A6ZA 3WUCA 1QDOA 1V6JA 1XC6A 5FZ9A 1AYM2 4PJYA 4LBQD 3B00A 1UZYA 1SLCA 3OBZA 5JSOA 3PLQA 1UX7A 3GZAA 3OG2A 4ZU5A 3POYA 4AGGA 1STMA 4LUKA 4NPLA 2LW8A 4XF9A 4GULA 1AX0A 2ZBJA 1T9PA 2HEVF 1X7NA 3ILNA 3NV2A 1XJAA 3KT4A 4FOVA 1RUH2 4QHOA 1O59A 4GD4A 4QPGC 4JRAA 3DPRC 2P6CA 3RYRA 5A70A 2VVDA 2FHRA 3AKPA 1LOCA 2PHWA 4FCAA 2HWE1 2WZR3 4ONUA 2WLPA 2BPA2 4KWUA 1BVVA 4ISQA 2EAKA 1EUTA 1OT5A 4XFAA 2V0FA 3KV5A 4OYUA 3HD8B 3GCWA 3RNSA 3GZEA 4AWDA 3SISA 1SDWA 3KQ4B 4TVMA 4BQ1A 3T1MA 5JZGA 3V0BB 3DECA 3VZOA 2LROA 4CDWB 2W1SA 4JADA 5D8AC 1IU5A 3VBOB 1XPWA 2ID4A 2YBSA 1VCXA 2PAMA 4QU1A 1J59A 5MF6A 1DFQA 2VOXA 4RXNA 4JGYB 1KEXA 2YYOA 2DU0A 3HOXL 5C3SA 1LGBA 3WHTA 2AC1A 2IVIB 5FMOL 2VL4A 3DKWA 3FJSA 4ZPIA 1UU4A 4NHYA 2H0VA 3H99A 1H8TB 2JI3A 2JD9A 4IW3A 4EYUA 2WZR2 5JSPA 1ZREA 1NXMA 5HCHA 5HCBA 3RMYA 3BYWA 4TXWA 4YWLA 3ZMNA 4IXLA 3VD7A 5GLZA 1DGWX 1GU3A 3TNPB 2HR5A 3Q8BA 4BOWA 2QL0A 4OI4A 1DQ2A 2DF7A 2ZGTA 1ENXA 2K46A 4K1ZA 3SC7X 1VZHA 1A6CA 4CU6A 3SKJE 1F5JA 2HWE3 1PGW2 2DCZA 1R9TL 1POV3 4FOWA 8RXNA 3FC0A 1PFWA 4NROA 4YVSB 2ZX3A 3M2MA 4M3CF 4CCKA 1CESA 4XF3A 3NNLA 1XNCA 4ZN1B 1BCXA 4AK3A 3SEEA 4D8MA 3EQEA 2CYFA 4UW3A 1J1LA 4J25A 2VCMA 4AW7A 1UXXX 1KGYA 3HOYL 2SLIA 2XKOA 3BALA 5C7GA 1SLAA 3O1VA 3TNQA 4HKOA 3N36A 4H7LA 1OA2A 2ZZQA 3MLJA 5I93A 1R64A 4LBKA 3MIGA 1MQTC 3AZWA 4BWOA 5D1IA 3HOZL 1QOTA 2ADDA 3KT7A 5EJ1B 2ZGUA 4CCLA 5B2GB 1DLCA 1QXRA 1AR71 3EJKA 1UY4A 2OPWA 3ZXEA 1VAMA 3GDBA 4JHZA 5FQ0B 3MIFA 4A3BL 4OLLA 5FYCA 4D3WA 4LNVA 5IY0A 3I3EA 5FZDA 4LT5A 5C3RA 2Q8CA 1SMVA 5F32A 2R7EB 3B9CA 3FL7A 3NKGA 3ZR5A 1VBA1 1EAH1 4CXXA 4YYOA 2QQVA 1GMMA 3RZDL 4A3DL 2WKKA 5K0UB 4BQ5A 4XIOA 3UJOA 4AQSA 4DXZA 5LA2A 2VL6A 5LBEA 3A0NA 2JDAA 5DDJ3 3VDDA 5AFEA 3PWFA 1OQ1A 2XJSA 1JS9A 1UW8A 1Q43A 5GKAC 5C33A 3TAYA 2JB8A 4GKXA 3BTZA 5D21A 1W8HA 4MGKE 4CCJA 2ORZA 4CDUA 1DQ6A 2WQ8A 3HBZA 2N7GA 2VBPA 2VY0A 5KXBA 5LEJA 3AL5A 4Y1UA 3M3EA 1PMIA 3PIGA 1PX4A 3VBSA 3WSOA 1RUF1 5FK7A 1HQNA 3VD4A 3PL5A 4Q27A 4K20A 2D98A 5FPZA 3ILFA 3IDEA 3NV1A 2Y26A 3LPGA 4CDWC 5T55A 4LKSA 3ZYHA 4CCOA 1TMF1 4YLZA 3HMYA 2E2IL 3FDJA 1FYUA 1MZFA 2HEYF 2WQ4A 3VBOC 4R9AA 3J7HA 3VD9A 2X53S 2ZGRA 4JGYC 4QGNA 5FY9A 3ZFEB 3LPFA 1RDVA 2VXRA 2I07B 1YHFA 4RS5B 4AHYA 3JR7A 1GZWB 1YQ5A 4E6YA 4GJZA 4XYXA 5DDJ2 2PAKA 1OC1A 3A7QA 4UFKA 4ZONA 4IQPA 1Q56A 1JN2P 1TQ5A 4YVWA 3WP6A 1RJ8A 4CP1A 2B42B 1YFXA 1CADA 1H8TC 1W03A 1ZM1A 3TB0A 3KHBA 2BRTA 1UCXA 2J1UA 2PHRA 1W6PA 2JG8B 2CR8A 5FZ3A 3WQ7A 3S1NL 1QQP1 1OI6A 1S24A 4KWLA 2KN9A 5FP8A 1I6HL 1BRFA 4P9WA 4BHPA 1SCSA 2KA3A 3M3OA 2PAEA 5IK7A 4WM8A 1IQDC 4Q2FA 2RFKB 4PQ9A 3BB6A 3ENRA 3IAQA 4Q4Y3 4URTA 4MYEA 3FWEA 5FLJA 2VZUA 5KHJA 1AXZA 1IKPA 1WCUA 3H3LA 1GNYA 4NHKA 2XJVA 4A3XA 4C3JL 4HXCA 5KBFA 3QH6A 2V3BB 1PM7A 3AM2A 4YVSC 4UBHA 5GZEA 3BTXA 2EF6A 2XVKA 5D2AA 5GLVA 4BDVB 5T54A 4YW6A 1ZA4A 3R4SA 2VUCA 2WNEA 2VUML 4YW7A 3MW4A 1Q8PA 1AR81 5FYTA 1NAEA 3FLRA 4CCEA 1F35A 2D44A 4QKBA 3IPVB 1W0PA 2GH8A 1PHMA 1QXJA 4XCAA 4Z82A 4NWWA 1F31A 2PLV3 5FZ0A 4U671 1WD3A 1RUD1 2VR4A 3KB5A 2B7YA 2BQPA 3AVRA 5HI0A 1HQLA 5F9TA 4LKEA 2G19A 3ITQA 2WFF3 4AR4A 5DZEA 1VMHA 1O3SA 4Q4Y2 3HOWL 4IE6A 3J7MA 3I4NL 1TNRA 5AI2A 3S2DL 3GTML 3VD3A 1W2NA 3AYEA 5L9VA 1QOOA 2P3JA 2A6VA 2RS33 4JVAA 2PMWB 3DPRA 5JCTA 5JR2A 4GB31 3U78A 2QQUA 1O91A 3WG2A 4CU8A 5JAXA 2AREA 1DLLA 2ZMKA 5C4WB 1W9FA 3OUIA 3I2IA 4XZUG 4E2QA 1F4HA 1YQ2A 5K0UC 3NJYA 1H6XA 4BJ0A 3OF1A 1EYBA 2RS11 2Z3RB 1ZZ8A 2ZAHA 4FOYA 2PLV2 5LBBA 1DCSA 2X8KA 5FWJA 2DVDA 4YFZA 1LTLA 2D97A 1VZGA 4UT5A 3WDVA 4Z1VA 1US3A 1UXZA 2WFF2 4QWNA 5A6XA 5CU1A 5D8AA 5L9BA 4A2UA 2EVXA 2DYCA 4ZHNA 1CZTA 4XFGA 1VRH1 1MZ6A 1ULPA 4K3UA 2GC2A 1QYBA 3IIIA 2UU8A 4QGLA 4EJRA 5A6YA 3I54A 3TEXA 4DY3A 2VNOA 5DPNA 4GMP3 2JE8A 1LOEA 1Y9QA 1UO9A 2RS32 1JYWA 1G8WA 2ARXA 3ZMOA 2VC9A 1LJ7A 2RM21 3KCXA 3MV01 3M1HA 1W6QB 3QD6A 4HN1A 4CTEA 1E57A 5ACA3 3ZFEC 4RD7A 4TPUA 1ZZBA 2K0GA 1IPKA 1GQPA 1NXGA 2HH9A 2JX9A 4FT8A 5JVG1 2JKXA 1ALYA 4RS5C 4XJWA 5G04L 5FZ6A 1AL23 3WF2A 3AYCA 2ZCWA 4BXFA 4AI0A 1YRZA 2XVLA 3POJA 3ON7A 3WINE 5E1RA 3MFAA 2QUOA 2Z42A 1AYN1 2VH9A 4Y5Z0 4N9HA 1Q8VA 5A7WB 2FDJA 1GZTA 4Q4W1 2JG8C 5FPLA 1QJFA 5ABJB 3HJRA 3VBUB 4JKLA 2LALA 4A44A 5CG8A 2DCJA 2WDBA 1ULGA 3I2KA 3VV1A 5IAXA 4XF1A 4XAAA 4UF0B 3RWKX 3AZXA 3NMBA 5FMBA 1MS0A 5LEKA 4QDRA 5K9YA 2XONA 4N90A 2YU2A 1XNBA 4PT6A 2RR11 3GNEA 4AFCA 4R8HA 1V00A 3K35A 2CDOA 3WQBA 4BQ4A 5ACA2 4XFFA 1SLLA 4B8EA 4CRQA 4JAEA 3GALA 3K77A 4SLIA 5FYVA 1AL22 4G3YC 4Z07A 1DU3D 5A32B 4MHUA 2FMDA 1MQTA 4GWMA 1JOPA 2Z4FA 3CEWA 2ZKNA 3D8CA 3KF5A 2J1TA 4FPKA 2RMU3 1W8ZA 4D7SA 3MHZA 2CGNA 2VUJA 1TWHL 2GNDA 1L7RA 4FXGB 3T2QA 4NHXA 2Y34A 4QX2A 5T5JA 3NNMA 4BU2A 5JI7A 4GS7D 3J26N 4Z2AA 3WDUA 3AZZA 2D3SA 5DM71 4Y1XA 1V6IA 2D6OX 4XJAA 3VPBE 3U07A 1O3TA 1BMV1 1RUE3 1VB4A 2ZHLA 4BYYA 4OUMA 1S55A 1R0FA 2JKBA 3I2JA 3PMEA 3E1F1 4UWDA 3T4HB 4XUQA 5L36A 3PU8A 4TN7A 2Q4SA 1BBT1 3FN9A 4LBLA 1JZ5A 3H0GL 3ZXAC 3CDZB 3ZKYA 1WKYA 4XDOA 1NUKA 2RS51 3L9JT 1S0CA 2BNOA 4I02A 2HWF3 1SBFA 4QB2A 3AMPA 4A6SA 3I3BA 2EALA 2RMU2 4B7EA 5DG2A 4QX7A 4UI9L 1UOGA 2VULA 3RZZA 2QQPA 3CL1A 2W39A 2WSUA 4FVVA 4IEQA 5DM61 1O3QA 3WNXA 1OUSA 5GALA 1O5LA 2JD4A 2F17A 3V0BA 1H9PA 2XBO1 4CDWA 1FATA 1JBCA 1RYQA 1RUE2 3VBOA 1TEIA 3TN93 4JGYA 1ODNA 2XL7A 4TYSA 4COYA 4JCKA 1WUVA 4QX0A 3ZPOA 4F8AA 5EIOC 3C7EA 1I50L 3DF0A 3H0OA 1P7PA 1CWPA 2HWF2 1ULCA 5C5TA 2PELA 1L7LA 5I0UA 1WMEA 4KH9A 1H8TA 5I0SA 5LZ6A 2VZ3A 2NMOA 4I3PA 3OPTA 1CPNA 5MGNA 1MS5A 1JZ2A 3IDAA 3WW1A 1IG0A 5B4XA 1XYPA 1HXS1 2ZPXA 1ZRRA 5IFTA 1PIV3 4CP2A 4JKMA 5I8TA 1NZCA 5FMDA 1ZRPA 5EZWA 3UGGA 2GMEA 4Y3OA 3B01A 5FYZA 3H8RA 4QPYA 4HVOA 2DFCA 4OCTA 2YHJA 1LKMA 2XJPA 3PKIA 2O1QA 5GADc 1RHI3 2X5IB 5ABJC 4N53B 2XQRA 1NKGA 2PHUA 3VBUC 3N4MA 1NT0A 4LOTA 4AAPA 4MGTA 2HWD1 4FP2A 3TN92 4ZS3A 1FHHA 4BXSV 3JZVA 4YVSA 3MF6A 2PQQA 4BLJA 3P2AA 1EV13 1JZ7A 5L7OB 3MIHA 3URFA 1Z0HA 1ULFA 3OEBA 3B5LB 5DN2A 5BNNB 4GZ9A 3LPEB 4BBSL 5FJ8L 2QQLA 3IDCB 1OLQA 2BBVA 3UNPA 1V9U3 4CA9A 2WUHA 1T9OA 2Q0AA 3GZTB 5FKBA 1WMDA 2JDKA 4CCNA 2Z3QB 2DWRA 3V0AB 1DG6A 3HQRA 4XF4A 3PUSA 3I2HA 3MPSA 4AHZA 5FY8A 1PIV2 4AI9A 3AP5A 5M3FL 4JZRA 1UY1A 5IJRA 3QVDA 4JC1A 1NQJA 4AZZA 2Q8OA 1H0BA 2ZGQA 4HN0A 1PO23 4YZ5A 2XJUA 1D4M1 4TWTA 5FQ0A 1RHI2 3M3YL 4LBQB 1JTZX 3OSDA 2VU9A 4OQ9A 5BNQA 3O1UA 4XETA 3PHMA 4E4SA 1H1IA 1EV12 4XXBB 1A78A 1BFYA 1RB9A 2DV9A 2R6QA 3R6SA 2QQIA 2GC0A 4RR3B 1BQ8A 5DUXA 4NIIA 5C6CA 5K0UA 5CA6A 1JZ6A 1V9U2 2XJQA 2EAAA 1PMJX 1WMFA 1YLLA 5LRRA 4JTNA 4HONA 2APOB 2GU9A 2WZ8A 2VTFA 4X6AL 3ES4A 3SHRA 4B4QA 3A22A 2JDPA 5CADA 4YNIA 2JA5L 2IFRA 1NNQA 3B08B 1IU6A 3C7HA 5KHGA 1PO22 1AR63 1IS3A 1W0OA 3LZZA 4DXRA 2WO2A 1S0EA 2H6BA 3VHPA 2BTVC 1HDKA 2ORXA 3S1RL 5E88A 3VGIA 4JTOA 3S1QL 3S2HL 1B71A 2YDEA 5F3CA 2VW0A 4H2AA 3Q8EA 1LOAA 1QH6A 5FMOS 4C8DA 2YUEA 4CDXB 2YPJA 2PVXA 1DZQA 3ZFEA 1PVC3 3JCIA 2JB4A 4C2M1 4RS5A 5JXGA 3W5NA 2BNMA 3ZYIB 5KHKA 2R043 1RUC1 4K8FA 1VBC3 1S0FA 3CO2A 3K4DA 4I0BA 3PIP1 3ZOIA 2BWCA 2C26A 5ANQA 1OVPA 5F8PA 4QPWA 1YUXA 1POQA 1AF9A 1LHNA 1ZBA1 4M3CB 5FZCA 2Q8DA 3RYPA 3AK0A 4KWKA 1W99A 3S0MA 2JG8A 3PTYA 3SXWA 3WCSA 1AR62 3JQXA 1VMJA 5DAQA 3INAA 1UKRA 3KZ4C 2OKXA 4NIHA 5DZFA 5FY4A 3VKOA 5A1AA 2CGOA 5A3OA 4FTSA 2VMIA 1OLMA 1SQ4A 1Z78A 5FZAA 1F2NA 2EA7A 4YGEA 3UT0A 1HRI3 2JDUA 2RV9A 4NRPA 5IK4A 3QH7A 2BU9A 2X5IC 1UAIA 3T09A 2VE1A 3E6CC 4NRQA 1IZ3A 4CXWA 4YZ1A 1LNSA 3VLBB 1LHVA 1PVC2 5A7QA 2B46X 2M4YA 2WNVB 3MPPG 5C71A 4P9JA 4XTMA 1BEV3 4MXVA 2CHHA 2P2KA 3AYAA 5L7OC 4GWIA 2R042 2M6OA 5BNNC 1AYM1 1GUIA 1VBC2 1YO8A 1N1SA 4PDWB 2ZTNA 5FXZA 1OPMA 2FCUA 1S2BA 2QFEA 4NIGA 1DYPA 2XJTA 3IPVA 3VL9A 4A3ZA 3RI9A 2Q1ZB 4XFHA 1Q5OA 2D6MA 3HQXA 2YG0A 3P6BA 4Y1ZA 1ONAA 1RUH1 2XLGA 1PX3A 5F2SA 3N7JA 4Q0UA 1G6NA 4JAAA 5FPUA 1SFOL 4UW6A 3TEYA 1K3IA 2ARAA 1EY2A 2L9LA 4HSJA 5CB7A 1HRI2 3HJYB 3NO8A 4OMDA 3KVBA 4IEZA 3IIAA 4XEZA 1GANA 4OHZA 5F3EA 4DXSA 3EB7A 4MV2A 2EIBA 4TSVA 1JU3A 4JDOA 3WHUA 2GZWA 4LR4A 1IS4A 1RDGA 4OFGA 1CJPA 4NE9A 4GA9A 3C7GA 1BEV2 1H2MA 3M70A 2AQCA 3LWOB 5EPAA 1VLNA 5FR3A 1QHDA 1UD1A 1UOFA 4RR3C 3RQ0A 1CPMA 4QIWP 3AXEA 4ARXA 3UETA 4L99A 1UYXA 4PLOA 5EP9A 4R9DA 5FKCA 3SNMA 1W28A 1JUHA 2E7AA 4M4RA 5EQUA 3UESA 2GC1A 3SH5A 2BUKA 3SH3A 1OA4A 1XSQA 2XMLA 3FHAA 4DO0A 5APAA 3O1RA 1BLZA 4D7YA 2A73B 5MFPA 4AEDB 1XU1A 1W9YA 1SG3A 3FZ3A 4FPCA 2UURA 3GTKL 2JE7A 2WZR1 1S0GA 5T5PA 3ZFGB 3LOBA 3DYOA 4HSLA 1VP6A 4Y52L 5FZIA 3THTA 5FLML 1JOJA 1REFA 2GH2A 2JDHA 2WC2A 4K21A 3OBRA 2WZPP 3S57A 4BXXL 5F7UA 6RXNA 1I3HA 3RG0A 3MZHA 1ZZ7A 3S7EA 2XH6A 2R93L 1DIWA 4DUXA 1DVBA 5FOBB 2FDIA 3P3NA 4UAPA 2PN5A 1W6QA 4CDXC 4CCDA 3H1WA 3MV11 4PIYA 3RZJA 4NR1A 2EIEA 1PGW1 4FFGA 2UWBA 4AVAA 5EIYB 4NIDA 1OQDA 2XL9A 1EPZA 2VECA 5FY7A 4CXYA 1R0JA 1LGNA 4BMEA 3IN9A 1ODHA 1W8TA 3LSEA 4Z2WA 5FY0A 3DYPA 1UF2C 4FOQA 3NW4A 2Y6JA 4EZHA 5CKNA 5A7WA 1G9BA 2WB1P 1LEDA 4QX3A 1MVEA 3OYWB 1NOVA 1QOSA 4L92A 5T3NA 5ABJA 4QPIB 3VBUA 3ZXGA 3WR0A 3HJWB 3W58A 2GDFA 2A68D 3K75B 4KI5M 4A3FL 4KNCA 4Q5OA 4I2OA 4CUBA 1OXCA 3LEGA 4QQHA 1KFXL 2AYHA 1I9RA 1HV0A 1WWYA 2V4VA 4PLMA 1HJFA 4UF0A 4YG3A 5FV3A 5F5QA 4CP9B 2R0FA 2Y6KA 1Q3EA 3F95A 4AR3A 4FPGA 4K6BA 5FYMA 4BCUA 3MEPA 2DBIA 3MUZ1 4RYDA 3H8XA 1YXWA 4LHLA 5CFCB 1B35B 1F4AA 1GP4A 1OVSA 1PZ8A 1UL9A 1QJX3 1WMXA 2WNVC 4JDNA 4AQTA 1POV1 2A70A 5C4XL 2GNBA 2VTXJ 1H2NA 2PHFA 2W1UA 3KSCA 5A32A 1MR5A 2WWJA 4NOTA 3WW4A 3K2OA 2C9KA 4PDWC 4YFWA 1UYPA 1VJ2A 4YZ3A 4MZUA 3SKVA 3WUDA 1ZA7A 2CWMA 2VZOA 3W21A 2ETEA 1N1TA 5GZCA 2J1RA 3WF0A 5JMOA 1FMD3 5FYUA 2D40A 3AC0A 5C70A 1ZYBA 4WBBA 2D5FA 3CU7A 2PHTA 4LBOA 1SACA 4QU2A 4DRVA 3UGHA 5LRSA 3GTOL 3RZLA 2P34A 3HNBM 1OOPB 2UWAA 2JJ6A 5F5AA 3WWLA 2NVQL 3L2HA 1M06G 3A44A 1I1EA 2DURA 2VMFA 4AFMA 3AX4A 4U36A 1K5JA 1QJX2 2BGOA 3DGTA 5FZKA 1LKPA 2X29A 5IVEA 5FO7B 1UU6A 3LDKA 5FXWA 1SFPA 2RDNA 1NXEA 3ZIXA 5LY1A 4E4HA 1YFUA 1W8WA 1LTEA 2W5FA 4POFA 2ZX0A 1UZZA 2QJVA 2SBAA 2E33A 3T2TA 3PIO1 4LTAA 1UMZA 3E97A 2AENA 1OH3A 1FMD2 1UU5A 1YWKA 1JI6A 3CHXA 3HT1A 3KV4A 3MIEA 3PUHA 4LHSA 4RFT0 5EYXA 3I2OA 2WS92 1YUDA 3PTRB 4AEDC 2ZGMA 3S14L 4O9GA 1JYXA 3WG3A 1V6MA 4R52A 4B29A 1OF3A 4ASLA 1WZXA 3PU3A 3GTJL 2XLFA 5FP4A 3D0JA 4PIZA 3ZFGC 1CIYA 4LORA 1OH4A 4KG0A 3V64A 3DYMA 3H42B 5M0TA 1WW7A 3WDWA 3S16L 2HYXA 2BYVE 4XDPA 5IUQA 3NJXA 1QDCA 1YC61 2YMZA 3GCXA 5BNPB 5FLHA 4C0HA 2NQYA 4LO7A 3ZYBA 4ZXEA 2UYAA 2FDGA 4OHXA 1XE0A 3LWVB 1OUXA 2C4XA 2DDUA 3KQRA 4S2GA 1H4GA 4QAWA 2D6KA 2VOKA 2LTNA 5EWSA 5FZHA 5H9SA 4HK8A 1UOJA 4I0AA 3ST7A 1S0BA 4A41A 2Y6FA 1COV3 2FDHA 1HN1A 3RFRA 3TEWA 1DZTA 4LHNA 4LOSA 4IEPA 1ODMA 1POV0 3AXDA 3LDRA 4A7ZA 2WT2A 3WDYA 1EP0A 5C3OA 2X5IA 2KKDA 2A71A 4QPIC 1FI2A 4RN5A 4XHBA 4ES8A 2FBEA 2XLAA 4P00B 1PGSA 4FFIA 2NVYL 5C4WC 3HN3A 4CCCA 1W2UA 4UYBA 4AOCA 3JB8A 4DIQA 3O1SA 3T3YA 4XURA 5L7OA 3AMQA 3K3OA 4KU7A 5BNNA 1VIWB 3DN7A 4H55A 3AZYA 3MYXA 4Q4Y1 1C09A 5FZMA 2IXLA 1B35C 1RYTA 4Q0QA 2H6CA 5CFCC 3K46A 1IGOA 2LRPA 5DMYA 2ARCA 3V0AA 4ZZ8A 4XFBA 3WNOA 1JYTA 4S2DA 4J6GA 1B2JA 2WL1A 1R1A3 3N9LA 1MS8A 2O5JD 1COV2 1NCRB 2JA7L 2B9UA 1GNZA 4POGA 2YU9L 2VBDA 3GYDA 3HEIA 4A42A 1YUZA 1C5HA 2VM9A 3POEA 4OHYA 3HNYM 5M3ML 4LBQA 1YQ8A 5FWEA 2YZ4A 1OLME 2PLV1 1DZRA 1CZSA 2IZWA 4N9IA 5FUPA 2MPFA 5F37A 4HVRA 5I0DA 4EROA 3QOPA 3B7MA 2WFF1 5JVVA 1OOPC 3FUOA 5I8SA 2CY6A 5H1Sc 3ZYFA 1OMIA 3D3AA 3USUB 4UBGA 1U5YA 3I3DA 4RR3A 2ZGPA 3WNPA 4DY5A 1YK5A 1WCSA 5FY5A 2DUOA 1MVQA 3IAPA 1WD4A 2JIGA 3J8F3 4XHXA 4H7MA 1WJVA 4AFBA 4ME3A 4IEWA 1J3RA 2RS31 4NPMA 1TZOA 3M3QA 4N8MA 4UFIA 1R1A2 1L7QA 4O9EA 3WF1A 5FYHA 4LULA 4XQDA 3GZUC 5J3UA 4FPFA 4AEKA 4YW2A 3WT3A 5CEHA 4A3EL 5A7PA 1GQHA 1QU0A 4LE3A 2JIJA 4Y26A 3I59B 1WLWA 4RGGA 2FZ2A 4RL7A 4BY7L 3UK9A 1YEWA 3J7NA 4ASKA 1IRNA 3WLUA 1G86A 2Y0IA 4A3IL 4CDXA 2WAOA 4BK5A 3NAPB 2OS2A 4A3JL 1JYIA 4AR5A 1PNFA 3AKRA 3EHKA 2UWCA 4QKDA 1G9CA 4AVVA 1UIJA 1RC6A 1HB3A 1TWFL 3HOUL 2NZ9A 3NQHA 3A21A 1SPPB 3J8F2 4B7KA 4D6RA 5BNPC 4GALA 4GMP1 1DX8A 4LBMA 2C1FA 4LO4B 3AP7A 4RHV3 3U11A 4NO4A 3RZGA 1XNTA 4EN8B 2IXHA 5CAZA 4M3CA 2DVGA 2ADEA 5ACA1 2ZJCA 2VGDA 4XGHA 2KD7A 3POGA 2Y0SP 3HOBA 2YC2A 4P5HA 2RJ2A 4XVHA 1AL21 3WV6A 4LA2A 1O4TA 2WT0A 3BCWA 4KWJA 4S2HA 4XJUA 1IW7D 1XU2A 2EICA 3MIDA 5JXIA 2W68A 1LENA 4XJZA 1LODA 2A69D 1N3PA 4FXKB 4OMCA 4QPGA 4Y4RA 3D5OA 2K2DA 2JDNA 2VG9A 1W6NB 3S6PA 1LOBA 1WW6A 3WOGA 4CZSA 4DNYA 5B4NA 4JQTA 4I09A 3AJYA 2ZHNA 2WNVA 4AI3A 3NVCA 5FY1A 5GM0A 5L9RA 3PUIA 5IFPA 3RYKA 4QKNA 3JXSA 3CMGA 3ZXLA 1QMJA 3T2PA 1LCLA 3CKHA 5DQ0A 2X05A 4JDMA 3RJ2X 4RHV2 3ZN6A 4PDWA 4B4PA 3FHQA 1RUNA 3OGRA 1JYVA 1GBGA 3W5MA 2J42A 2O0OA 2A6ED 1GOFA 2TEPA 2BOIA 3NV3A 4G6BA 4LKFA 4Q29A 4R9BA 1RIRA 2BOJA 2W87A 3OB8A 4GQ7A 4QDSA 1FPN3 3ROUA 5CFDB 5LA9A 2IXKA 4YGDA 5IYDL 1FNYA 2YFZA 3M4FA 3UYJA 4AR2A 1NCRC 5A33B 3TOJA 5I8YA 3ZM8A 1YCIA 4N7UA 2VXJA 4L97A 3O1TA 1SBDA 4WZFA 5IAVA 2W1QA 1JHJA 4GIQA 2RMU1 1SMMA 1ZNPA 1AX1A 4YZ4A 2PHLA 2RHPA 2E63A 1J1TA 1DGLA 3ABZA 4H14A 4L0PA 5E8AA 3ZSEA 5A1FA 1ZVFA 5DXDA 1WCKA 3ACIA 3AYDA 2JICA 4AQ2A 3OUJA 1Q8OA 1W90A 3WDTA 4IL7A 3PO3L 4WZCA 4MOAA 4WVMB 2PPTA 1RUE1 5LA0A 1S2ZA 5JOWA 3LWRB 4IE7A 1CAAA 1CAVB 1YFWA 4HKLA 1DGRN 5FZOB 4W6XA 3B02A 1ENRA 1YJLA 3BGAA 2OYZA 5SV8A 2J1VA 3I3MA 5RXNA 1FPN2 4XBNA 4DRRA 4M0NA 2JDYA 4WM7B 5F3IA 5SV5A 3I4IA 1C57A 4IERA 3ZXFA 1PNGA 2D93A 2WYFA 3M7AA 3OY8B 2HWF1 4FPHA 5IATA 4AEDA 2NYDA 3I2FA 1KITA 4B1MA 3RZHA 1RXGA 3ZXKA 1A8MA 1WA6X 3ZFGA 4GMP0 1C3HA 3WP3A 3AMMA 4BIOA 4BQYA 4NAMA 1S4CA 5IT6A 1X9PA 3FFQA 4DINB 3BUCA 4A3KL 3P8BA 2E6VA 2WAQP 1E5SA 1N3QA 3LIHA 3U75A 4K7JA 1DYOA 1RINA 3THDA 3RGBA 2WABA 3NAPC 2E2HL 1GP6A 3M4OL 1VBD3 3O0VA 2Q1FA 1BHGA 4DEQA 2AR6A 2VUDA 3TN91 2OX0A 3KMHA 4ATEA 5A3LA 2GMGA 4D94A 4YZ2A 1OSGA 2YY1A 1PK6B 4Q4X3 1JOBA 3OCPA 1K83L 3WNKA 3JBG3 5T50A 3POBA 3OYWA 2YFUA 4HT1T 4XPVA 3WW3A 5FBJA 3KGZA 4QPIA 4W6YA 3VZNA 4PI2A 2F4LA 2A5ZA 4OHVA 4RA0A 1PIV1 5C4WA 4CP9A 4GKYA 1HB2A 3EBRA 4CDQB 1JYCA 2E26A 4TTGA 3K4ZA 3D4KA 2R49A 1MACA 5FCCA 4URAA 1EUUA 3OTFA 3KF3A 5FFOC 1RHI1 1KS5A 3I2GA 5FK8A 5CFCA 1B35A 1VBD2 2ZEYA 1J84A 4FQZA 3THCA 3N9OA 3M3CA 1PFYA 2WAAA 3OJBA 1XOYA 2JA6L 3I97A 4WFN1 1RYYA 4LMFA 3S17L 1EV11 3JUUA 4Q4X2 3HR9A 3HT2A 4Y7NL 1OD5A 1RVF3 1G7YA 4GH4B 2MEV3 1H1MA 3JBG2 5GAEc 4FP3A 1ASJ3 2DFBA 2WWUA 4MSVA 1V9U1 1W8FA 3W9AA 1C8M3 5CFDC 1X33A 3RZMA 4FPEA 4XE9A 3ECQA 2ENRA 4FAGA 2XKPA 3NWKA 1AXYA 1OWCA 4XBLA 3N9QA 1F15A 3KM5A 1EPWA 2BGPA 3AJZA 3QLQA 5LBCA 3WQ1A 3AFGA 1OOPA 2B5HA 1PO21 1O4ZA
chains in the Genus database with same CATH topology
4HANA 5GAHc 4C1XA 3HIFA 4N43B 1J3PA 2CTVA 5T52A 1OWBA 2I2SA 4EN9B 4IEXA 4LO6B 1AXKA 1D0HA 1NA1B 1NXD1 3CJIB 4ITCA 5J37A 1DGRA 5FO8B 3RZTA 1RVF2 1AZDA 3THPA 2MEV2 1ZZ6A 3AP9A 3B3QE 1ASJ2 1C8M2 4WM7C 1REDA 4EWEA 2ZZJA 5DUUA 5BPXA 1QNWA 5KHHA 5J98B 2NM1A 2WIIB 1H2KA 1VAKA 1X8EA 2V5YA 1RTVA 2BGCA 5J96B 3RDIA 3D6EA 1AR61 3E5XA 3JU9A 3ZYJB 2IXJA 5BNPA 5CIRA 1DHKB 3ZFFB 1NG0A 4AI1A 2R32A 4YGCA 2VNRA 3RSJA 3P3PA 4G9SB 4Q26A 5FO9B 3JB4C 4AFAA 1ZX5A 1N47A 1QKQA 4FTEA 1PVC1 3UV9A 3TWIA 1QF3A 2A6XA 1PK6C 3AB0A 4OUSA 1PVXA 3ZO0B 4COVA 3KYXA 5JOYA 2R041 1VBC1 3H3UA 2CWSA 1VBB3 4HFSA 5FAXA 1LRHA 3VZLA 4XZPA 4W65A 1BQPA 2VW1A 4FPYA 4WVZA 2VOWA 4CDQC 1RUI3 1UIKA 4JAGA 2A6ZA 3H7JA 3SCGA 3H7YA 4BM8A 1HRI1 2AGSA 3PVNA 4AVBA 4INDA 5GZGA 1H7VA 1XNKA 4XIKA 1HX6A 3WXPA 4JQRA 4Z8BA 2HWB3 3J7Y1 1MS1A 1ZZ9A 3JD73 1B2OA 1YI7A 4J1XA 4JV4A 4XILA 2ZA9A 3FMGA 2OZJA 4CEWB 1L3JA 2YROA 1BEV1 4OULA 4FPOB 4ZXKA 1MS9A 1PZ7A 1U5ZA 4XMIA 3A4UA 1NCRA 4GH4C 2ZGOA 4M3CE 4KGQA 2PFWA 4GXLA 4HPKB 4LHKA 1VBB2 2PHDA 3CF6E 5GLWA 1KD7A 1DGWA 1PZ9A 2F6BA 5E89A 2PTMA 3FUQA 1NLRA 3POWA 3SCHA 1B09A 3MW3A 1LEMA 1YNAA 3N3HA 4IV3B 1ND3B 2QE3A 4E2SA 1OFSA 3MSUA 5JIUA 4BE3A 2A6WA 2BW8A 1GZWA 1RUI2 2O8OA 2HEWF 5EYYA 5BNOB 2QNKA 2VMHA 3O12A 3O5SA 5AN9H 3CNAA 2MHFA 2WA3A 4CP0A 1XYOA 2R063 1R082 5MLC3 2HWB2 4N43C 3ZXDA 3JD72 4WV8A 3ZYPA 3VBFB 2P17A 3MF9A 2DSXA 1SEFA 3VBHB 1Z7S3 2VVFA 1QH7A 1REEA 1NA1C 1Q8QA 2IXCA 3CJIC 5H9RA 5FRAA 1C5IA 3O14A 1AJOA 4COUA 5K8SA 1QJZA 1LHOA 1AJKA 2IFWA 1RL3A 1NE4A 3R4UA 4N53C 5JPMB 1WBLA 2ILMA 2R073 3I59A 2E53A 3APBA 1Y7BA 2ATFA 3D82A 1W6MB 1R0GA 2CL2A 2CKAA 1PO13 2CV6A 3ATGA 3NAPA 4COZA 1RJ7A 2EXHA 2Y38A 1AUYA 2R062 1X8MA 3VHRA 2ZMLA 2JECA 3ZFFC 3VHOA 4MVTA 2A3YA 2A6YA 1GYKA 1Z7S2 2XG3A 2VVEA 2D6LX 3DV8A 1U5IA 4AQ6A 5GLTA 4FPLA 1ENSA 2XB6C 3ZXJA 1S0JA 1S0DA 4LEJA 4BPZA 5KHIA 5AVPA 1LU2A 1PGL2 3N7KA 3ZSKA 2DVFA 2R072 4P9IA 2DCTA 2GMMA 1QJU3 5K7PA 2JG9B 2R0HA 4XMAA 2ET1A 1YJKA 4L9BA 3N7MA 5EINC 2E9QA 3S30A 1PO12 1W6NA 4ORFA 5JR7B 3ES1A 1R1ZA 3JQWA 1OLRA 4CEYB 3B94A 5C9AB 1HRV3 1KS4A 3LWCA 1RUJ3 3FE5A 3ZYGA 3WX5A 3WG1A 3IM0A 1N3OA 5EJ3A 1H8VA 3RS6A 3WW2A 1GKBA 1IPJA 4IEVA 4DZGA 3ELNA 2G9GA 5DUVA 2ZX1A 3B93A 1ZBE3 1AL0G 5HXVA 1QJX1 4EWDA 4QHBA 4CEWC 1RGSA 3I2DA 3OD0A 5CFDA 2ZGKA 1KFUL 5KC6A 3QCWA 5A33A 2PA7A 4AGRA 1QJU2 1AR93 2B45X 4F7ZA 2VOVA 1JW6A 4DPNA 4HVQA 1FHMA 4IV3C 1ND3C 1V6LA 2M6PA 3WCRA 1FMD1 4LO8A 4E4DX 4QX5A 4R4XA 3AFKA 2LUWA 1HRV2 2G4IA 1RUJ2 1TME3 2WS91 5BNOC 1NY72 3ZN4A 1V6NA 1XE7A 1O7FA 3R4DB 3LA3A 2L0ZA 3M8LA 4WVMA 4X6RB 4K9SA 4BLIA 5GZFA 2ERFA 1ZBE2 3HAGA 1X50A 2GALA 3VBFC 3ALQA 2A6HD 2TBVA 3AMHA 4HZFA 4QM9A 3VBHC 4WM7A 1RITA 3AKTA 1M4WA 2AH2A 3RWNA 4M01A 3OGJA 1D2SA 4KU8A 3J9SA 1AR92 3ZX7A 5JWPA 2BWAA 4UW5A 1IS5A 4LA3A 3MIBA 3ZIWA 3SLIA 2BVVA 4ATFA 2Z69A 1RUOA 3H1MA 2NP0A 1YIFA 3HN1A 1TME2 1ZRDA 1QJY3 1LOFC 2HWC3 5AC93 1T9QA 2MS3A 3UKVA 1Z92B 1SLIA 2E7TA 1E8JA 3KD4A 2XJRA 4PLNA 4YW4A 5IK5A 1CAUB 1VBE3 1KDKA 1PK6A 4QXKA 1X36A 2TNFA 3MW2A 2B39A 1KDMA 4MGZE 2ZMNA 1LU1A 2WS93 3VN4A 1ZZCA 4UXAA 4FSJA 5C8WA 2ZHKA 1DYKA 4MXWB 1OKQA 4P9LA 2VQAA 1S0IA 2JG9C 4OVEA 5JIAA 4CDQA 1COV1 2Z2SB 1QJY2 2ET7A 1H2LA 4UY81 3UKNA 1CAXB 2HWC2 5AC92 3E6DA 3KLSA 3SITA 3MDPA 3SCFA 2OUJA 4LBJA 4CEYC 3KS7A 4FPJA 2QVSB 2A3XA 2R1DA 3GBFA 2MNGA 5EFUA 5C9AC 1MS4A 4AVTA 4AEJA 1BJQA 4AE2A 4Y20B 5HCFA 3MPBA 2H0BA 1SMUA 1WBFA 1VBE2 5FLIA 4BZ4A 1XRUA 3BU7A 4OI2A 2JI1A 4GH4A 5GJ6A 1RWDA 3GHMA 3TRSB 3E5UA 1DDLA 4GWNA 3J7Z1 4DS0A 3VBRB 4X8PA 4A7YA 3MI8A 1LKNA 4V1PA 2IWGB 2DUQA 1NCQB 1S30A 3LKJA 2BE5D 3H8UA 2EIGA 1SBEA 4DMIA 2DUPA 4HLTA 1R1A1 3FBYA 2H12A 4Q0PA 3PVBB 3LB9A 1HW5A 5JPNB 1ND2B 5K2ME 4MGIE 4JGZB 1BXHA 2ERSA 1UKGA 4JRLA 3OPZA 4NVPA 4N43A 1Q8SA 4TLFA 4NHMA 4Q8LA 3RMXA 1JYBA 2P3KA 2YXSA 1TE1B 1V6KA 4D7TA 4MUVA 1NA1A 2D3PA 3CJIA 5FREA 3KYWA 3AP6A 1CAWB 3BIWE 4XQ4A 4U2AA 3K48A 4EN7B 4E27A 4YW1A 4N53A 1I6XA 2TUNA 5EV7A 1H1AA 1F8VA 1APNA 2HJIA 3J8F1 4I3GA 5C8CB 1RMU1 4M0HA 4AI8A 5F1RA 1SFYA 5J09A 5JI9A 2QZ2A 3LNLA 1A3KA 1HKDA 2HWE2 1AHSA 2V09A 2VW2A 3ZFFA 3I8TA 1C1FA 3J4UH 2RDVA 1CN1A 1W6OB 2ARBA 4FO9A 2DCYA 2DVAA 4IV1B 4RQPB 3MFCA 1HLCA 2DU1A 1CIWA 3AMNA 4N7IA 3ME2A 4F3JA 3MICA 1CONA 3NFPI 1WW5A 3KCCA 4AXOA 1LB2A 2HYKA 4RHV1 4L11A 4YM3A 1B13A 1N1YA 2JE9A 2IC1A 4WVWA 3VKMA 5J36A 4I30A 4ZKTB 3KYUA 3H1YA 5JSRA 4PIXA 2OW4A 2JDZA 2B8MA 2Q5TA 5J7MA 1MS3A 1ZRFA 5FTTC 1VZIA 1WLCA 2AUYA 1FV2A 1RMU3 3GHNA 2W52A 2OPKA 5CVRA 1AR73 4RGAA 2ZOEB 2VMGA 2JI2A 4CEWA 2VNGA 1FAYA 3UKTA 5KXCA 4TZDA 2HKXA 3LSDA 4K9FA 1J58A 4P9GA 1LGCA 3OGGA 3UJQA 2CKCA 2YC0A 4AVSA 3VKFC 1FXZA 1IQAA 4HPKA 3LOIA 1NLSA 1KRIA 3VBRC 2WNUB 2P37A 1VBA3 1EAH3 4IV3A 1ND3A 3O0XA 2WT1A 1NCQC 1FX5A 1S2KA 5IK8A 1FPN1 2CNAA 1LECA 3WY6A 3FLTA 4Y1VA 5L73A 1BZWA 5BNOA 3ZYRA 1YYNA 1LHWA 3L2YA 2LCQA 2YGLA 1ND2C 3WD5A 3WP5A 1VALA 2XWJB 1FNZA 1UPSA 4JGZC 4KGGA 1RMU2 1SLTA 3AKQA 1QY4A 1AR72 2UYBA 1HV1A 2QDNA 4MGYE 3VBFA 3KGLA 1RUF3 3VBHA 4A7KA 1GQGA 4EV0A 2I74A 1UPIA 5LK5A 5FPXA 2I45A 1K5MB 3PKJA 3U4XA 1T6GC 4NWVA 4LLOA 1TMF3 1MEC1 4QQ2A 1C8NA 2NPIA 1VBA2 1EAH2 4YSFA 4HBNA 4YG6A 1BQ9A 1QWRA 3H3ZA 5C8CC 5HBAA 1C28A 3H9AA 1XYNA 1W6MA 3U10A 4AEMA 1LOFA 5BYNA 4C91A 3FBMA 2GC3A 3FLPA 1XQNA 3MGUA 2ZAAA 4D69A 2XPJA 4ZU7A 4LLFA 3GBWA 3VKNA 3ZN5A 2D6NA 1RUF2 1QQP3 4AYUA 4F83A 4Y22B 4AGVA 4IV1C 4RQPC 3MLKA 1AX2A 4X6QB 1CQ9A 1VBD1 3H50A 2FMYA 1GR3A 1QNYA 2K2SA 3TBDA 1TMF2 1XNDA 3OBTA 4AG4A 4Q0SA 1G9AA 4Q4X1 3RRDA 2WJSA 5KC5A 2IXIA 2JG9A 2B5ID 1D0GA 5GAGc 1A8DA 2NYYA 3JBG1 4E9KA 3N35A 4QQPA 3VUOA 1R0IA 4Y4YA 4XF0A 1S1AA 4QQOA 1AR83 4CEYA 1NE6A 3EXUA 1WW4A 4G4FA 4MX3A 5C9AA 1CJDA 2C9AA 3PZAA 4HKWA 1MEC3 4K1YA 3G6JB 1YK4A 1F9KA 1SMWA 2ZGSA 2PYTA 4E2GA 2UY8A 2DVBA 2O8QA 2D6PA 1RUD3 5GZDA 1QQP2 3VHNA 1GV9A 2PVEA 1JH5A 3ASIA 4MH0E 3RZ6A 3ZG6A 2OIIA 3WDXA 4AF9A 5TSWA 5CG9A 4OHWA 1WGPA 4YG0A 5E16A 4YRDA 4PBPA 1AVBA 2JENA 1QGLA 3ILRA 4I01A 1RB8G 1QCVA 1RVF1 2GMPA 4AI2A 2MEV1 2WNUC 4YGBA 4GB33 1ASJ1 2PSMC 1KQRA 3GF6A 1AR82 1C8M1 2BVBA 3WZ1A 4Q1RA 2DTWA 4HETA 4QD2A 4SBVA 1QXPA 3O7OA 5DUWA 1F5FA 1MEC2 3R0RA 1OQEA 2RS13 4META 4AFDA 3VKLA 1RUD2 3AP4A 4XJ9A 3AZVA 2VPVA 4BH9A 1WA4A 2NN8A 4LO5B 1O5UA 3O0WA 1URXA 5MFZA 3LA2A 2JEMA 2KM2A 1U5XA 4M00A 1VRH3 2ZX4A 3PNAA 3IMNA 1U0AA 1K5MC 4QM8A 3SMHA 4LBNA 3GBGA 5JZGB 7RXNA 4OZXA 5BY5A 2RM23 3KYYA 2ES3A 2P3IA 2ERJA 3WWNB 4GB32 2BFUS 2PHXA 3CLPA 4R4ZA 5L19A 1CR7A 1LR5A 5JDBA 1R091 1IKQA 2QZ3A 1ULEA 3PVEA 2RS12 4K40A 3ZPYA 2EXJA 5I0RA 2QDRA 2E51A 2UY9A 3M3IA 4XDQA 5JOXA 1AYN3 1IHMA 1V6OA 2NLRA 2D43A 4IETA 1X82A 2ZACA 1GZCA 5F6LB 3IWZA 4Q4W3 5JMCA 1CAUA 4YM1A 1BE7A 1VRH2 3ETQA 3RPQA 2XWBB 2C6BA 1H30A 4MLOA 1GNHA 4AVCA 1ZRCA 1LULA 4ZN3B 2RM22 4MXWA 3ZSJA 2RR13 2WINB 1C4RA 3SS2A 1DQ4A 2BNNA 3BOWA 4YM2A 4JAFA 2ZS6B 3PJYA 1VBB1 1CAXA 1W39A 2GN3A 1O3RA 4XQWA 4Q4V1 2ZGLA 3QQCE 4NN0A 5FOJB 3R05A 5I0TA 4EN0A 1AYN2 4QT6A 2GSYA 4Q4W2 4Y20A 1UX6A 2D7FA 1UN1A 4NPRA 1RUI1 4Q1PA 1GICA 1R093 3BPZA 3U0ZA 2FQPA 1GZ9A 3UL2A 1G9FA 3HWJA 3FFZA 3QBQA 4IEUA 3VBRA 1R081 2C5DA 2FZ1A 2EXIA 2HWB1 1IS6A 2XGXA 3JD71 4WVVA 3LGRA 1NCQA 2RR12 4E4ZA 5JOZA 4YW5A 2GN7A 1DQ1A 1WLTA 2AYJA 2F4PA 2ZX2A 3BOPA 1IROA 1BBT3 2VUAA 2DTYA 4XFIA 2RS53 1CGPA 2C0ZA 3EO6A 1ND2A 2OUHA 2ZGNA 3NKTA 4JGZA 1R0HA 3AKSA 4FQ4A 1U12A 4OI1A 3LAGA 1YV1A 4LUMA 2XVGA 3MLLA 4AR6A 2Z5WA 4RSUA 4P9YA 5KXDA 1ULDA 3E5QA 3DL3A 2OZ6A 4P14A 3VDDB 1BYHA 1R092 4XTPA 3KYVA 4PCRA 1SFNA 4KL1A 3VZMA 3NL1A 5CBLA 1CAWA 1YI9A 2XBO3 4DB5A 1LHUA 2A75A 1OHFA 2DCKA 4CDUB 2R061 3USSA 4AHXA 4HMZA 3NV4A 4Q4V3 1BMV2 3KCYA 3RYGA 1OA3A 1CX4A 2GNTA 1KJLA 3VBSB 3WVJA 4Q8KA 5C8CA 1RUG1 1Z7S1 3PJQA 1BBT2 1BK1A 2GAUA 5JZGC 2WQZC 2D3RA 2RJLA 2RS52 2R16A 1NYWA 2V73A 5DG1A 3QACA 2A7AA 4HL0A 2K9ZA 1PGL1 4QQLA 1OFNA 4ZU4A 1R083 3D0SA 1JXNA 4S2FA 5A3MA 2R071 4ISRA 1BKZA 1Y43B 4KBBA 4W6WA 4XFCA 4E4SA 1HXS3 3B69A 2W08A 3IU3I 3BODA 4BIFA 1KXGA 1HIXA 1W6OA 5AI3A 4V196 2XUMA 1PO11 1H4HA 4IV1A 4RQPA 4R9CA 4YVWB 2XBO2 1FV3A 3S7IA 3WG4A 2WLQA 1DF0A 1FOD1 1JHNA 4Q4V2 1W6PB 2HWD3 4KG8A 2PYAA 3FX3A 1IOAA 3LA7A 4Z92B 4AHWA 2CAVA 2ZKLA 5JVH1 1YIPA 5EXOA 4WM8B 1SLBA 2E7QA 1GFF2 2D5HA 1OPOA 4UW4A 2OVUA 3USUA 4YW3A 4P9XA 4QGMA 4QMAA 2AZ5A 1GLHA 3IKWA 2ZIXA 3ZVXA 4L8QA 1BVP1 1MZEA 3V56A 1QJU1 1VAVA 2GNMA 1HXS2 1RUG3 1V70A 2J9UB 4B8CD 4COWA 1LESA 4IESA 1FT9A 4XOGA 3W59A 4CYDA 3VL8A 1WCDJ 2WSVA 1D4M3 4Y24A 4LE4A 3A0KA 1HRV1 5GLUA 5CNAA 1RUJ1 5AVAA 1NY71 2HWD2 1JUIA 3ZSMA 1TNFA 5J48A 3WP4A 4XW3A 3RI8A 4Y1YA 3TYJA 1CD3G 2WNUA 1NQDA 1ZBE1 1VB2A 2BFUL 3ZDSA 4DOUA 5BUVA 4ES9A 1FOD3 4YWMA 1VR3A 3Q9OA 2CAUA 3IT8A 5I91A 1AR91 2Q30A 3POSA 4XXPA 1RUG2 4QPGB 2V0EA 5H9QA 3DPRB 2RJKA 3IDBB 4OI0A 4IEYA 1N1VA 1D2QA 2QKDA 4DFSA 1D4M2 4EN6B 2EXKA 4YM0A 3VDDC 2ZHMA 1I5ZA 2M4VA 1TME1 4PF5A 3OD4A 4C90A 4NHLA 3BTAA 2Y0OA 3PVOA 1K5MA 3ZN6B 1SCRA 4CDUC 4I0WB 3NJZA 1KJRA 3WV6A 1H9WA 2Q1MA 3N7LA 4FTBA 5LK7B 1Y3TA 2WFPA 2ZABA 5D8AB 1GSLA 3VBSC 3IBMA 4HK9A 3NSTA 5F6KA 1XXNA 2C6AA 5DZGA 3ACLA 1FOD2 2BEOA 4PBOA 2OA2A 2W0XA 2Z79A 2A3WA 2VQ0A 1RUC3 2XHKA 4KQ7A 2WWSA 2KXLA 4FAHA 4ASMB 5BV6A 2LM3A 4B4RA 1ZBA3 2YGMA 2JXAA 2NMNA 3CJXA 5T5OA 3V65A 4B3NA 5KXEA 5HCAA 3FHIB 4C1WA 1J3QA 3PMSA 3KT1A 3SH4A 4X8NA 1QJY1 1MZ5A 1DQ5A 1DQ0A 2HWC1 4Y22A 5AC91 3B9IA 4YVWC 1LOGA 3E6BA 3LCPA 4XJ8A 3X29B 5BXXA 5KWRA 1ENQA 2RE9A 4BMBA 1VBE1 1O4YA 1C1LA 3VZKA 5FDBA 2CGPA 2R1BA 5FBZA 4Q0VA 1RUC2 1AYM3 3C3VA 4WM8C 3VZJA 3WQ0A 5JLVA 4DQAA 1LKOA 1HQWA 3I7DA 1YFYA 4XBQA 3T1LA 1ZBA2 2R30A 1CAVA 5H9PA 1DBNA 4J1WA 4C0BA 2G9FA 1RUH3 2QCSB 3C2UA 5T5LA 2YV8A 3OY8A 1MQTB 1CVNA 2WA4A 3ZSLA 1WLDA 1XE8A 3B0AB 4EWAA 1D4VB 3K51A 4BA6A 4XXAA 4YARA 5AFBA 3DUIA 4IEOA 3G7DA 4H3WA 3WUCA 1QDOA 1V6JA 1AYM2 4PJYA 4LBQD 3B00A 1UZYA 1SLCA 5JSOA 3PLQA 4ZU5A 3GZAA 3POYA 4AGGA 4LUKA 4XF9A 4GULA 1AX0A 2ZBJA 1T9PA 2HEVF 1X7NA 3ILNA 3NV2A 3KT4A 4FOVA 1RUH2 3RYRA 4QPGC 4JRAA 3DPRC 2VVDA 2FHRA 3AKPA 1LOCA 2PHWA 4FCAA 2HWE1 2WZR3 4ONUA 2WLPA 2BPA2 1BVVA 4ISQA 2EAKA 4XFAA 2V0FA 3HD8B 3RNSA 4AWDA 3SISA 1SDWA 4TVMA 4BQ1A 3T1MA 5JZGA 3V0BB 3VZOA 4CDWB 4JADA 5D8AC 1IU5A 3VBOB 1VCXA 2PAMA 1J59A 5MF6A 1DFQA 2VOXA 4RXNA 4JGYB 2YYOA 2DU0A 1LGBA 3WHTA 5FMOL 3DKWA 3FJSA 1UU4A 2H0VA 1H8TB 2JI3A 1ZREA 2WZR2 5JSPA 1NXMA 5HCBA 3RMYA 4YWLA 3ZMNA 4IXLA 5GLZA 1DGWX 3TNPB 2HR5A 4BOWA 2QL0A 4OI4A 1DQ2A 2DF7A 2ZGTA 1ENXA 4K1ZA 1VZHA 1A6CA 1F5JA 2HWE3 1PGW2 2DCZA 1POV3 4FOWA 8RXNA 3FC0A 4YVSB 2ZX3A 3M2MA 4M3CF 1CESA 4XF3A 1XNCA 4ZN1B 1BCXA 4AK3A 3EQEA 2CYFA 4UW3A 1J1LA 4AW7A 2SLIA 2XKOA 3BALA 1SLAA 3TNQA 4HKOA 3N36A 4H7LA 1OA2A 2ZZQA 3MLJA 5I93A 4LBKA 3MIGA 1MQTC 3AZWA 4BWOA 5D1IA 1QOTA 3KT7A 2ZGUA 5B2GB 1QXRA 1AR71 3EJKA 3ZXEA 1VAMA 5FQ0B 3MIFA 4OLLA 4D3WA 4LNVA 5IY0A 4LT5A 1SMVA 3B9CA 3NKGA 1VBA1 1EAH1 4YYOA 2WKKA 5K0UB 4XIOA 3UJOA 4AQSA 4DXZA 3VDDA 2VL6A 3A0NA 5DDJ3 5AFEA 3PWFA 1OQ1A 2XJSA 1UW8A 1Q43A 5GKAC 5C33A 3TAYA 4GKXA 4MGKE 4CDUA 1DQ6A 3HBZA 2N7GA 2VY0A 5KXBA 5LEJA 4Y1UA 3M3EA 1PMIA 3VBSA 1RUF1 1HQNA 4Q27A 4K20A 2D98A 5FPZA 3ILFA 3IDEA 3NV1A 2Y26A 4CDWC 5T55A 1TMF1 4YLZA 3HMYA 3VBOC 1FYUA 1MZFA 2HEYF 2WQ4A 4R9AA 2X53S 2ZGRA 4JGYC 4QGNA 3ZFEB 1RDVA 2VXRA 2I07B 1YHFA 4RS5B 4AHYA 1GZWB 4E6YA 5DDJ2 4XYXA 2PAKA 4IQPA 1Q56A 1JN2P 1TQ5A 4YVWA 3WP6A 1RJ8A 4CP1A 2B42B 1YFXA 1CADA 1H8TC 1ZM1A 3TB0A 1UCXA 2PHRA 1W6PA 2JG8B 2CR8A 3WQ7A 1QQP1 1OI6A 1S24A 4KWLA 2KN9A 1BRFA 4P9WA 4BHPA 1SCSA 2KA3A 3M3OA 2PAEA 5IK7A 4WM8A 4Q2FA <