4RXNA

Crystallographic refinement of rubredoxin at 1.2 angstroms resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
54
structure length
54
Chain Sequence
b'MKKYTCTVCGYIYDPEDGDPDDGVNPGTDFKDIPDDWVCPLCGVGKDEFEEVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Crystallographic refinement of rubredoxin at 1 x 2 A degrees resolution.
pubmed doi rcsb
source organism Clostridium pasteurianum
molecule tags Electron transfer(iron-sulfur protein)
total genus 8
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1984-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4rxnA00
1YK5A 4ME3A 1LKPA 1ZRPA 2PVXA 1B13A 3RZTA 1RDGA 1BRFA 4AR3A 3KYVA 1B2JA 1FHHA 2QL0A 2DSXA 2PVEA 1R0JA 1RB9A 1CADA 1BQ9A 3QVDA 4AR6A 4TPUA 6RXNA 4K9FA 1BQ8A 3KYUA 1CAAA 4AR4A 1IRNA 7RXNA 1YUZA 1BFYA 1E8JA 4YWMA 1FHMA 1DVBA 1RYTA 3RYGA 1JYBA 1LTLA 1RDVA 2LCQA 1R0GA 2PYAA 3PZAA 1T9OA 2V3BB 4RXNA 3MPSA 4AR5A 1NNQA 1QCVA 1C09A 2VL6A 5IY0A 3KYWA 1R0FA 1DX8A 4YWLA 2KN9A 2RDVA 3KYXA 1SMMA 1B71A 3A44A 5AI3A 1QYBA 1T9PA 1LKMA 1IU5A 1RWDA 2M4YA 1YV1A 1B2OA 1IU6A 4POGA 2MS3A 8RXNA 1S2ZA 1H7VA 1SMUA 2KKDA 1YK4A 1VCXA 4POFA 2K2DA 1R0IA 3SS2A 5RXNA 1T9QA 1YUXA 1R0HA 1LKOA 2GMGA 3RZ6A 1S24A 1IROA 2HR5A 5AI2A 1BE7A 1S30A 3PWFA 3KYYA 1SMWA
chains in the Genus database with same CATH superfamily
1YK5A 4ME3A 2NYDA 2B5ID 2V0EA 2PVXA 1B13A 4AHXA 5FLML 3ZG6A 1I3QL 1RDGA 4AR3A 1FHHA 1WJVA 5MFZA 2AYJA 1CADA 5GAHc 2H12A 4A3JL 4TPUA 1VZHA 3HOUL 3GTPL 4V196 2C6BA 2WB1P 4K9FA 4C3IL 3PIO1 3HOWL 4C3JL 1F4LA 3GTQL 1I50L 2ERSA 1RDVA 2LCQA 2A6HD 1R0GA 3LWVB 2A68D 2BE5D 3GTJL 4TVMA 2WAQP 2CR8A 4RXNA 5AN9H 3I4NL 5GADc 2EY4E 3S2DL 4AR5A 4AI3A 5IY0A 1PFYA 3KYWA 1R0FA 1DX8A 5M5YL 3HOXL 2KN9A 4BBRL 3A44A 3P8BA 1PFUA 1IU5A 4A3IL 3PO3L 1YV1A 1B2OA 2MS3A 4C2M1 3LWQB 5MLC3 1IW7D 4GS7D 2PMZP 2R92L 1VCXA 2E2HL 4POFA 2K2DA 3QQCE 1R0HA 5EINC 3NFPI 1LKOA 2GMGA 4A3ML 5C4JL 1BE7A 1S30A 3S1QL 1SMWA 3FDJA 1LKPA 4A3BL 3LNLA 3RZDL 4A93L 3RZTA 2J9UB 2AUSB 5M3ML 5K2ME 5IP9L 3JR7A 2R93L 1NXEA 1RB9A 4JAGA 1BQ9A 4LHNA 3FKIL 4BY1L 1Z92B 2V0FA 3GTLL 2A69D 1TWGL 1IRNA 1YUZA 1BFYA 4YWMA 2AQCA 1DVBA 2NVYL 5IYBL 3S1RL 2JA8L 5MGNA 1LTLA 4JAFA 2PYAA 2E2IL 2E2JL 5C44L 1SFOL 5IYDL 1NNQA 1C09A 5DM71 4U671 3J7Z1 4G6BA 5IP7L 3PL5A 4XXBB 1OWCA 2C6AA 5MF6A 1R9TL 1B71A 3CQZL 2B63L 1PFVA 1LKMA 5IYCL 3LWPB 1IU6A 2Y0SP 1I6HL 8RXNA 1S2ZA 1H7VA 4WFN1 2APOB 3M3YL 1R0IA 4BY7L 1S24A 3HJWB 2XJQA 5C4XL 4AYBP 4BXXL 1OWBA 2ZIXA 3S17L 1BRFA 1B2JA 2QL0A 3S15L 4UY81 1R0JA 5FJ8L 3HOVL 4AR6A 1ODHA 3PIP1 2XJSA 1BQ8A 1CAAA 2L0ZA 2NVXL 3S16L 1NXGA 5JVG1 3S14L 4Y7NL 3S1NL 1TWFL 4ZN3B 2Z3RB 2O5JD 3PO2L 3HOZL 3H9BA 3RYGA 1JYBA 3H99A 3WWNB 5GAGc 2R7ZL 2M6OA 4AI0A 3S2HL 2V3BB 3LPEB 4ZN1B 3MPSA 1QCVA 1VZGA 3H3VM 1P7PA 2NVQL 3MQKB 5JVH1 1PFWA 4A3GL 4YWLA 2JA7L 1WCML 2RDVA 3KYXA 1TWCL 5DM61 1TWHL 3B0AB 4X6AL 5AI3A 1QYBA 3GTGL 4AI1A 3HAXC 4AHYA 4Y52L 5MFPA 3IU3I 4POGA 2M6PA 1SMUA 2KKDA 1YK4A 2VUML 2JI1A 3PKIA 5EIOC 3J7Y1 3SS2A 1T9QA 3PKJA 1YUXA 2YU9L 3RZ6A 2HR5A 1IROA 5AI2A 2PSMC 3H97A 3KYYA 4JADA 2JA5L 3GTOL 1Y1VL 1ZRPA 3HOYL 2NVTL 2HVYC 3S1ML 1K83L 4A3KL 2XJPA 4XGHA 5M3FL 4E6YA 2Z3QB 3H9CA 1Y1WL 3KYVA 3M4OL 2JI2A 3MSUA 2DSXA 2PVEA 1TWAL 3QVDA 4AI2A 2JI3A 6RXNA 3K35A 4A3LL 3KYUA 4JAEA 3B08B 4AR4A 4C3HL 3RZOL 7RXNA 4A3EL 4A3FL 1PZXA 4LHLA 1E8JA 3GTKL 1FHMA 4AHWA 5GAEc 1RYQA 1RYTA 1VZIA 3LWRB 5M5XL 3PZAA 1T9OA 1QQTA 2XJUA 2VL6A 4AHZA 5C3EL 4A3DL 2PPTA 3HKZP 4BBSL 3P2AA 1SMMA 2XJRA 3WWLA 1T9PA 3K7AL 2JA6L 2CKCA 3LWOB 4B8CD 1RWDA 2M4YA 3HJYB 3VPBE 2M4VA 3I4ML 2CKAA 4QIWP 4A3CL 2A6ED 3H0GL 2XJTA 5RXNA 5M5WL 2ERJA 3GTML 2XJVA 3PWFA 5H1Sc 2RFKB
chains in the Genus database with same CATH topology
1YK5A 4ME3A 2NYDA 1LKPA 2XJQA 1ZRPA 3LNLA 2B5ID 2V0EA 2PVXA 1B13A 4AHXA 1OWBA 2XJPA 3ZG6A 4XGHA 2ZIXA 4E6YA 3RZTA 2J9UB 1RDGA 1BRFA 2Z3QB 4AR3A 3KYVA 1B2JA 2JI2A 3MSUA 1FHHA 2QL0A 5K2ME 2DSXA 4UY81 1WJVA 1NXEA 2PVEA 5MFZA 2AYJA 1R0JA 1RB9A 1CADA 5GAHc 4JAGA 1BQ9A 3QVDA 4LHNA 4AI2A 2JI3A 2H12A 4AR6A 4TPUA 1VZHA 6RXNA 3K35A 3PIP1 1ODHA 4V196 1Z92B 2C6BA 2XJSA 2V0FA 4K9FA 1BQ8A 3KYUA 4JAEA 2A69D 3PIO1 1CAAA 3B08B 2L0ZA 4AR4A 1NXGA 1IRNA 7RXNA 5JVG1 1YUZA 4LHLA 4ZN3B 1BFYA 1E8JA 2Z3RB 4YWMA 1FHMA 1DVBA 4AHWA 5GAEc 2O5JD 1RYQA 1RYTA 1VZIA 3RYGA 5GAGc 1JYBA 3WWNB 2ERSA 5MGNA 1LTLA 1RDVA 2LCQA 4JAFA 2A6HD 1R0GA 2PYAA 2BE5D 2A68D 2M6OA 3PZAA 1T9OA 4AI0A 2V3BB 4TVMA 2XJUA 3LPEB 2CR8A 4RXNA 5AN9H 5GADc 4ZN1B 3MPSA 4AR5A 1NNQA 1QCVA 1VZGA 1C09A 2VL6A 4AI3A 5IY0A 3KYWA 5DM71 4U671 3J7Z1 1R0FA 1DX8A 4G6BA 5JVH1 4XXBB 1OWCA 4YWLA 4AHZA 2C6AA 2KN9A 5MF6A 2RDVA 3KYXA 2PPTA 5DM61 3P2AA 1SMMA 1B71A 2XJRA 3B0AB 3WWLA 3A44A 5AI3A 1QYBA 1T9PA 4AI1A 3P8BA 2CKCA 1LKMA 1IU5A 4B8CD 4AHYA 1RWDA 2M4YA 5MFPA 1YV1A 1B2OA 1IU6A 3IU3I 4POGA 2MS3A 2M6PA 8RXNA 1S2ZA 3VPBE 5MLC3 1SMUA 1IW7D 4GS7D 2KKDA 4WFN1 1H7VA 1YK4A 2M4VA 2CKAA 1VCXA 2JI1A 2A6ED 3PKIA 4POFA 5EIOC 2K2DA 1R0IA 2XJTA 3J7Y1 3SS2A 5RXNA 1T9QA 3QQCE 3PKJA 1YUXA 1R0HA 5EINC 3NFPI 2GMGA 1LKOA 3RZ6A 2ERJA 1S24A 1IROA 2HR5A 2XJVA 5AI2A 1BE7A 2PSMC 1S30A 3PWFA 5H1Sc 3KYYA 4JADA 1SMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YK5 A;  4ME3 A;  1LKP A;  1ZRP A;  2PVX A;  1B13 A;  3RZT A;  1RDG A;  1BRF A;  4AR3 A;  3KYV A;  1B2J A;  1FHH A;  2QL0 A;  2DSX A;  2PVE A;  1R0J A;  1RB9 A;  1CAD A;  1BQ9 A;  3QVD A;  4AR6 A;  4TPU A;  6RXN A;  4K9F A;  1BQ8 A;  3KYU A;  1CAA A;  4AR4 A;  1IRN A;  7RXN A;  1YUZ A;  1BFY A;  1E8J A;  4YWM A;  1FHM A;  1DVB A;  1RYT A;  3RYG A;  1JYB A;  1LTL A;  1RDV A;  2LCQ A;  1R0G A;  2PYA A;  3PZA A;  1T9O A;  2V3B B;  4RXN A;  3MPS A;  4AR5 A;  1NNQ A;  1QCV A;  1C09 A;  2VL6 A;  5IY0 A;  3KYW A;  1R0F A;  1DX8 A;  4YWL A;  2KN9 A;  2RDV A;  3KYX A;  1SMM A;  1B71 A;  3A44 A;  5AI3 A;  1QYB A;  1T9P A;  1LKM A;  1IU5 A;  1RWD A;  2M4Y A;  1YV1 A;  1B2O A;  1IU6 A;  4POG A;  2MS3 A;  8RXN A;  1S2Z A;  1H7V A;  1SMU A;  2KKD A;  1YK4 A;  1VCX A;  4POF A;  2K2D A;  1R0I A;  3SS2 A;  5RXN A;  1T9Q A;  1YUX A;  1R0H A;  1LKO A;  2GMG A;  3RZ6 A;  1S24 A;  1IRO A;  2HR5 A;  5AI2 A;  1BE7 A;  1S30 A;  3PWF A;  3KYY A;  1SMW A; 
#chains in the Genus database with same CATH topology
 1YK5 A;  4ME3 A;  2NYD A;  2B5I D;  2V0E A;  2PVX A;  1B13 A;  4AHX A;  5FLM L;  3ZG6 A;  1I3Q L;  1RDG A;  4AR3 A;  1FHH A;  1WJV A;  5MFZ A;  2AYJ A;  1CAD A;  5GAH c;  2H12 A;  4A3J L;  4TPU A;  1VZH A;  3HOU L;  3GTP L;  4V19 6;  2C6B A;  2WB1 P;  4K9F A;  4C3I L;  3PIO 1;  3HOW L;  4C3J L;  1F4L A;  3GTQ L;  1I50 L;  2ERS A;  1RDV A;  2LCQ A;  2A6H D;  1R0G A;  3LWV B;  2A68 D;  2BE5 D;  3GTJ L;  4TVM A;  2WAQ P;  2CR8 A;  4RXN A;  5AN9 H;  3I4N L;  5GAD c;  2EY4 E;  3S2D L;  4AR5 A;  4AI3 A;  5IY0 A;  1PFY A;  3KYW A;  1R0F A;  1DX8 A;  5M5Y L;  3HOX L;  2KN9 A;  4BBR L;  3A44 A;  3P8B A;  1PFU A;  1IU5 A;  4A3I L;  3PO3 L;  1YV1 A;  1B2O A;  2MS3 A;  4C2M 1;  3LWQ B;  5MLC 3;  1IW7 D;  4GS7 D;  2PMZ P;  2R92 L;  1VCX A;  2E2H L;  4POF A;  2K2D A;  3QQC E;  1R0H A;  5EIN C;  3NFP I;  1LKO A;  2GMG A;  4A3M L;  5C4J L;  1BE7 A;  1S30 A;  3S1Q L;  1SMW A;  3FDJ A;  1LKP A;  4A3B L;  3LNL A;  3RZD L;  4A93 L;  3RZT A;  2J9U B;  2AUS B;  5M3M L;  5K2M E;  5IP9 L;  3JR7 A;  2R93 L;  1NXE A;  1RB9 A;  4JAG A;  1BQ9 A;  4LHN A;  3FKI L;  4BY1 L;  1Z92 B;  2V0F A;  3GTL L;  2A69 D;  1TWG L;  1IRN A;  1YUZ A;  1BFY A;  4YWM A;  2AQC A;  1DVB A;  2NVY L;  5IYB L;  3S1R L;  2JA8 L;  5MGN A;  1LTL A;  4JAF A;  2PYA A;  2E2I L;  2E2J L;  5C44 L;  1SFO L;  5IYD L;  1NNQ A;  1C09 A;  5DM7 1;  4U67 1;  3J7Z 1;  4G6B A;  5IP7 L;  3PL5 A;  4XXB B;  1OWC A;  2C6A A;  5MF6 A;  1R9T L;  1B71 A;  3CQZ L;  2B63 L;  1PFV A;  1LKM A;  5IYC L;  3LWP B;  1IU6 A;  2Y0S P;  1I6H L;  8RXN A;  1S2Z A;  1H7V A;  4WFN 1;  2APO B;  3M3Y L;  1R0I A;  4BY7 L;  1S24 A;  3HJW B;  2XJQ A;  5C4X L;  4AYB P;  4BXX L;  1OWB A;  2ZIX A;  3S17 L;  1BRF A;  1B2J A;  2QL0 A;  3S15 L;  4UY8 1;  1R0J A;  5FJ8 L;  3HOV L;  4AR6 A;  1ODH A;  3PIP 1;  2XJS A;  1BQ8 A;  1CAA A;  2L0Z A;  2NVX L;  3S16 L;  1NXG A;  5JVG 1;  3S14 L;  4Y7N L;  3S1N L;  1TWF L;  4ZN3 B;  2Z3R B;  2O5J D;  3PO2 L;  3HOZ L;  3H9B A;  3RYG A;  1JYB A;  3H99 A;  3WWN B;  5GAG c;  2R7Z L;  2M6O A;  4AI0 A;  3S2H L;  2V3B B;  3LPE B;  4ZN1 B;  3MPS A;  1QCV A;  1VZG A;  3H3V M;  1P7P A;  2NVQ L;  3MQK B;  5JVH 1;  1PFW A;  4A3G L;  4YWL A;  2JA7 L;  1WCM L;  2RDV A;  3KYX A;  1TWC L;  5DM6 1;  1TWH L;  3B0A B;  4X6A L;  5AI3 A;  1QYB A;  3GTG L;  4AI1 A;  3HAX C;  4AHY A;  4Y52 L;  5MFP A;  3IU3 I;  4POG A;  2M6P A;  1SMU A;  2KKD A;  1YK4 A;  2VUM L;  2JI1 A;  3PKI A;  5EIO C;  3J7Y 1;  3SS2 A;  1T9Q A;  3PKJ A;  1YUX A;  2YU9 L;  3RZ6 A;  2HR5 A;  1IRO A;  5AI2 A;  2PSM C;  3H97 A;  3KYY A;  4JAD A;  2JA5 L;  3GTO L;  1Y1V L;  1ZRP A;  3HOY L;  2NVT L;  2HVY C;  3S1M L;  1K83 L;  4A3K L;  2XJP A;  4XGH A;  5M3F L;  4E6Y A;  2Z3Q B;  3H9C A;  1Y1W L;  3KYV A;  3M4O L;  2JI2 A;  3MSU A;  2DSX A;  2PVE A;  1TWA L;  3QVD A;  4AI2 A;  2JI3 A;  6RXN A;  3K35 A;  4A3L L;  3KYU A;  4JAE A;  3B08 B;  4AR4 A;  4C3H L;  3RZO L;  7RXN A;  4A3E L;  4A3F L;  1PZX A;  4LHL A;  1E8J A;  3GTK L;  1FHM A;  4AHW A;  5GAE c;  1RYQ A;  1RYT A;  1VZI A;  3LWR B;  5M5X L;  3PZA A;  1T9O A;  1QQT A;  2XJU A;  2VL6 A;  4AHZ A;  5C3E L;  4A3D L;  2PPT A;  3HKZ P;  4BBS L;  3P2A A;  1SMM A;  2XJR A;  3WWL A;  1T9P A;  3K7A L;  2JA6 L;  2CKC A;  3LWO B;  4B8C D;  1RWD A;  2M4Y A;  3HJY B;  3VPB E;  2M4V A;  3I4M L;  2CKA A;  4QIW P;  4A3C L;  2A6E D;  3H0G L;  2XJT A;  5RXN A;  5M5W L;  2ERJ A;  3GTM L;  2XJV A;  3PWF A;  5H1S c;  2RFK B; 
#chains in the Genus database with same CATH homology
 1YK5 A;  4ME3 A;  2NYD A;  1LKP A;  2XJQ A;  1ZRP A;  3LNL A;  2B5I D;  2V0E A;  2PVX A;  1B13 A;  4AHX A;  1OWB A;  2XJP A;  3ZG6 A;  4XGH A;  2ZIX A;  4E6Y A;  3RZT A;  2J9U B;  1RDG A;  1BRF A;  2Z3Q B;  4AR3 A;  3KYV A;  1B2J A;  2JI2 A;  3MSU A;  1FHH A;  2QL0 A;  5K2M E;  2DSX A;  4UY8 1;  1WJV A;  1NXE A;  2PVE A;  5MFZ A;  2AYJ A;  1R0J A;  1RB9 A;  1CAD A;  5GAH c;  4JAG A;  1BQ9 A;  3QVD A;  4LHN A;  4AI2 A;  2JI3 A;  2H12 A;  4AR6 A;  4TPU A;  1VZH A;  6RXN A;  3K35 A;  3PIP 1;  1ODH A;  4V19 6;  1Z92 B;  2C6B A;  2XJS A;  2V0F A;  4K9F A;  1BQ8 A;  3KYU A;  4JAE A;  2A69 D;  3PIO 1;  1CAA A;  3B08 B;  2L0Z A;  4AR4 A;  1NXG A;  1IRN A;  7RXN A;  5JVG 1;  1YUZ A;  4LHL A;  4ZN3 B;  1BFY A;  1E8J A;  2Z3R B;  4YWM A;  1FHM A;  1DVB A;  4AHW A;  5GAE c;  2O5J D;  1RYQ A;  1RYT A;  1VZI A;  3RYG A;  5GAG c;  1JYB A;  3WWN B;  2ERS A;  5MGN A;  1LTL A;  1RDV A;  2LCQ A;  4JAF A;  2A6H D;  1R0G A;  2PYA A;  2BE5 D;  2A68 D;  2M6O A;  3PZA A;  1T9O A;  4AI0 A;  2V3B B;  4TVM A;  2XJU A;  3LPE B;  2CR8 A;  4RXN A;  5AN9 H;  5GAD c;  4ZN1 B;  3MPS A;  4AR5 A;  1NNQ A;  1QCV A;  1VZG A;  1C09 A;  2VL6 A;  4AI3 A;  5IY0 A;  3KYW A;  5DM7 1;  4U67 1;  3J7Z 1;  1R0F A;  1DX8 A;  4G6B A;  5JVH 1;  4XXB B;  1OWC A;  4YWL A;  4AHZ A;  2C6A A;  2KN9 A;  5MF6 A;  2RDV A;  3KYX A;  2PPT A;  5DM6 1;  3P2A A;  1SMM A;  1B71 A;  2XJR A;  3B0A B;  3WWL A;  3A44 A;  5AI3 A;  1QYB A;  1T9P A;  4AI1 A;  3P8B A;  2CKC A;  1LKM A;  1IU5 A;  4B8C D;  4AHY A;  1RWD A;  2M4Y A;  5MFP A;  1YV1 A;  1B2O A;  1IU6 A;  3IU3 I;  4POG A;  2MS3 A;  2M6P A;  8RXN A;  1S2Z A;  3VPB E;  5MLC 3;  1SMU A;  1IW7 D;  4GS7 D;  2KKD A;  4WFN 1;  1H7V A;  1YK4 A;  2M4V A;  2CKA A;  1VCX A;  2JI1 A;  2A6E D;  3PKI A;  4POF A;  5EIO C;  2K2D A;  1R0I A;  2XJT A;  3J7Y 1;  3SS2 A;  5RXN A;  1T9Q A;  3QQC E;  3PKJ A;  1YUX A;  1R0H A;  5EIN C;  3NFP I;  2GMG A;  1LKO A;  3RZ6 A;  2ERJ A;  1S24 A;  1IRO A;  2HR5 A;  2XJV A;  5AI2 A;  1BE7 A;  2PSM C;  1S30 A;  3PWF A;  5H1S c;  3KYY A;  4JAD A;  1SMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...