4POFA

Pfmcm n-terminal domain without dna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
255
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication, dna binding protein
molecule keywords Cell division control protein 21
publication title A conserved MCM single-stranded DNA binding element is essential for replication initiation.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 60
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4pofA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4pofA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4pofA01
3G4SA 1KL9A 5M5XH 2R93H 5C3EH 3GTOH 2EXDA 4LFAL 4JBKA 2UXCL 3GTGH 4A93H 4ME3A 5C44H 4KHZA 1SMWA 3WWVA 2Y0SE 8RXNA 1VQMA 2JA9A 2VQFQ 1PA6A 4L5RC 2LXKA 1S3OA 5IYCH 1RDGA 4DR1L 4BBSG 4OO1G 3CD6A 1IBKL 3S16H 1N33Q 5LMUL 2K4KA 3T1HL 5AJ3L 1Y1VH 1WYDA 1PHJA 1JB7A 3GTLH 1PH7A 3H3VH 3H0GG 3MEFA 3ZJYC 5M5YH 4X66Q 5FJ8G 3M4OH 4LUVA 3J81c 2E2IH 3NBHB 2ID0A 1I94L 1YUXA 4BY7G 2EIFA 1VQLA 3K81C 1BQ9A 4PMWA 3KF6B 1VQHA 1EIFA 1BRFA 2PVEA 4OWXB 4AH6A 1PH9A 1HR0L 2N49A 2VY3A 1IBMQ 4BY1G 2JA5H 3CCLA 3FKIH 4BXXG 4DR6Q 1Q7YC 4NXNL 1VCXA 1DVBA 5C3EG 2R93G 1Q1EA 2VQEL 2N8NA 1QZGA 4JI3Q 4A93G 5EAYA 4A3LH 3RLNA 1EFWA 3L7ZC 4YY3Q 3J7A5 1NTGA 5C4JH 1PVOA 1FHHA 2K5HA 4P74A 1OXSC 5E7NA 3CC7A 4DR2Q 1S40A 3PO2H 1N32Q 4JI4Q 3HOVH 1ZRPA 1K8AC 2YTYA 3DM3A 4JYAQ 2DGYA 1LKPA 1IYJB 4R4CA 2VNUD 2ZM6L 1Y1VG 3HOWH 3U4VA 1YJNA 2NVTH 3I7FA 2WAQG 1SMUA 4JBWA 4DR4Q 1MJCA 5H1SE 1VQKA 3I4NH 1TWAH 2UXDQ 3B6YA 4K9FA 4LF5L 1NY4A 4DAYB 5IY0A 4P71A 5FLMH 4JV5L 2JA5G 2V3BB 2R7DA 1HNZL 1YBYA 4YHHL 1HZBA 1UE5A 4JI7L 1NE3A 1FL0A 1GD7A 1KD1C 2Z6KC 4H02A 4QY7A 3TEHB 2OCEA 1HNWL 3KOJA 4DV6L 1VQBA 2BA0A 1VQEA 3MXNB 4FDBA 3A5UA 3PO2G 3CC2A 1Q86C 4L5SA 5ELOA 4POFA 1RWDA 3JAMi 3F2DA 3G48A 1I5FA 4RG1A 3G71A 1RDVA 3HOVG 4LNQA 4DR1Q 5LMNL 1IBKQ 2E2HH 4TVAB 2R7FA 1YHBA 3ULPA 3T1HQ 4GKKL 1PH2A 3U50C 3GDEA 3TS0A 1L1OB 2QEXA 4HIOA 5JJLA 3I4NG 3CF5A 1U0LA 1XPOA 4OXPA 2VQFL 2A19A 4B3RL 4GNXA 2JK8A 2XGTA 1I94Q 1UWVA 4IPDA 1E8JA 3K8AA 1HNXQ 2HT1A 2UXBQ 1S72A 5RXNA 3CP0A 5IP7H 1N33L 4A3GH 4DV0L 2ATWA 2UUAQ 4GKJQ 3ULJA 3PIOA 1BBUA 1V43A 1YJWA 3RZTA 1MJEA 2PI2E 1G6PA 4WJ4A 4X66L 2BH2A 3AEVA 4NXNQ 3W5OA 3S17H 2VQEQ 3GTPH 2K5VA 1SMXA 2H5XA 3I2ZA 1C9OA 1B8AA 1TWCH 3GD7A 4DK3C 1CKNA 1YHAA 1UE1A 3AYHB 1R0GA 1I3QH 1XPUA 1PH4A 1IBML 4EQ5A 2JA7H 1X3EA 2GVBA 1QUQA 3STBD 4R4TA 2WB1G 1VQPA 1HZAA 2KCTA 1LTLA 3ICEA 4JI3L 2ZM6Q 2Z6KA 1PH8A 4A3DG 3MPSA 4UP7A 3JC62 1KC8C 4YY3L 1B7YB 1L0WA 2Q2IA 2ZJQA 1N32L 4JI8Q 1PH6A 2MFIA 4JI0L 3CW2C 1X3FA 3IRBA 3Q8DA 1Z9FA 4JC0A 4JBMA 4JYAL 4A3GG 5IP7G 5JJKA 2QA4A 4LF5Q 3SS2A 2VUMH 4LFBL 3UE1A 1PV4A 3CCMA 4C3IH 5GADC 1VQ4A 1SFOH 3DLLA 1T9OA 1PH3A 1Q1BA 2Q2HA 3KYVA 4OX9Q 1W2BA 4Y52H 3S1NH 2IHEA 1XNQQ 4YHHQ 4JI7Q 4IJHA 4MTNA 1PFSA 3M85A 4DR4L 1EYGA 1SRUA 3RZ6A 1X9NA 3H15A 4R4QA 4X6AH 5M3FH 3J80c 4UP9A 3RYGA 3J7ZC 3GTJH 1HZCA 2R7ZH 4PG3A 2WFWA 1HJPA 2JA7G 1S30A 3F2BA 1NNQA 4YWLA 2JEAI 2NN6I 2NZHA 5GAGC 1K0RA 2OWOA 2I5LX 2OQKA 4GKKQ 2MQHA 2NVYH 5JEAG 1V9PA 1CSQA 2BH8A 2D0PA 4A76A 1KRSA 4GLXA 3ERSX 3KLWA 4MNOA 4A3MH 5JJIA 4B3RQ 4HJ9A 4LF4L 5M3MH 4X65L 1PYBA 3M9BA 1HZ9A 4NXMQ 2VUMG 1OXTA 3HKZE 4DV0Q 4JI6Q 2AWOA 1A0IA 4AIMA 4BBRG 1VQ9A 3T1YL 2XTIA 3PUVA 1CKMA 1YZ6A 1AH9A 5C0XI 1KQSA 4J15A 2UXBL 1HNXL 1RYTA 3CCVA 1OXXK 5M3FG 2B29A 1NMGA 2UUAL 1NMFA 1XJVA 3CAMA 2YTXA 3PO3H 1BKBA 1HH2P 2JA8G 1MIUA 1U5KA 1YEZA 3GTMH 4JI1Q 2RCNA 3F8TA 3AFQA 4LF9L 2JQOA 1LUZA 2Y0SG 1VQ5A 3K0XA 4OONA 4DUZL 5C44G 1BQ8A 1LYLA 4A3CH 4A3MG 3M7NA 4RXNA 4KLKA 2PNHA 1YIJA 3A0JA 1CSPA 4GNXC 3HOYH 4IFDI 1IBLL 5M3MG 4JI0Q 5IYCG 1N36L 1UE6A 4YWMA 4BA2I 3PGZA 5GQOA 1P8LA 2ZJRA 3OTOL 2UU9L 5C0XJ 1YVCA 4LFBQ 2IY5B 1IZ6A 1LM0A 2C35B 1IXRA 1JT8A 2R6GA 4R1JA 5IYBH 1X65A 4GS3A 4DV2L 1SN8A 1H7VA 1VQAA 5GAEC 4NB3A 4JI8L 3CCRA 3UDXA 1JE5A 2CWAA 4R4IA 4P72A 2YTVA 1E3PA 4HIDA 1CAAA 4ALPA 1C7YA 1A8VA 1I50H 3KDFA 3TQYA 1T9HA 4KI0A 2D0OA 4OX9L 3PO3G 1K8GA 1YV1A 2BA1A 3FKIG 2LXJA 3J81j 1YUZA 3BZKA 3E0EA 3CQZH 2ALYB 3CCQA 1WFQA 1JJCB 3OW2A 4UY8C 2ASBA 1XTDA 1M90C 2IT1A 1L2FA 3CMAA 4IFDJ 4A3LG 2K2DA 4IPGA 4DV5Q 3ER0A 2ZTEA 2HQLA 1OTCA 1BFYA 2I5MX 3J81i 5IT9c 5IWAQ 5LMNW 4K0KQ 3RLFA 4AR3A 1PH5A 3EIVA 4L5TA 3JC63 4LF4Q 4RMFA 4X65Q 3M4PA 4XIGS 4OO1I 1Y14B 1XMOL 1QVGA 4B3MQ 1R0JA 3I56A 1J5EQ 4LFCQ 3HOWG 4JI2L 4B3TQ 1EQQA 2K14A 3T1YQ 3RR5A 3F2CA 3TREA 2M4YA 4GOPC 3KYWA 3STBC 2CCZA 2OQ0A 1Q82C 1VQFA 5C4XH 1SE8A 2QGQA 4NXML 2ZJPA 5FLMG 3RN5A 1QZHA 1N34Q 4JI6L 3PWFA 5HY6A 1C09A 1KHIA 2PVXA 5BR8L 1RB9A 1Q46A 4AQYQ 4LF9Q 1B70B 2V1CC 3D0FA 4DV3L 4DR3Q 3CXCA 2VS1A 4A3FH 3S2HH 3UE0A 4DUZQ 2KBNA 2ES2A 1CADA 1UE7A 3CCJA 2KHJA 1Q12A 2B63H 1RL2A 2F4VQ 2CWPA 2WB1E 1IBLQ 2F52A 3K7AH 3A5ZB 3PSIA 4PZ8A 4A4IA 1N36Q 1V1QA 4JI1L 3CPWA 1XPRA 2UU9Q 3PF4A 3OTOQ 1VQ6A 1N9WA 3I55A 2WP8J 4DUYQ 1NBWA 4L5QA 2UUBL 1IRNA 2KENA 4DV2Q 4QIWE 3PUWA 3FHWA 2PMZE 1FJGQ 4IPCA 4A3KH 5C4XG 1KXLA 4QJFA 2IX1A 1B2JA 3KYHC 4X62L 3PF5A 1YJ9A 1AE3A 4Y7NH 1DGSA 2QL0A 1K83H 1MKHA 1IU6A 1WCMH 2N3SA 3PV0A 5DLQE 3U4ZA 5FLXc 5M5WH 3I4MH 4GOPA 4UPAA 1YHQA 2Q2UA 1T9QA 4A3FG 1SMMA 2IX0A 2EQSA 4DV4Q 2PQAA 3CCEA 4A3EH 4IJLA 2CQOA 2HIVA 2B63G 2VZAA 2MS3A 2KKDA 4O2DA 3CCUA 4DR5L 1JJ2A 3PUXA 2FXQA 4LF8Q 2LSSA 3HFZB 4AR4A 1SR3A 1WJJA 3EBEA 1XMOQ 4DNIA 1EIYB 2I5HA 2HHHL 4AYBG 1XNQL 5GAHC 1L1OA 2AHOB 4JI2Q 1LKMA 2VL6A 4DV5L 4EX5A 4B3SL 4OWTB 2AWNA 1B13A 2KHIA 4JOIA 4DAMA 5IWAL 1OXVA 4K0KL 1C0AA 2NZOA 1EWIA 4POGA 4GN3B 1ASZA 3TRZA 2JJQA 5FJ8H 1Q81C 4LFCL 4B3ML 3S1RH 3PCOB 4HJ8A 1J5EL 4MZ9A 3RZOH 4B3TL 3HOXH 4DV1Q 4BY7H 3PZAA 1OXUA 1WCMG 2RHQB 3K7UC 2K5NA 5J3BA 5BR8Q 4DPGA 1TWFH 5IE8A 4IPHA 1JMCA 4A3JH 3S14H 3KDFB 4DV3Q 1E7ZA 1WI5A 4A3EG 4BY1H 4BXXH 3E9IA 3CMEA 1GO3E 1VQOA 2JE6I 4R4OA 4PZ7A 1E1TA 1N34L 3KYUA 2KCMA 1X3GA 1HR0W 2R7ZG 1GM5A 4JI5Q 6RXNA 2RF4A 1E24A 2ZTDA 3JC66 1X56A 1VQDA 3KJOA 4AQYL 2E2JH 2Q2TA 1IROA 2IHFA 4DR3L 2YU9H 2B3GA 4WJ3M 3M3YH 2JA6H 2UUBQ 1X6OA 3NENA 4NPSA 5GROA 4DR7L 1E22A 3KFUA 2OTJA 2F4VL 1YK4A 3RZDH 1R0HA 1E1OA 3HKZG 1YK5A 1GKHA 1PYSB 3FP9A 4KHPL 1BE7A 1X54A 3K80C 3J80i 4DK6C 3AFPA 2JEBI 1B2OA 2WAQE 1QCVA 2ZTCA 1S2ZA 3BZCA 3W1GA 4X62Q 3JAMc 3HOXG 4DUYL 4GNXB 2E5LQ 3S24A 2VW9A 4A3JG 4LF7L 2NVQH 3PUYA 3NELA 4DV7Q 1FJGL 3S1QH 1AE2A 4TPUA 2E8GA 3KF8B 4HIKA 3U58A 1QYBA 4O0AA 4HJ5A 1KIXA 1TXYA 4C3HH 1Y1WH 4HIMA 1EUJA 3PUZA 4XTCS 3L0OA 1Q8KA 3NEMA 4HJAA 4DR5Q 1D7QA 1TWHH 2MO1A 2RDVA 4LW1A 4X64Q 2R92H 1CKNB 2HHHQ 1YITA 7RXNA 2JA6G 4TQUS 4DV4L 4IOAA 5IYDH 3QVDA 4LF6L 1A63A 4A3CG 4B3SQ 1QVFA 1QUQB 1GVPA 1A62A 2OTLA 3HOYG 2N78A 1IU5A 2GMGA 1H95A 4IO9A 4LUZA 2DSXA 4LF8L 2GN5A 3HKSA 1VQIA 3CC4A 1UEBA 1J6QA 1BBWA 4P75A 1K3RA 5IYBG 3OYYA 3VDYA 4UP8A 1NJIC 1XNRQ 1R0IA 1S24A 1FVIA 4OWWB 3HOUH 2A1AA 1N8RC 1XMQL 2YYZA 1X55A 4GN5A 5AI3A 3KF6A 2CKZB 1Y1WG 3KYXA 4GOPB 4GLVB 1JJGA 4AR5A 2L15A 2GVAA 4C3JH 4LFAQ 2UUCL 4DV1L 2UXCQ 2PQAB 4GKJL 2R92G 1FGUA 3CPFA 1VQCA 2NN6G 1L1OC 5JEAJ 1KRTA 3UDFA 5IYDG 4YWKA 3S15H 2A8VA 2LCQA 3CCSA 3KYYA 4JOIC 4APVA 5LMUQ 4DR7Q 5AJ3Q 4A3DH 1R0FA 1EOVA 1SLJA 5AI2A 3BJUA 4JCVE 2YV5A 4LWCA 4JI5L 1R9TH 1M1KC 4JBJA 3HOZH 3BU2A 4KHPQ 1JYBA 3KJPA 2MNAA 1W3SA 1Z47A 3RLOA 4LF7Q 4DKAC 3HOUG 2K75A 3F1ZA 3GTKH 3I4OA 3E9HA 4LUOA 5IP9H 5C0XG 2MO0A 4YCVA 1HR0Q 3H3VI 4AR6A 4A3IH 1IL2A 3A74A 3S1MH 1RIPA 3EN2A 1VQGA 1WOCA 2E5LL 3W1BA 2NVXH 4YCWA 3G6EA 1BVSA 2AKWB 4IOCA 2KN9A 4BA1I 3GTQH 1VQ8A 2PI2A 4GLAC 4A3BH 2RHSB 3TS2A 1G291 3ULLA 1O7IA 1EQRA 1G51A 5HGQA 4DV7L 2AMCB 5ELNA 2K52A 4DR6L 1CUKA 4LF6Q 3AQQA 1VS0A 1YNXA 3RN2A 1YI2A 1P16A 4C2MH 3HOZG 1SROA 2Z0SA 4GN4B 4AYBE 4X64L 4DR2L 4IFDG 4QQBX 1PH1A 4JI4L 2CFMA 4HJ7A 1I6HH 4PZ6A 1KAWA 1VQNA 4BBSH 3L2PA 1DX8A 3A44A 1CKOA 3GO5A 1TWGH 3LGJA 1K73C 1VQJA 5IP9G 3S2DH 4JV5Q 4BBRH 1T9PA 1D8LA 2HR5A 4A3KG 1XMQQ 4JG2A 4A3IG 1HNZQ 3RNUA 2DUDA 2PYAA 3H0GH 4A75A 1FHMA 4YCUA 4QGUA 1QVCA 2UXDL 1HNWQ 1VCIA 4P73A 2I0QA 3UDGA 5K36G 2K50A 1VQ7A 3D31A 3PIPA 4DV6Q 1LKOA 1ASYA 2HIXA 2UUCQ 3I4MG 3UDIA 4A3BG 1XNRL 4QL5A 1B71A 3M4QA 3SGIA 5LMNQ 2JA8H 1K9MC 2D62A 2F3IA
chains in the Genus database with same CATH superfamily
2B8FA 4HMJA 5C3EH 2EXDA 3GTOH 2UXCL 4ME3A 1ONLA 4KHZA 5C44H 4CJ2C 5JJZA 2E2DC 4AI0A 1WTPA 4OO1G 1KNEA 5ELCA 3GV3A 2WIIB 2RSOA 3V05A 1AN8A 4UDUC 1PH7A 3P20A 4HAEA 3ZJYC 5FJ8G 3NBHB 3U9SA 2EIFA 3KF6B 3MQKB 4N9TA 1Q3LA 2JA5H 2VY3A 3AU7A 1ET6A 1VF7A 1MSHA 2N8NA 1WTHA 1TY0A 2RA4A 4L63B 5D3IB 3J7A5 3PO2H 2D2CC 4P74A 2PCFB 4JI4Q 4QMGA 1K8AC 2KVMA 2NVXL 5J22A 1EY0A 4JYAQ 2DGYA 4R4CA 2PZWA 4B08A 2NBFA 3HOWH 1ODHA 1PMRA 1YJNA 1TS4A 2WAQG 1SMUA 2F0WA 2OEOA 5H1SE 1VQKA 3I4NH 1TWAH 3S1NB 5AFWA 2MP1A 3T4AC 4LF5L 4DAYB 1ICWA 4K5XA 4KV6A 1VZGA 4JV5L 4ME5A 3CRKC 1Q90A 2AQCA 1HZBA 3NP8A 3J7AV 1GD7A 1KD1C 4H02A 3TEHB 3LWEA 4XT3B 2HD3A 3MXNB 1VQEA 4E6YA 3M4YA 4N8FA 1SNMA 1Q86C 3JAMi 3HOVG 3F2DA 1RDVA 5KRUA 5ELEA 2V0EA 4DR1Q 5MFPA 2E2HH 1DONA 4FNFA 3LWVB 3PMFA 3U50C 3D6WA 3HEJA 1L1OB 2JA8L 4U68A 5JJLA 1ZKOA 3CF5A 1XPOA 4OXPA 2BOSA 2UXBQ 4IPDA 1LLRD 5RXNA 3CP0A 1N33L 2G9DA 4A3ML 5J39A 2ZT9C 1LTGD 1SJED 5M3ML 1YJWA 2PSMC 4WJ4A 4X66L 4NXNQ 3W5OA 5FO8B 4DK1A 3BVMA 1WCMB 3GTPH 2H5XA 3CKIB 1BBXC 2ERJA 2NUCA 3M4OL 2E2IL 1XPUA 4V0BA 5C6AA 5LL6S 1X3EA 2KOLA 5M3FB 1M8AA 1LTLA 4C1NI 3P1HA 4A3DG 4UP7A 4EGVA 3HZXA 1B7YB 5JEAH 1RJTA 4JI8Q 1PH6A 1Z9FA 2HDMA 4A3LL 4ZUIA 2VUMH 4CKBA 3D6CA 4DA2A 4K6DA 1T9OA 1Q1BA 4Y52H 4JI7Q 1PFSA 2XJQA 3DWQA 4WFN1 4IUPA 2JI3A 3DXJC 1TWFB 3S14B 5BN3A 5IOCA 3GTJH 1HZCA 2R7ZH 4FYDA 4KJNA 5JOBA 1Y8PB 3I90A 2B2WC 1SE2A 1I50L 1NXGA 4MTKA 2OWOA 1PTOF 1EQVA 1CSQA 4A3MH 2M4VA 1KRSA 3ERSX 4MNOA 3EVQA 4B3RQ 4HJ9A 2JA6B 5M3MH 3M9BA 2IJ0A 2KUMA 4DV0Q 3HOYB 2AWOA 4RCOA 4BBRG 1O7LA 3IFDA 4HMIA 4AI1A 1II3A 1CKMA 1YZ6A 1KQSA 2QW7A 4ZKBB 5A2QE 3A54A 3DMUA 1RYTA 3IFTA 3TSSA 3WWNB 3C46A 2YTXA 1SMYC 1P7PA 2CKAA 1U5KA 5C3WA 3GTMH 2RCNA 3AFQA 1S5DD 1LUZA 4PNYA 4OONA 5CC4A 5C44G 1WTWA 4IUUA 1PFVA 5IGDA 5M9OA 4RXNA 1YIJA 4JI0Q 2ZJRA 5GQOA 4LFBQ 1S5BD 1JT8A 2R6GA 1I3QL 1X65A 3NUCA 4GS3A 2JA7L 1SN8A 5GAEC 3CCRA 4G4KA 3H97A 4R4IA 2YTVA 4EQPA 4ALPA 4HIDA 2L55A 1HQMC 1C7YA 1I50H 5GAGc 3KDFA 3HOUB 2D0OA 3RMHA 2BDNA 4OX9L 2BA1A 1SXTA 1YUZA 3E0EA 1NCVA 3CQZH 3CCQA 4C3IL 2A6HC 4RGOS 1A3UA 1I6VC 4J6HA 3ND9A 3DM1A 2I5MX 3K0YA 3J81i 1TU2B 5IT9c 2JSOA 3S15B 3L9AX 3A8JE 2SNSA 3NQTA 1CHQD 5IGFA 1Y14B 3EJIA 1R0JA 3HOWG 2DNCA 3BYYB 3TREA 2OT2A 2Q8RE 4QIWB 1YNNC 2OQ0A 2IX3A 5DM63 4KMUC 3BDOA 2QGQA 2EYMA 3EA6A 4NXML 2A6HD 4JI6L 2WB1P 3PWFA 4O42A 5HY6A 4A3KB 5BR8L 1Q46A 1EZ8A 3OMCA 1B70B 1EY8A 4DV3L 3CXCA 1HHVA 2OXPA 5C5LA 4KD4A 2NTTA 1A6XA 4L6TB 1EL0A 1B3AA 1RDPD 2EYPA 2B63H 2KHJA 1IBLQ 3K7AH 3B08B 4PZ8A 3PSIA 1N36Q 1H9JA 3PF4A 5JPNC 1XPRA 1PLFA 1YNND 3MZ5A 1TT2A 2WP8J 5IODA 4C2MB 4DUYQ 4CDDC 3PO3L 1IRNA 2KENA 2XWBB 3FHWA 1FJGQ 1STEA 4BBSB 5C4XG 3VYTA 2B2UC 4QJFA 2F0HA 2Z3QB 3S2DB 1B2JA 4X62L 2C6AA 1OWCA 1O7ZA 4UHVA 4GOPA 1PZJD 1YHQA 4A3FG 2EQSA 4DV4Q 4A3EH 4IJLA 2EYOA 1A3TA 3MXPA 2PZTA 2IPKD 1JJ2A 4X3TA 4LF8Q 2AUJD 2EE1A 2DJFC 3R2TA 1EIYB 1F9PA 2AHOB 1LKMA 4DV5L 4B3SL 2K04A 4KN7C 4DAMA 2YU9B 2EY5A 5IWAL 4K0KL 1S4ZA 2NZOA 1EWIA 3HJYB 1C48A 1B53A 1LV9A 3TRZA 1ENCA 2QDLA 3TP8A 1Q81C 3C2PA 4HJ8A 2FHTA 2N88A 2Y0SP 2RHQB 3E6ZX 5KIXA 5CGKA 3K7UC 2O2LD 1JICA 1E7ZA 2H1EA 1STGA 3OHXC 3SK4A 4BY1H 3CMEA 3K6OA 3KYUA 1X3GA 3VYSA 2R7ZG 1BUVT 5EKLA 3S1QB 6RXNA 2ZTDA 3DEOA 2WINB 4XYOA 4WJ3M 1FYCA 5KYIA 3PO2B 3ITPA 4NPSA 1JWUD 2F4VL 1KLGD 1ZXTA 1GKHA 4KHPL 3J80i 3BZCA 4V190 2PO4A 3N52A 4FXKC 3I4NB 1PXUA 4A3JG 4LF7L 1TWAB 4N9PA 2Z9HA 4HIKA 3U58A 5CMDA 4HJ5A 5CV7A 1D6EC 4C3HH 4X3UA 2ZXPA 4HIMA 1D2BA 1EUJA 1ML0D 1EWCA 3PUZA 1EY6A 4XDXA 3MXUA 4ZAIA 2C9OA 4LW1A 4O1NA 1CKNB 7RXNA 4Y7NL 2KCNA 5IYDH 1A15A 1DOLA 1LABA 5C3XA 1A63A 1QVFA 3TBIB 1QUQB 4A3BL 2N78A 1OWBA 4IO9A 3F2UA 4FP5D 2GN5A 1EEID 3HKSA 4DK0A 1UEBA 4P75A 1BBWA 2A1AA 1XMQL 1X55A 5C0XH 4K6LA 4PV1C 2EJGC 1WTVA 3KYXA 1JJGA 2L15A 2GVAA 1CA6A 1T5XD 4ABNA 4B9WA 3NBIA 2HVYC 5FJ8L 3CPFA 1KDBA 2PW5A 1L1OC 2BDOA 2NVXB 3P7JA 2LCQA 4JOIC 3S14L 4DR7Q 2F0LA 1R0FA 3JAML 3BJUA 1M1KC 1S5CD 2YV5A 3HOZH 1VZIA 1LT3D 3TP5A 2ICEC 2MNAA 1KNAA 1MGSA 4CGYB 2E2JL 1CZGA 3E9HA 1TS5A 2EDGA 1HUMA 1B44D 2O5JC 2VUMB 3S16L 4E6IA 1PZKD 4C3JG 3BVZA 3R93A 2E5LL 2KN9A 1JOOA 3D3RA 1VQ8A 4OEMB 4A3BH 3FRPB 3MEHA 1SFOL 4DV7L 5IT9L 5ELNA 2K52A 1LT6D 4FF1A 5JVG1 3URYA 1P16A 2JA8B 1HQRD 2B5ID 5ISRA 1H9SB 4QQBX 2DJGC 4JI4L 3J7Y1 2O5JD 4OO1H 3L2PA 3MAQA 5C4JL 3J7AF 4LHNA 4A3MB 4V196 1W6KA 1D5XC 4JK1C 1K73C 2R92L 1VQJA 5M3MB 1T9PA 2HR5A 1EQTA 5AN9H 1HNZQ 2DUDA 1AZQA 2PYAA 1BCPB 3R3OA 2F1MA 1QVCA 1HNWQ 1VCIA 4P73A 3SVMA 1VQ7A 2UUCQ 3D31A 1LKOA 2K32A 3W2DA 3G7LA 1XNRL 3M4OB 2E2IB 1B71A 1MI2A 3Q22A 3M4QA 3QWNA 2MPMA 3SK8A 1YITA 1XTCD 1KL9A 4CJ0B 2KJXA 3K57A 4XT1B 1SMWA 2JN4A 2Y0SE 4B8CD 2JA9A 1TVXA 3IL8A 1PA6A 3E5SA 2LXKA 1MD2D 4TSSA 4DR1L 5IGEA 3S16H 2K4KA 2J0TD 1PZXA 1PHJA 5FK9C 1EFID 3E0JA 2HUGA 1KDCA 4U673 3MEFA 5M5YH 4XQQA 2ID0A 3OWFA 1YUXA 4A3DL 1VQLA 4ODGA 4RWSC 1VQHA 2CH4A 3NWSA 2B2YC 1EIFA 3AEVA 1FNWA 1HR0L 1PH9A 2N49A 4BY1G 3FKIH 1I50B 4NXNL 1VCXA 5MLC3 2R93G 1Q1EA 4JI3Q 3HS0C 5KNDA 1QZGA 5EAYA 3L7ZC 4YY3Q 1NTGA 5C4JH 1FHHA 3S1ML 4IUQA 1OXSC 5E7NA 3CC7A 1PFWA 3HOVH 1RCVD 4XQNA 2KEDA 2B2WA 3GTQL 1TWCL 2VNUD 1Y1VG 3ND8A 2NVTH 3I7FA 2E75C 1MJCA 2PPBC 2UXDQ 1QNKA 1U4MA 5ELFA 5IY0A 2DY8A 1K3BC 1KLUD 5JPMC 5FLMH 2ERSA 5EJWA 2F0JA 2R7DA 1YBYA 4JI7L 5E4XA 4QY7A 4C3HG 2OCEA 2IWHA 4BBRL 3KOJA 3A5UA 5ELOA 4POFA 1S5FD 4RG1A 2HCCA 5LMNL 1JORA 5FO7B 5I4DA 2B63B 3J81L 3GDEA 1I3QB 2JA7B 2QEXA 2VQFL 1CTMA 4LMQD 4B3RL 1EYDA 5C3EL 3GTOL 2JK8A 1HNXQ 5C44L 2XVSA 4DV0L 5HURA 3PIOA 2F0VA 4K2KA 2PI2E 1G6PA 3BYTB 1EIGA 4KY7A 1DCZA 2J7ZA 4QIWP 2K5VA 2M6OA 5I6YA 1TWCH 3GD7A 1EOTA 3AYHB 4OELB 1R0GA 4A3EB 1IBML 4EQ5A 1VQPA 5CV8A 5EIOC 1PH8A 2Z6KA 3LX0A 5CV4A 3MPSA 3JC62 1VZHA 2JA5L 1KC8C 2Q2IA 5KGUA 1N32L 2MFIA 4JI0L 1EYAA 1X3FA 4JBMA 4A3GG 5IP7G 2HCIA 4LFBL 3A8IE 3UE1A 3HKZB 5MFZA 2FINB 3PIP3 2IHEA 1XNQQ 4YHHQ 4DR4L 4IJHA 3M85A 1EYGA 3HOWL 1I4HA 1X9NA 2J4XA 4X6AH 5K2ME 2LS01 4UP9A 1GUWA 2XRQD 3TZUA 2BCOA 3F2BA 2NB0A 1NNQA 3T53B 5A35A 1STBA 2OF1A 3E3XA 4GKKQ 1BO0A 3PO3B 1GUGA 2MQHA 2NVYH 2J9UB 1V9PA 2PZUA 5JJIA 1PYBA 1OXTA 3P75A 1VMCA 3IAYA 1A0IA 4R8IA 2JI2A 3PUVA 1AH9A 3PL5A 2E2HL 4DNRB 3KUPA 1H9RA 1Z92B 4I7ZC 5M3FG 2B39A 3A56A 4JW0A 1ZEQX 2UUAL 1XJVA 1RTNA 1LTID 2RDFA 3CAMA 1BKBA 3GP7A 1YEZA 5CV6A 3FPUB 4QB4A 2JQOA 3O13A 1X32A 3VA5A 3K0XA 1BQ8A 4HSVA 3M7NA 2NTSA 3V96A 3A0JA 4A3FL 1IBLL 4IFDI 1N36L 4YWMA 3S2HL 3GTPL 3EFXD 3PGZA 4ZQ3A 2F0FA 4R1JA 2Q8TA 1JCKB 5IT9E 1H7VA 3J80L 2F0QA 3FDJA 2CWAA 4P72A 1E3PA 1J8IA 3TQYA 1T9HA 1YV1A 3FKIG 4JAFA 2VUML 1HRJA 2CR8A 4UY8C 1WFQA 1GXDC 4IFDJ 1L2FA 1TKWB 4Y52L 4IPGA 1D1KA 3ER0A 1K0SA 1OTCA 5M5WL 1BFYA 5LMNW 3RLFA 2AYJA 1PH5A 3JC63 4X65Q 3Q0AA 1SNPA 4XIGS 1RTOA 4M8AA 3WOFA 1QVGA 3I56A 1J5EQ 4LFCQ 3GTJL 2R7ZL 1RYQA 4J8QA 3T1YQ 3ZG6A 3WWLA 3DEPA 3KLSX 3NBHA 1Y8OB 2PYKA 5C4XH 3S9WA 1SE8A 4DFAA 1B3QA 4HCSA 1VF5C 3LWPB 5FLMG 3RN5A 2AQ2B 2K5DA 4RCNA 1C09A 1HCZA 1RB9A 3M7GA 2KEEA 2WKDA 2QDBA 3D0FA 1JQYD 3BS1A 5ELDA 4Y7NB 4A3FH 1BR9A 4KKTA 1F2LA 3NTIA 4DAPA 4DUZQ 3S2HH 2L1BA 4CDEC 3K5LA 4A3JL 4A3BB 3CCJA 3LWRB 1RL2A 2CWPA 1H9MA 4CDFC 2F52A 5EBCA 2HQEA 1ENAA 4IFDH 4JI1L 2UU9Q 3OTOQ 1VQ6A 1N9WA 4KKSA 3I55A 1NBWA 1AW7A 4DV2Q 4QIWE 3GTML 2ZXRA 2LFNA 2B2TC 1KXLA 1M4VA 1CHPD 2IX1A 4HN7A 1STHA 3PF5A 5K36H 3BDLA 1K83H 3LWQB 3PV0A 3PIO1 2CQAA 5FLXc 5M5WH 3I4MH 1T9QA 5DM61 1A3VA 1D5MC 3H9BA 3CCEA 2XIWA 2B8GA 3I4LA 2MS3A 2KKDA 1X3PA 3CCUA 2A5HA 2I46A 3EBEA 1XMOQ 4DNIA 4AYBG 5GAHC 1L1OA 4F7XA 2VL6A 1BCPC 2E2JB 2AWNA 1B13A 4JOIA 3CQZL 1ENFA 1OXVA 1PDQA 1SAPA 1YNJD 1C0AA 3H3VC 1XYIA 3S16B 2CKCA 4GN3B 2JJQA 4B3ML 3S1RH 2RBMA 2O5IC 3RZOH 4B3TL 4DV1Q 4BY7H 2WAQB 2X69A 5J3BA 5D3DA 1F2YA 4IPHA 1JMCA 4A3JH 2GA4B 3KDFB 1SFOB 1WI5A 1WJVA 1S5ED 4OIKA 4DXGA 1STYA 1VQOA 4PZ7A 1E1TA 1UUPA 4ZUJA 1N34L 4AHWA 5T1IA 1PRTB 2SNMA 1BCPD 1PFUA 3JC66 1E24A 4AQYL 1SEBD 1X56A 4FVMA 4XXEA 1IROA 2IHFA 4DR3L 1QJOA 4C3JL 1D5ZC 2B3GA 2ICIA 2Z4HA 5C4JB 4MN3A 3I8ZA 1EZ6A 1E2WA 4DR7L 2R92B 3KFUA 3MWYW 3HOVB 1YK4A 3RZDH 1BE7A 1X54A 3JAMc 1B2OA 2B63L 1LTTD 3HOXG 2EJFC 4GNXB 3K7AL 3S24A 2NVQH 2Z3RB 3NELA 1F77A 1DYQA 4TPUA 3OW7A 4O0AA 1Q8IA 2L5TA 1GHJA 3SR1A 3Q23A 2RSNA 1Q8KA 1WVLA 1I4QA 4K8IA 4X64Q 2F3WA 3P8BA 5MF6A 1NSNS 4QCLA 3I73A 2RFKB 3MC0B 3K59A 1EYCA 1A62A 1GVPA 1WD0A 2OTLA 2NWGA 3NHHA 1IU5A 2GMGA 2A6EC 3BVGA 4A3EL 3D4WA 4A3DB 5HGTA 3D4DA 1IYVA 1FNVA 2FMMA 1R0IA 1N8RC 1I6HL 2YYZA 4GN5A 2XJRA 3WOEA 1Y1WG 2AQ3B 4GLVB 4GOPB 4C3JH 1HUNA 4KY5A 2UUCL 2UXCQ 4F8MA 2NYDA 5DNFA 3S1MB 2A68D 4GKJL 2EVBA 3NTHA 2A6ED 1KRTA 4YWKA 3HJWB 3GTQB 1TWCB 2A8VA 4EQOA 1E2VA 1KAAA 1SLJA 2IL8A 4JI5L 1R9TH 2G5DA 4BY1L 4WORA 4ZKCB 5M5XL 2XSCA 1SE4A 1W3SA 5CORA 5KNBA 1DXMA 1Z47A 1TS3A 2WACA 3QQCE 1NNXA 3I4OA 1GOZA 2PQEA 2MO0A 2XJVA 3LWUA 1ICFB 4AR6A 5T1GA 1ZYRC 3A74A 4ZCKA 4AHZA 4OHJA 1Y1VL 1VQGA 3H94A 4BBRB 2EPBA 3W1BA 4IOCA 2M6PA 4BA1I 3NTKA 4GLAC 2RHSB 1G291 1JWMD 5HGQA 2AMCB 1CUKA 3AB9A 1VS0A 3RN2A 3T13A 2Z0SA 4IFDG 1E0BA 5C3EB 4C3HL 3GTOB 2BE5C 1I6HH 4PZ6A 5C44B 1VQNA 1ZYRD 1CKOA 2D9UA 1TWGH 3LGJA 4JV5Q 5IP9G 4A3IG 5IYDL 3QG1A 1FHMA 2UXDL 1DJRD 5K36G 3UDGA 1XX8A 3PIPA 1BNZA 1ASYA 3I4MG 1RHPA 3UDIA 1F9SA 2R3ZA 4QL5A 2JYOA 3HKZP 3QJYA 3SGIA 1RKNA 2M2LA 2F3IA 3G4SA 5M5XH 2BE5D 2R93H 4LFAL 2JA5B 3WWVA 1HXYD 2F0IA 8RXNA 2VB2X 4CKCA 1S3OA 3KK7A 5IYCH 3CD6A 4HR7B 1N33Q 5LMUL 2F03A 5AJ3L 1Y1VH 1JB7A 1K8OA 3H0GG 3NSWA 4X66Q 5EPJA 5CR3A 5FLXL 5IGGA 3J81c 3HOWB 4BY7G 3K81C 1BQ9A 3HOZL 1WTQA 3TN2A 4PMWA 1O80A 1GUSA 2PVEA 4AH6A 4Q5VA 3CCLA 4A3GL 4DR6Q 1Q7YC 3AMUA 2RVLA 1U4LA 1DVBA 4Q0FA 1DZ1A 2MHVA 4A93G 1QB5D 1LO5D 2D5DA 3QOJA 4WJWA 2K5HA 1DOKA 2EY4E 1S40A 5D65A 5COYA 2XJPA 2F0UA 1BCPF 1LKPA 1IYJB 1WD1A 2EXZA 1GHKA 3U4VA 4EVOA 2E2HB 3H6MA 2F3VA 3B6YA 1MSGA 4P71A 3QOLA 2V3BB 4U671 4XQJA 1SNCA 1UE5A 4YHHL 1NE3A 2EY1A 1EWHA 3S1NL 4DV6L 2BA0A 2F4IA 2X6GA 4FDBA 4NKLA 4A3FB 3G48A 3L3OC 3G71A 3S2HB 1AFPA 4LNQA 3GTPB 3J7Z1 1EY9A 1IBKQ 1W6JA 4TVAB 1LT4D 1YHBA 3T1HQ 4GKKL 1PH2A 4F87A 2IW3A 3TS0A 4GS7D 4HIOA 2NYZD 3Q6SA 2XJSA 2F0KA 1I94Q 4IUTA 3K8AA 3SK6A 5EKKA 5IP7H 4TRDA 1S72A 4A3GH 2ATWA 5JVH1 3VYUA 3ULJA 2HDLA 1BBUA 4QUCA 5C4HA 1LT5D 1MJEA 1ILQA 5G3LD 4LJZC 2VQEQ 2XJTA 1SMXA 3I2ZA 5M5WB 3NFPI 5M5YL 1CKNA 4F88A 2PMZP 1YHAA 1UE1A 2GVBA 3STBD 1QUQA 4JPBW 4WRDA 2WB1G 1HZAA 4GZYC 3GTJB 3ICEA 2R7ZB 2K6AA 2ZM6Q 1QQTA 2RKSA 4ZLTF 4HCEA 3FKIL 1L0WA 2ZJQA 1O7YA 1NXEA 1NAPA 3IRBA 3Q8DA 4JYAL 2QA4A 2QKIC 1NR4A 1VQ4A 2PPTA 3HRZC 1SNDA 3HOVL 2Q2HA 4OX9Q 1CQVA 3S1NH 2AUSB 3EQLC 3LPEB 5KNCA 3C1EA 5I9PA 1JOQA 1SRUA 1F9QA 1SYCA 2NVTL 4DU9A 5I9OA 5M3FH 4A3JB 3J80c 3RYGA 4KY6A 3J7ZC 1HA5A 1XXGA 4PG3A 2WFWA 1HJPA 2JA7G 2K5WA 3OSOA 2JEAI 1VDZA 2NZHA 5GAGC 1K0RA 5FLML 3LWOB 1B9NA 2L0ZA 2FMCA 2I5LX 2JP1A 2N55A 2O4XA 2OQKA 3RD4A 3H91A 3GTMB 4H0LC 2BH8A 2D0PA 4A76A 4GLXA 1V1PB 1WTOA 4X65L 3K5MA 4NXMQ 3HKZE 4C3IG 4JI6Q 1I4PA 2RQXA 3SXHA 3T1YL 1IL8A 2XTIA 3VR2A 1PRTC 2B2TA 4J15A 1BQQT 3MA2B 2UXBL 2PNRC 1OXXK 2B29A 2NVQB 3PIP1 1NMFA 3W3AA 4TVMA 1HH2P 3MXGA 2WAQP 3F8TA 2Y0SG 1QNUA 4DUZL 2JI1A 2XWJB 1LYLA 4A3CH 3CQZB 4KLKA 2PNHA 3HOYH 4GNXC 1CSPA 2K33A 1EY7A 5IYCG 4BA2I 1IKMA 4HEDA 2QILA 3N6RA 4C2M1 5FO9B 2UU9L 1PRTD 2B2VC 3OTOL 1YVCA 2C35B 2I07B 3MHBA 5IYBH 4DV2L 1Z7TA 1VQAA 4NB3A 4JI8L 3UDXA 1JE5A 1PFNA 3CRLC 1A8VA 4KD3A 3PO3G 2F0DA 5DAUA 3J81j 2ALYB 4C3JB 3OW2A 3MSUA 1M90C 1L0XB 3CMAA 2G9HD 2K2DA 4DV5Q 1XWEA 2HQLA 4K0KQ 5IWAQ 4L5TA 4YIJA 4LF4Q 4RMFA 4X6AL 3M4PA 1DD2A 3H99A 1XMOL 4JAGA 1BDOA 3I70A 4RFBA 3QO2A 1EQQA 3K7AB 2K14A 4GOPC 4BWGB 2SOBA 3KYWA 5FOBB 1Q82C 3VYRA 1VQFA 3VR4A 2NVYL 1V8QA 2ZJPA 4FF4A 1QZHA 1B4OA 3KF8A 5JVG3 4LF9Q 2VS1A 3QIAA 1GJXA 3HOXL 2K28A 3UE0A 5A2QL 2KBNA 5E1FA 2ES2A 1CADA 2P5ZX 1UE7A 4NDXA 2F4VQ 5D14A 5FLXE 3A5ZB 1DOMA 4NMZA 3CPWA 4XXBB 4L5QA 2AUKA 1B50A 4G6BA 3PUWA 1PTOH 1I6HB 2PMZE 4IPCA 4A3KH 3M3YL 4FXDA 4RA8A 2TSSA 1QWYA 1RD9D 4OIJA 1AE3A 1YJ9A 1DGSA 2QL0A 4AYBP 1IU6A 2N3SA 4FF3A 4OGQC 1JE4A 2Q2UA 2XNAC 1FGBD 4XYQA 1SMMA 5E3FA 2IX0A 2PQAA 1E2ZA 1UAPA 4RGMA 2CQOA 5IGCA 1B1ZA 2HIVA 2VZAA 5G3LF 1LTSD 4BS9A 1A2TA 3PUXA 4BY1B 1I4RA 2LSSA 1CT1D 1SR3A 1WJJA 1Y1WL 3HFZB 5M5XB 2I5HA 2TMPA 2WKCA 4JI2Q 4RHSA 4DAVA 4UY81 4EX5A 4OWTB 1TWHL 1Y8NB 3J7YW 1KTKA 3WDNA 4POGA 1ASZA 3I91A 1TQOA 1Y1VB 2M00A 1ET9A 3HOXH 1QG7A 1WCMG 5IE8A 2K5NA 4CDCC 4DPGA 4ULLA 1AZPA 2K05A 3NXWA 1L0YB 4K2LA 4BXXH 3JAME 1GO3E 2JE6I 4R4OA 1HR0W 2B2UA 4B9XA 4QUFA 1SYFA 5C4XL 1VQDA 4G7ZC 1G2SA 4C3HB 2YU9H 1FNUA 1PZID 1SNQA 4XGHA 2MUYA 2UUBQ 3M3YH 3HG9A 3GV6A 3LNNA 2EY2A 5DM73 2OTJA 1NR2A 1R0HA 1E1OA 5GADc 3DHQA 1PYSB 4DK6C 3EROA 2JEBI 2WAQE 2VB3X 1S2ZA 4DUYL 2E5LQ 3MVVA 2VW9A 1Z6HA 4P2CB 5IIFA 4DV7Q 1FJGL 3S1QH 1AE2A 1R4PB 1Y1WH 3GTKL 5IP9L 3L0OA 4DR5Q 1EEFD 3NEMA 1D7QA 4A3IL 1TWHH 2MO1A 2RDVA 2CVRA 1QOHA 2EOTA 2HHHQ 4ZN3B 3KLSA 4TQUS 4DV4L 2JA6G 3QVDA 1K83L 2F0GA 2QCPX 4A3CG 3I4ML 3HOYG 3HGBA 3VR5A 1F4LA 4LF8L 3CC4A 1JB3A 5IYBG 3HOZB 3OYYA 2XN9C 1NJIC 4IN3A 3RUZA 1XNRQ 1PRTF 4ZYSA 1FVIA 5EGTA 2A74C 4A3GB 3T16A 3KF6A 2CKZB 2PMZB 4CKEA 3OMGA 4AR5A 5F2DA 4FO2A 2Q8IB 1LTBD 2Z8LA 5CYUA 3H3VM 1HTPA 3H0GL 2R92G 3S1RL 3RZOL 1LTRD 5EKIA 5JEAJ 4BY7L 3HAXC 4HSPA 3CCSA 3KYYA 2VXWA 1PH3A 1EY4A 4S3SA 4JCVE 1V1OA 4JBJA 3BU2A 1LTAD 1JYBA 4IURA 3LNLA 2LKVA 4KJOA 3GTGL 4A93L 5I6WA 1X3QA 4OL7A 2C6BA 4DKAC 3HOUG 2K75A 3GTKH 3H3VI 4LUOA 5IP9H 1HR0Q 4YCVA 4DAYA 2A69C 1AEXA 3D8GA 4A3IH 4K14A 4PQXA 1PYWD 1TS2A 3GTLL 3RZDL 1WOCA 1YNJC 2L4NA 4YCWA 4UAIA 1BVSA 2AKWB 3G6EA 2NVXH 3K5NA 1C8CA 2PI2A 4IZ8A 1F2MA 3A7AB 1O7IA 1EQRA 1G51A 3MXNA 3TP7A 1DM0B 4DR6L 2M9VA 1G91A 4LF6Q 2RDHA 2NVQL 1D1IA 1YI2A 2V0FA 4AYBE 1K8MA 1PH1A 1NUCA 4HJ7A 2A69D 1EIHA 1DX8A 3GO5A 1D8LA 4A3KG 4DN4M 3RNUA 3H0GH 4QGUA 2EZVA 2K50A 3OIPA 5M5YB 2F0NA 5E4WC 3VA7A 2JA8H 5LMNQ 3C1FA 1I4GA 3J81E 1K9MC 2D62A 5I2YA 3QR8A 4RAUC 4I7AA 4JBKA 3NK9A 3GTGH 4A93H 3FKIB 2KHSA 1VQMA 2VQFQ 3DWAA 4I65A 4L5RC 1U4RA 4BBSG 1RDGA 4CHTB 5MGNA 2ENBA 1IBKL 2C5CA 2F0PA 3T1HL 1WYDA 3GTLH 1T5EA 3H3VH 4FF2A 2XRSD 3M4OH 3BG3A 4LUVA 2E2IH 1I94L 2NVTB 1R9TL 1LACA 1BRFA 2L0CA 4OWXB 2SEBD 2IY5B 1IBMQ 4BXXG 4RKLA 1HPCA 5KYLA 5C3EG 3SE0A 2VQEL 3VR3A 4A3LH 1WTRA 3RLNA 1EFWA 3KBXA 4FXGC 5DEHA 1PVOA 1J9OA 4DR2Q 3MFYA 1N32Q 3S17L 1UEAB 1ZRPA 2YTYA 2DNEA 3DM3A 2A68C 2ZM6L 4AI2A 2K01A 3IKJA 1CM9A 2LMCB 4JBWA 4DR4Q 4K8JA 4DXFA 1SMYD 2LY7A 4K9FA 1F2ZA 1K28A 1NY4A 2KA7A 4X3SA 2JA5G 1HNZL 1FL0A 3MFGA 1C4QA 2Z6BA 2Z6KC 4IUNA 3TZDA 5C4ZA 1TWGL 1HNWL 1GUNA 1VQBA 5TSSA 3PO2G 2CH4W 1U9RA 3CC2A 4RGTA 4L5SA 1RWDA 4DGZA 1I5FA 5BN5A 5H1Sc 2B2YA 3R8BA 3TP6A 2R7FA 3H09A 4N8X1 3ULPA 1STNA 3I4NG 1O78A 1U0LA 3PIO3 2A19A 4GNXA 2R93L 4AYBB 2XGTA 1UWVA 1E8JA 2HT1A 4WFN3 3BDCA 2B2VA 1PTOB 3PQIA 1RODA 4TKOB 2UUAQ 1V43A 5IYCL 3RZTA 2RDGA 2F0EA 2L11A 4ZK9B 2BH2A 3S17H 1IW7C 2ZXOA 1C9OA 1B8AA 1SYBA 4DK3C 4JAEA 3H9CA 1I3QH 1PH4A 2JA7H 1R4QB 5J1ZA 4R4TA 2A73B 5BN4A 1TR5A 2KCTA 4JI3L 4ID6A 3X3NA 3J80E 1HA6A 4YY3L 2F0MA 3CW2C 3I72A 4JC0A 1FR3A 3OIQA 1WTXA 4ILWA 2NVYB 5JJKA 4LF5Q 3SS2A 1PV4A 3CCMA 4C3IH 5GADC 3DLLA 1IW7D 3KYVA 1W2BA 3JR7A 4MTNA 1BOSA 3OPOA 3HOXB 3FMCA 3RZ6A 1MBYA 1UNSA 4H44C 4K5VA 3H15A 4R4QA 1SYEA 2F0OA 5CV9A 2APOB 4G7HC 1SE3A 2E76C 5EPKA 1S30A 4YWLA 2NN6I 3NPPA 4G7OC 5KEEA 1STAA 3P2AA 5JEAG 3FDTA 3SEBA 3KLWA 4LF4L 3M3YB 3G6JB 1HZ9A 2VUMG 2L12A 3KBGA 1IYUA 3KLRA 4AIMA 1VQ9A 3OWEB 1TY2A 5C0XI 1PFMA 4HTHA 1HNXL 3CCVA 1NMGA 1SDFA 3PO3H 1JOKA 1IHZA 4JADA 2JA8G 1MIUA 1CA5A 4JI1Q 4LF9L 5IP7L 1Y1WB 1ILPA 1VQ5A 4Z9CB 1TWHB 4A3MG 5M3MG 1UE6A 3FVQA 5EBDA 1P8LA 2CHBD 1HTLD 5C0XJ 1IZ6A 1LM0A 1MHWC 1IXRA 2V4DA 1SYGA 4LAAA 4MIUA 3R2IA 3K35A 2Z1CA 1CAAA 4KI0A 2H12A 5C4XB 5ELBA 3NQIA 1K8GA 2LXJA 1XNQL 3BZKA 2ASBA 3I3CA 1JJCB 1XTDA 2NN6H 2IT1A 4A3LG 5EINC 1WCML 2ZTEA 3K5OA 3GQBA 4AR3A 3EIVA 3UI2A 1GUTA 3QB3A 5M3FL 4OO1I 4B3MQ 2MJ8A 3VR6A 3ZYYX 4JI2L 1H9KA 2R61A 4B3TQ 2SDFA 5EPLA 1AP0A 3RR5A 3TMEA 3F2CA 2M4YA 4QF4A 1ESFA 4G57A 3STBC 2CCZA 1CI3M 4R9WA 4CJ1B 2MGSA 2XJUA 2F0SA 2F0TA 5CBAE 1N34Q 4M1UB 3GTKB 3OOCA 5LL6X 1KHIA 2KCCA 2PVXA 1CK1A 1PFBA 4PMBA 4A3IB 4AQYQ 5FKAC 2V1CC 4DR3Q 1CFMA 1K83B 1SJHD 3I4MB 1U4PA 1TWFL 1GUOA 1Q12A 4IQZA 1ESRA 2K7VA 2WB1E 4A4IA 4ZRZA 1V1QA 4H7BA 3HP3A 4AHYA 3NE5B 2UUBL 3FEWX 1RF2D 2JXMB 3SHLA 2ZIXA 3TDQA 2JA6L 3FPPA 3A8KE 4A3CL 3KYHC 3HOYL 4Y7NH 3B0AB 4KK7A 2FJ2A 1MKHA 1WCMH 3U9OA 3BZDB 3H0GB 5DLQE 3U4ZA 3ERQA 4UPAA 3S1RB 3RZOB 4X3KA 5C5MA 3T56B 4BY7B 5IYBL 2B63G 4O2DA 4DR5L 2FXQA 4NP5A 4AR4A 1SSOA 2HHHL 4J1MA 3GTGB 4A93B 3DWPA 1JC7A 2KHIA 2E74C 1PFYA 2K5QA 5JAVA 5FJ8H 4LFCL 2H4OA 1J5EL 3PCOB 3GTLB 3RZDB 4MZ9A 4MHEA 3PZAA 1OXUA 5BR8Q 4GKJQ 1CZWA 1TWFH 2EYLA 3S14H 4DV3Q 3DUZA 3SDZA 4A3EG 3PKJA 4LK1C 3E9IA 2KCMA 3HOUL 4DNTB 1GM5A 4JI5Q 3Q24A 2RF4A 3KJOA 2Q2TA 2WV6D 2E2JH 3IU3I 4EQNA 2EYJA 2EJMA 1CQFA 2QEJC 5NUCA 4ZN1B 2JA6H 1H9SA 1X6OA 3NENA 3ONAB 5GROA 1E22A 3S15L 3HKZG 1YK5A 2KQ3A 3FP9A 3K80C 3MTSA 3AFPA 1SFOH 4X62Q 1QCVA 2ZTCA 3W1GA 5CBEE 4AHXA 3PUYA 4PMCA 3VPBE 2E8GA 3KF8B 1QYBA 2K1BA 1KIXA 1TXYA 1B2TA 1KABA 1HFNA 4XTCS 5K5PA 5GAHc 4A3KL 2RCFA 4HJAA 4KN4C 3CU7A 3NWTA 1G6ZA 1G2TA 3C3LA 2R92H 4AI3A 4IOAA 1EY5A 2NZ1D 4LF6L 4B3SQ 1KDAA 1Y69U 1V1PA 4KTAA 1IKLA 5JVH3 2KECA 1H95A 2Z4IA 4LUZA 2DSXA 1A2UA 2WB1B 1QILA 1VQIA 2DN8A 1R9TB 1J6QA 2AQ1B 1K3RA 3VDYA 5DM71 2L9HA 4UP8A 3A7LA 1S24A 4OWWB 3HOUH 4RGNA 4K5WA 3T51B 3K58A 4BBSL 3SK5A 5AI3A 2EYFA 1OO9B 3S2DL 4LFAQ 4KKUA 4DV1L 2PQAB 3V2TA 2FFKB 5IGBA 4LHLA 1FGUA 3X3MA 3S17B 1VQCA 2NN6G 3S15H 3UDFA 5IYDG 2K03A 1JR0D 4APVA 5LMUQ 5AJ3Q 4A3DH 1EOVA 4LWCA 4C56C 1PTOC 2X6LA 4BXXL 4KHPQ 3KJPA 1B9MA 5GAEc 3PKIA 3RLOA 4LF7Q 5L37A 2YU9L 1SNOA 3F1ZA 5C0XG 4CBVA 1BXTA 1IL2A 3S1MH 5I2XA 4C3IB 1QCBD 1TWGB 1RIPA 2DY7A 3EN2A 3D4RA 4RH6A 4RHRA 4JVZA 3GTQH 1BF4A 4H13C 5CV5A 4R8NA 3TS2A 3ULLA 1PTOD 1VMPA 3AQQA 2CW0C 5EQ0A 1YNXA 3HOZG 1QE6A 4C2MH 3S1QL 1TIID 1SROA 3A55A 1HFGA 4GN4B 4L8JA 4X64L 4DR2L 2R93B 2Y0SB 2CFMA 1JWSD 1EU3A 1KAWA 1SBBB 4C1NK 1SYDA 4BBSH 1FD7D 1F9RA 3PO2L 3A44A 2EY6A 1G8ZD 2QF7A 1EU4A 4IALA 3S2DH 4BBRH 1XMQQ 4JG2A 1I4XA 2EYHA 4A75A 4YCUA 4KHVA 2PW7A 2I0QA 4NW2A 4DV6Q 2CW0D 2HIXA 4DF7A 3CHBD 4A3BG 3I4NL 1TWAL 4RKBA 5LHY1 4IUVA 5AI2A
chains in the Genus database with same CATH topology
5C3EH 3GTOH 2EXDA 2UXCL 4ME3A 5C44H 4KHZA 4AI0A 4OO1G 1PH7A 3ZJYC 5FJ8G 3NBHB 2EIFA 3KF6B 2JA5H 2VY3A 2N8NA 3J7A5 3PO2H 4P74A 4JI4Q 1K8AC 4JYAQ 2DGYA 4R4CA 3HOWH 1ODHA 1YJNA 2WAQG 1SMUA 5H1SE 1VQKA 3I4NH 1TWAH 4LF5L 4DAYB 1VZGA 4JV5L 1HZBA 1GD7A 1KD1C 4H02A 3TEHB 3MXNB 1VQEA 4E6YA 1Q86C 3JAMi 3HOVG 3F2DA 1RDVA 4DR1Q 2V0EA 5MFPA 2E2HH 3U50C 1L1OB 5JJLA 3CF5A 1XPOA 4OXPA 2UXBQ 4IPDA 5RXNA 3CP0A 1N33L 1YJWA 2PSMC 4WJ4A 4X66L 4NXNQ 3W5OA 3GTPH 2H5XA 2ERJA 1XPUA 1X3EA 1LTLA 4A3DG 4UP7A 1B7YB 4JI8Q 1PH6A 1Z9FA 2VUMH 1T9OA 1Q1BA 4Y52H 4JI7Q 1PFSA 2XJQA 4WFN1 2JI3A 3GTJH 1HZCA 2R7ZH 1NXGA 2OWOA 1CSQA 4A3MH 2M4VA 1KRSA 3ERSX 4MNOA 4B3RQ 4HJ9A 5M3MH 3M9BA 4DV0Q 2AWOA 4BBRG 4AI1A 1CKMA 1YZ6A 1KQSA 1RYTA 3WWNB 2YTXA 2CKAA 1U5KA 3GTMH 2RCNA 3AFQA 1LUZA 4OONA 5C44G 4RXNA 1YIJA 4JI0Q 2ZJRA 5GQOA 4LFBQ 1JT8A 2R6GA 1X65A 4GS3A 1SN8A 5GAEC 3CCRA 4R4IA 2YTVA 4ALPA 4HIDA 1C7YA 1I50H 5GAGc 3KDFA 2D0OA 4OX9L 2BA1A 1YUZA 3E0EA 3CCQA 3CQZH 2I5MX 3J81i 5IT9c 1Y14B 1R0JA 3HOWG 3TREA 2OQ0A 2QGQA 4NXML 2A6HD 4JI6L 3PWFA 5HY6A 5BR8L 1Q46A 1B70B 4DV3L 3CXCA 2B63H 2KHJA 1IBLQ 3K7AH 3B08B 4PZ8A 3PSIA 1N36Q 3PF4A 1XPRA 2WP8J 4DUYQ 1IRNA 2KENA 3FHWA 1FJGQ 5C4XG 4QJFA 2Z3QB 1B2JA 4X62L 2C6AA 1OWCA 4GOPA 1YHQA 4A3FG 2EQSA 4DV4Q 4A3EH 4IJLA 1JJ2A 4LF8Q 1EIYB 2AHOB 1LKMA 4DV5L 4B3SL 4DAMA 4K0KL 5IWAL 2NZOA 1EWIA 3TRZA 1Q81C 4HJ8A 2RHQB 3K7UC 1E7ZA 4BY1H 3CMEA 3KYUA 1X3GA 2R7ZG 6RXNA 2ZTDA 4WJ3M 4NPSA 2F4VL 1GKHA 4KHPL 3J80i 3BZCA 4A3JG 4LF7L 4HIKA 3U58A 4HJ5A 4C3HH 4HIMA 1EUJA 3PUZA 4LW1A 1CKNB 7RXNA 5IYDH 1A63A 1QVFA 1QUQB 2N78A 1OWBA 4IO9A 2GN5A 3HKSA 1UEBA 4P75A 1BBWA 2A1AA 1XMQL 1X55A 3KYXA 1JJGA 2L15A 2GVAA 3CPFA 1L1OC 2LCQA 4JOIC 4DR7Q 1R0FA 3BJUA 1M1KC 2YV5A 3HOZH 1VZIA 2MNAA 3E9HA 2E5LL 2KN9A 1VQ8A 4A3BH 4DV7L 5ELNA 2K52A 5JVG1 1P16A 2B5ID 4QQBX 4JI4L 3J7Y1 2O5JD 3L2PA 4LHNA 4V196 1K73C 1VQJA 1T9PA 2HR5A 1HNZQ 5AN9H 2DUDA 2PYAA 1QVCA 1HNWQ 1VCIA 4P73A 1VQ7A 2UUCQ 3D31A 1LKOA 1XNRL 1B71A 3M4QA 1YITA 1KL9A 1SMWA 2Y0SE 4B8CD 2JA9A 1PA6A 2LXKA 4DR1L 3S16H 2K4KA 1PHJA 3MEFA 5M5YH 2ID0A 1YUXA 1VQLA 1VQHA 1EIFA 3AEVA 1HR0L 1PH9A 2N49A 4BY1G 3FKIH 4NXNL 1VCXA 5MLC3 2R93G 1Q1EA 4JI3Q 1QZGA 5EAYA 3L7ZC 4YY3Q 1NTGA 5C4JH 1FHHA 1OXSC 5E7NA 3CC7A 3HOVH 2VNUD 1Y1VG 2NVTH 3I7FA 1MJCA 2UXDQ 5IY0A 5FLMH 2ERSA 2R7DA 1YBYA 4JI7L 4QY7A 2OCEA 3KOJA 3A5UA 5ELOA 4POFA 4RG1A 5LMNL 3GDEA 2QEXA 2VQFL 4B3RL 2JK8A 1HNXQ 4DV0L 3PIOA 2PI2E 1G6PA 2K5VA 2M6OA 1TWCH 3GD7A 3AYHB 1R0GA 1IBML 4EQ5A 1VQPA 5EIOC 1PH8A 2Z6KA 3MPSA 3JC62 1VZHA 1KC8C 2Q2IA 1N32L 2MFIA 4JI0L 1X3FA 4JBMA 4A3GG 5IP7G 4LFBL 3UE1A 5MFZA 2IHEA 1XNQQ 4YHHQ 4DR4L 4IJHA 3M85A 1EYGA 1X9NA 4X6AH 5K2ME 4UP9A 3F2BA 1NNQA 4GKKQ 2MQHA 2NVYH 2J9UB 1V9PA 5JJIA 1PYBA 1OXTA 1A0IA 2JI2A 3PUVA 1AH9A 1Z92B 5M3FG 2UUAL 1XJVA 3CAMA 1BKBA 1YEZA 2JQOA 3K0XA 1BQ8A 3M7NA 3A0JA 4IFDI 1IBLL 1N36L 4YWMA 3PGZA 4R1JA 1H7VA 2CWAA 4P72A 1E3PA 3TQYA 1T9HA 1YV1A 3FKIG 4JAFA 4UY8C 2CR8A 1WFQA 4IFDJ 1L2FA 4IPGA 3ER0A 1OTCA 1BFYA 5LMNW 3RLFA 2AYJA 1PH5A 3JC63 4X65Q 4XIGS 1QVGA 4LFCQ 3I56A 1J5EQ 1RYQA 3T1YQ 3ZG6A 3WWLA 5C4XH 1SE8A 3RN5A 5FLMG 1C09A 1RB9A 3D0FA 4A3FH 3S2HH 4DUZQ 3CCJA 1RL2A 2CWPA 2F52A 4JI1L 2UU9Q 3OTOQ 1VQ6A 1N9WA 3I55A 1NBWA 4DV2Q 4QIWE 1KXLA 2IX1A 3PF5A 1K83H 3PV0A 3PIO1 3I4MH 5FLXc 5M5WH 1T9QA 5DM61 3CCEA 2MS3A 2KKDA 3CCUA 3EBEA 1XMOQ 4DNIA 4AYBG 5GAHC 1L1OA 2VL6A 2AWNA 1B13A 4JOIA 1OXVA 1C0AA 2CKCA 4GN3B 2JJQA 4B3ML 3S1RH 3RZOH 4B3TL 4DV1Q 4BY7H 5J3BA 4IPHA 1JMCA 4A3JH 3KDFB 1WI5A 1WJVA 1VQOA 4PZ7A 1E1TA 1N34L 4AHWA 3JC66 1E24A 4AQYL 1X56A 1IROA 2IHFA 4DR3L 2B3GA 4DR7L 3KFUA 1YK4A 3RZDH 1BE7A 1X54A 3JAMc 1B2OA 3HOXG 4GNXB 3S24A 2NVQH 2Z3RB 3NELA 4TPUA 4O0AA 1Q8KA 4X64Q 3P8BA 5MF6A 1GVPA 1A62A 2OTLA 1IU5A 2GMGA 1R0IA 1N8RC 2YYZA 4GN5A 2XJRA 1Y1WG 4GOPB 4GLVB 4C3JH 2UUCL 2UXCQ 2NYDA 4GKJL 2A68D 2A6ED 1KRTA 4YWKA 2A8VA 1SLJA 1R9TH 4JI5L 1W3SA 1Z47A 3QQCE 3I4OA 2MO0A 2XJVA 4AR6A 3A74A 4AHZA 1VQGA 3W1BA 4IOCA 2M6PA 4BA1I 4GLAC 2RHSB 1G291 5HGQA 2AMCB 1CUKA 1VS0A 3RN2A 2Z0SA 4IFDG 1I6HH 4PZ6A 1VQNA 1CKOA 1TWGH 3LGJA 4JV5Q 5IP9G 4A3IG 1FHMA 2UXDL 5K36G 3UDGA 3PIPA 1ASYA 3I4MG 3UDIA 4QL5A 3SGIA 2F3IA 3G4SA 5M5XH 2BE5D 2R93H 4LFAL 3WWVA 8RXNA 1S3OA 5IYCH 3CD6A 1N33Q 5LMUL 5AJ3L 1Y1VH 1JB7A 3H0GG 4X66Q 3J81c 4BY7G 3K81C 1BQ9A 4PMWA 2PVEA 4AH6A 3CCLA 4DR6Q 1Q7YC 1DVBA 4A93G 2K5HA 1S40A 2XJPA 1LKPA 1IYJB 3U4VA 3B6YA 4P71A 2V3BB 4U671 4YHHL 1UE5A 1NE3A 4DV6L 2BA0A 4FDBA 3G48A 3G71A 4LNQA 3J7Z1 1IBKQ 4TVAB 1YHBA 3T1HQ 4GKKL 1PH2A 3TS0A 4GS7D 4HIOA 2XJSA 1I94Q 3K8AA 1S72A 5IP7H 4A3GH 2ATWA 5JVH1 3ULJA 1BBUA 1MJEA 2VQEQ 2XJTA 1SMXA 3I2ZA 3NFPI 1CKNA 1YHAA 1UE1A 2GVBA 3STBD 1QUQA 2WB1G 1HZAA 3ICEA 2ZM6Q 1L0WA 2ZJQA 1NXEA 3IRBA 3Q8DA 4JYAL 2QA4A 1VQ4A 2PPTA 4OX9Q 2Q2HA 3S1NH 3LPEB 1SRUA 5M3FH 3J80c 3RYGA 3J7ZC 4PG3A 2WFWA 1HJPA 2JA7G 2JEAI 2NZHA 5GAGC 1K0RA 2L0ZA 2I5LX 2OQKA 2BH8A 2D0PA 4A76A 4GLXA 4X65L 4NXMQ 3HKZE 4JI6Q 3T1YL 2XTIA 4J15A 2UXBL 1OXXK 2B29A 3PIP1 1NMFA 4TVMA 1HH2P 3F8TA 2Y0SG 4DUZL 2JI1A 1LYLA 4A3CH 4KLKA 2PNHA 3HOYH 4GNXC 1CSPA 4BA2I 5IYCG 2UU9L 3OTOL 1YVCA 2C35B 5IYBH 4DV2L 1VQAA 4NB3A 4JI8L 3UDXA 1JE5A 1A8VA 3PO3G 3J81j 2ALYB 3OW2A 3MSUA 1M90C 3CMAA 2K2DA 4DV5Q 2HQLA 4K0KQ 5IWAQ 4L5TA 4LF4Q 4RMFA 3M4PA 1XMOL 4JAGA 1EQQA 2K14A 4GOPC 3KYWA 1Q82C 1VQFA 2ZJPA 1QZHA 4LF9Q 2VS1A 3UE0A 2KBNA 2ES2A 1CADA 1UE7A 2F4VQ 3A5ZB 3CPWA 4XXBB 4L5QA 4G6BA 3PUWA 2PMZE 4IPCA 4A3KH 1YJ9A 1AE3A 1DGSA 2QL0A 1IU6A 2N3SA 2Q2UA 1SMMA 2IX0A 2PQAA 2CQOA 2HIVA 2VZAA 3PUXA 2LSSA 3HFZB 1SR3A 1WJJA 2I5HA 4JI2Q 4UY81 4EX5A 4OWTB 4POGA 1ASZA 3HOXH 1WCMG 5IE8A 2K5NA 4DPGA 4BXXH 1GO3E 2JE6I 4R4OA 1HR0W 1VQDA 2YU9H 4XGHA 3M3YH 2UUBQ 2OTJA 1R0HA 1E1OA 5GADc 1PYSB 4DK6C 2JEBI 2WAQE 1S2ZA 4DUYL 2E5LQ 2VW9A 4DV7Q 1FJGL 3S1QH 1AE2A 1Y1WH 3L0OA 4DR5Q 3NEMA 1D7QA 1TWHH 2MO1A 2RDVA 2HHHQ 4ZN3B 2JA6G 4TQUS 4DV4L 3QVDA 4A3CG 3HOYG 4LF8L 3CC4A 5IYBG 3OYYA 1NJIC 1XNRQ 1FVIA 3KF6A 2CKZB 4AR5A 2R92G 5JEAJ 3CCSA 3KYYA 1PH3A 4JCVE 4JBJA 3BU2A 1JYBA 3LNLA 2C6BA 4DKAC 3HOUG 2K75A 3GTKH 3H3VI 4LUOA 5IP9H 1HR0Q 4YCVA 4A3IH 1WOCA 2NVXH 4YCWA 3G6EA 1BVSA 2AKWB 2PI2A 1O7IA 1EQRA 1G51A 4DR6L 4LF6Q 1YI2A 2V0FA 4AYBE 1PH1A 4HJ7A 2A69D 1DX8A 3GO5A 1D8LA 4A3KG 3RNUA 3H0GH 4QGUA 2K50A 2JA8H 5LMNQ 1K9MC 2D62A 4JBKA 3GTGH 4A93H 1VQMA 2VQFQ 4L5RC 4BBSG 1RDGA 5MGNA 1IBKL 3T1HL 1WYDA 3GTLH 3H3VH 3M4OH 4LUVA 2E2IH 1I94L 1BRFA 4OWXB 2IY5B 1IBMQ 4BXXG 5C3EG 2VQEL 4A3LH 3RLNA 1EFWA 1PVOA 4DR2Q 1N32Q 1ZRPA 2YTYA 3DM3A 2ZM6L 4AI2A 4JBWA 4DR4Q 4K9FA 1NY4A 2JA5G 1HNZL 1FL0A 2Z6KC 1HNWL 1VQBA 3PO2G 3CC2A 4L5SA 1RWDA 1I5FA 5H1Sc 2R7FA 3ULPA 3I4NG 1U0LA 2A19A 4GNXA 2XGTA 1UWVA 1E8JA 2HT1A 2UUAQ 1V43A 3RZTA 2BH2A 3S17H 1C9OA 1B8AA 4DK3C 4JAEA 1I3QH 1PH4A 2JA7H 4R4TA 2KCTA 4JI3L 4YY3L 3CW2C 4JC0A 5JJKA 4LF5Q 3SS2A 1PV4A 3CCMA 4C3IH 5GADC 3DLLA 1IW7D 3KYVA 1W2BA 4MTNA 3RZ6A 3H15A 4R4QA 1S30A 4YWLA 2NN6I 3P2AA 5JEAG 3KLWA 4LF4L 1HZ9A 2VUMG 4AIMA 1VQ9A 5C0XI 1HNXL 3CCVA 1NMGA 3PO3H 2JA8G 4JADA 1MIUA 4JI1Q 4LF9L 1VQ5A 4A3MG 5M3MG 1UE6A 1P8LA 5C0XJ 1IZ6A 1LM0A 1IXRA 3K35A 1CAAA 4KI0A 2H12A 1K8GA 2LXJA 1XNQL 3BZKA 2ASBA 1JJCB 1XTDA 2IT1A 4A3LG 5EINC 2ZTEA 4AR3A 3EIVA 4OO1I 4B3MQ 4JI2L 4B3TQ 3RR5A 3F2CA 2M4YA 3STBC 2CCZA 2XJUA 1N34Q 1KHIA 2PVXA 4AQYQ 2V1CC 4DR3Q 1Q12A 2WB1E 4A4IA 1V1QA 4AHYA 2UUBL 2ZIXA 3KYHC 4Y7NH 3B0AB 1MKHA 1WCMH 5DLQE 3U4ZA 4UPAA 2B63G 4O2DA 4DR5L 2FXQA 4AR4A 2HHHL 2KHIA 5FJ8H 4LFCL 1J5EL 3PCOB 4MZ9A 3PZAA 1OXUA 5BR8Q 4GKJQ 1TWFH 3S14H 4DV3Q 4A3EG 3PKJA 3E9IA 2KCMA 1GM5A 4JI5Q 2RF4A 3KJOA 2Q2TA 2E2JH 3IU3I 4ZN1B 2JA6H 1X6OA 3NENA 5GROA 1E22A 3HKZG 1YK5A 3FP9A 3K80C 3AFPA 1SFOH 4X62Q 1QCVA 2ZTCA 3W1GA 4AHXA 3PUYA 3VPBE 2E8GA 3KF8B 1QYBA 1KIXA 1TXYA 4XTCS 5GAHc 4HJAA 2R92H 4AI3A 4IOAA 4LF6L 4B3SQ 1H95A 4LUZA 2DSXA 1VQIA 1J6QA 1K3RA 3VDYA 5DM71 4UP8A 1S24A 4OWWB 3HOUH 5AI3A 4LFAQ 4DV1L 2PQAB 4LHLA 1FGUA 1VQCA 2NN6G 3S15H 3UDFA 5IYDG 4APVA 5LMUQ 5AJ3Q 4A3DH 1EOVA 4LWCA 4KHPQ 3KJPA 5GAEc 3PKIA 3RLOA 4LF7Q 3F1ZA 5C0XG 1IL2A 3S1MH 1RIPA 3EN2A 3GTQH 3TS2A 3ULLA 3AQQA 1YNXA 3HOZG 4C2MH 1SROA 4GN4B 4DR2L 4X64L 2CFMA 1KAWA 4BBSH 3A44A 3S2DH 4BBRH 1XMQQ 4JG2A 4A75A 4YCUA 2I0QA 4DV6Q 2HIXA 4A3BG 5AI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S A;  1KL9 A;  5M5X H;  2R93 H;  5C3E H;  3GTO H;  2EXD A;  4LFA L;  4JBK A;  2UXC L;  3GTG H;  4A93 H;  4ME3 A;  5C44 H;  4KHZ A;  1SMW A;  3WWV A;  2Y0S E;  8RXN A;  1VQM A;  2JA9 A;  2VQF Q;  1PA6 A;  4L5R C;  2LXK A;  1S3O A;  5IYC H;  1RDG A;  4DR1 L;  4BBS G;  4OO1 G;  3CD6 A;  1IBK L;  3S16 H;  1N33 Q;  5LMU L;  2K4K A;  3T1H L;  5AJ3 L;  1Y1V H;  1WYD A;  1PHJ A;  1JB7 A;  3GTL H;  1PH7 A;  3H3V H;  3H0G G;  3MEF A;  3ZJY C;  5M5Y H;  4X66 Q;  5FJ8 G;  3M4O H;  4LUV A;  3J81 c;  2E2I H;  3NBH B;  2ID0 A;  1I94 L;  1YUX A;  4BY7 G;  2EIF A;  1VQL A;  3K81 C;  1BQ9 A;  4PMW A;  3KF6 B;  1VQH A;  1EIF A;  1BRF A;  2PVE A;  4OWX B;  4AH6 A;  1PH9 A;  1HR0 L;  2N49 A;  2VY3 A;  1IBM Q;  4BY1 G;  2JA5 H;  3CCL A;  3FKI H;  4BXX G;  4DR6 Q;  1Q7Y C;  4NXN L;  1VCX A;  1DVB A;  5C3E G;  2R93 G;  1Q1E A;  2VQE L;  2N8N A;  1QZG A;  4JI3 Q;  4A93 G;  5EAY A;  4A3L H;  3RLN A;  1EFW A;  3L7Z C;  4YY3 Q;  3J7A 5;  1NTG A;  5C4J H;  1PVO A;  1FHH A;  2K5H A;  4P74 A;  1OXS C;  5E7N A;  3CC7 A;  4DR2 Q;  1S40 A;  3PO2 H;  1N32 Q;  4JI4 Q;  3HOV H;  1ZRP A;  1K8A C;  2YTY A;  3DM3 A;  4JYA Q;  2DGY A;  1LKP A;  1IYJ B;  4R4C A;  2VNU D;  2ZM6 L;  1Y1V G;  3HOW H;  3U4V A;  1YJN A;  2NVT H;  3I7F A;  2WAQ G;  1SMU A;  4JBW A;  4DR4 Q;  1MJC A;  5H1S E;  1VQK A;  3I4N H;  1TWA H;  2UXD Q;  3B6Y A;  4K9F A;  4LF5 L;  1NY4 A;  4DAY B;  5IY0 A;  4P71 A;  5FLM H;  4JV5 L;  2JA5 G;  2V3B B;  2R7D A;  1HNZ L;  1YBY A;  4YHH L;  1HZB A;  1UE5 A;  4JI7 L;  1NE3 A;  1FL0 A;  1GD7 A;  1KD1 C;  2Z6K C;  4H02 A;  4QY7 A;  3TEH B;  2OCE A;  1HNW L;  3KOJ A;  4DV6 L;  1VQB A;  2BA0 A;  1VQE A;  3MXN B;  4FDB A;  3A5U A;  3PO2 G;  3CC2 A;  1Q86 C;  4L5S A;  5ELO A;  4POF A;  1RWD A;  3JAM i;  3F2D A;  3G48 A;  1I5F A;  4RG1 A;  3G71 A;  1RDV A;  3HOV G;  4LNQ A;  4DR1 Q;  5LMN L;  1IBK Q;  2E2H H;  4TVA B;  2R7F A;  1YHB A;  3ULP A;  3T1H Q;  4GKK L;  1PH2 A;  3U50 C;  3GDE A;  3TS0 A;  1L1O B;  2QEX A;  4HIO A;  5JJL A;  3I4N G;  3CF5 A;  1U0L A;  1XPO A;  4OXP A;  2VQF L;  2A19 A;  4B3R L;  4GNX A;  2JK8 A;  2XGT A;  1I94 Q;  1UWV A;  4IPD A;  1E8J A;  3K8A A;  1HNX Q;  2HT1 A;  2UXB Q;  1S72 A;  5RXN A;  3CP0 A;  5IP7 H;  1N33 L;  4A3G H;  4DV0 L;  2ATW A;  2UUA Q;  4GKJ Q;  3ULJ A;  3PIO A;  1BBU A;  1V43 A;  1YJW A;  3RZT A;  1MJE A;  2PI2 E;  1G6P A;  4WJ4 A;  4X66 L;  2BH2 A;  3AEV A;  4NXN Q;  3W5O A;  3S17 H;  2VQE Q;  3GTP H;  2K5V A;  1SMX A;  2H5X A;  3I2Z A;  1C9O A;  1B8A A;  1TWC H;  3GD7 A;  4DK3 C;  1CKN A;  1YHA A;  1UE1 A;  3AYH B;  1R0G A;  1I3Q H;  1XPU A;  1PH4 A;  1IBM L;  4EQ5 A;  2JA7 H;  1X3E A;  2GVB A;  1QUQ A;  3STB D;  4R4T A;  2WB1 G;  1VQP A;  1HZA A;  2KCT A;  1LTL A;  3ICE A;  4JI3 L;  2ZM6 Q;  2Z6K A;  1PH8 A;  4A3D G;  3MPS A;  4UP7 A;  3JC6 2;  1KC8 C;  4YY3 L;  1B7Y B;  1L0W A;  2Q2I A;  2ZJQ A;  1N32 L;  4JI8 Q;  1PH6 A;  2MFI A;  4JI0 L;  3CW2 C;  1X3F A;  3IRB A;  3Q8D A;  1Z9F A;  4JC0 A;  4JBM A;  4JYA L;  4A3G G;  5IP7 G;  5JJK A;  2QA4 A;  4LF5 Q;  3SS2 A;  2VUM H;  4LFB L;  3UE1 A;  1PV4 A;  3CCM A;  4C3I H;  5GAD C;  1VQ4 A;  1SFO H;  3DLL A;  1T9O A;  1PH3 A;  1Q1B A;  2Q2H A;  3KYV A;  4OX9 Q;  1W2B A;  4Y52 H;  3S1N H;  2IHE A;  1XNQ Q;  4YHH Q;  4JI7 Q;  4IJH A;  4MTN A;  1PFS A;  3M85 A;  4DR4 L;  1EYG A;  1SRU A;  3RZ6 A;  1X9N A;  3H15 A;  4R4Q A;  4X6A H;  5M3F H;  3J80 c;  4UP9 A;  3RYG A;  3J7Z C;  3GTJ H;  1HZC A;  2R7Z H;  4PG3 A;  2WFW A;  1HJP A;  2JA7 G;  1S30 A;  3F2B A;  1NNQ A;  4YWL A;  2JEA I;  2NN6 I;  2NZH A;  5GAG C;  1K0R A;  2OWO A;  2I5L X;  2OQK A;  4GKK Q;  2MQH A;  2NVY H;  5JEA G;  1V9P A;  1CSQ A;  2BH8 A;  2D0P A;  4A76 A;  1KRS A;  4GLX A;  3ERS X;  3KLW A;  4MNO A;  4A3M H;  5JJI A;  4B3R Q;  4HJ9 A;  4LF4 L;  5M3M H;  4X65 L;  1PYB A;  3M9B A;  1HZ9 A;  4NXM Q;  2VUM G;  1OXT A;  3HKZ E;  4DV0 Q;  4JI6 Q;  2AWO A;  1A0I A;  4AIM A;  4BBR G;  1VQ9 A;  3T1Y L;  2XTI A;  3PUV A;  1CKM A;  1YZ6 A;  1AH9 A;  5C0X I;  1KQS A;  4J15 A;  2UXB L;  1HNX L;  1RYT A;  3CCV A;  1OXX K;  5M3F G;  2B29 A;  1NMG A;  2UUA L;  1NMF A;  1XJV A;  3CAM A;  2YTX A;  3PO3 H;  1BKB A;  1HH2 P;  2JA8 G;  1MIU A;  1U5K A;  1YEZ A;  3GTM H;  4JI1 Q;  2RCN A;  3F8T A;  3AFQ A;  4LF9 L;  2JQO A;  1LUZ A;  2Y0S G;  1VQ5 A;  3K0X A;  4OON A;  4DUZ L;  5C44 G;  1BQ8 A;  1LYL A;  4A3C H;  4A3M G;  3M7N A;  4RXN A;  4KLK A;  2PNH A;  1YIJ A;  3A0J A;  1CSP A;  4GNX C;  3HOY H;  4IFD I;  1IBL L;  5M3M G;  4JI0 Q;  5IYC G;  1N36 L;  1UE6 A;  4YWM A;  4BA2 I;  3PGZ A;  5GQO A;  1P8L A;  2ZJR A;  3OTO L;  2UU9 L;  5C0X J;  1YVC A;  4LFB Q;  2IY5 B;  1IZ6 A;  1LM0 A;  2C35 B;  1IXR A;  1JT8 A;  2R6G A;  4R1J A;  5IYB H;  1X65 A;  4GS3 A;  4DV2 L;  1SN8 A;  1H7V A;  1VQA A;  5GAE C;  4NB3 A;  4JI8 L;  3CCR A;  3UDX A;  1JE5 A;  2CWA A;  4R4I A;  4P72 A;  2YTV A;  1E3P A;  4HID A;  1CAA A;  4ALP A;  1C7Y A;  1A8V A;  1I50 H;  3KDF A;  3TQY A;  1T9H A;  4KI0 A;  2D0O A;  4OX9 L;  3PO3 G;  1K8G A;  1YV1 A;  2BA1 A;  3FKI G;  2LXJ A;  3J81 j;  1YUZ A;  3BZK A;  3E0E A;  3CQZ H;  2ALY B;  3CCQ A;  1WFQ A;  1JJC B;  3OW2 A;  4UY8 C;  2ASB A;  1XTD A;  1M90 C;  2IT1 A;  1L2F A;  3CMA A;  4IFD J;  4A3L G;  2K2D A;  4IPG A;  4DV5 Q;  3ER0 A;  2ZTE A;  2HQL A;  1OTC A;  1BFY A;  2I5M X;  3J81 i;  5IT9 c;  5IWA Q;  5LMN W;  4K0K Q;  3RLF A;  4AR3 A;  1PH5 A;  3EIV A;  4L5T A;  3JC6 3;  4LF4 Q;  4RMF A;  4X65 Q;  3M4P A;  4XIG S;  4OO1 I;  1Y14 B;  1XMO L;  1QVG A;  4B3M Q;  1R0J A;  3I56 A;  1J5E Q;  4LFC Q;  3HOW G;  4JI2 L;  4B3T Q;  1EQQ A;  2K14 A;  3T1Y Q;  3RR5 A;  3F2C A;  3TRE A;  2M4Y A;  4GOP C;  3KYW A;  3STB C;  2CCZ A;  2OQ0 A;  1Q82 C;  1VQF A;  5C4X H;  1SE8 A;  2QGQ A;  4NXM L;  2ZJP A;  5FLM G;  3RN5 A;  1QZH A;  1N34 Q;  4JI6 L;  3PWF A;  5HY6 A;  1C09 A;  1KHI A;  2PVX A;  5BR8 L;  1RB9 A;  1Q46 A;  4AQY Q;  4LF9 Q;  1B70 B;  2V1C C;  3D0F A;  4DV3 L;  4DR3 Q;  3CXC A;  2VS1 A;  4A3F H;  3S2H H;  3UE0 A;  4DUZ Q;  2KBN A;  2ES2 A;  1CAD A;  1UE7 A;  3CCJ A;  2KHJ A;  1Q12 A;  2B63 H;  1RL2 A;  2F4V Q;  2CWP A;  2WB1 E;  1IBL Q;  2F52 A;  3K7A H;  3A5Z B;  3PSI A;  4PZ8 A;  4A4I A;  1N36 Q;  1V1Q A;  4JI1 L;  3CPW A;  1XPR A;  2UU9 Q;  3PF4 A;  3OTO Q;  1VQ6 A;  1N9W A;  3I55 A;  2WP8 J;  4DUY Q;  1NBW A;  4L5Q A;  2UUB L;  1IRN A;  2KEN A;  4DV2 Q;  4QIW E;  3PUW A;  3FHW A;  2PMZ E;  1FJG Q;  4IPC A;  4A3K H;  5C4X G;  1KXL A;  4QJF A;  2IX1 A;  1B2J A;  3KYH C;  4X62 L;  3PF5 A;  1YJ9 A;  1AE3 A;  4Y7N H;  1DGS A;  2QL0 A;  1K83 H;  1MKH A;  1IU6 A;  1WCM H;  2N3S A;  3PV0 A;  5DLQ E;  3U4Z A;  5FLX c;  5M5W H;  3I4M H;  4GOP A;  4UPA A;  1YHQ A;  2Q2U A;  1T9Q A;  4A3F G;  1SMM A;  2IX0 A;  2EQS A;  4DV4 Q;  2PQA A;  3CCE A;  4A3E H;  4IJL A;  2CQO A;  2HIV A;  2B63 G;  2VZA A;  2MS3 A;  2KKD A;  4O2D A;  3CCU A;  4DR5 L;  1JJ2 A;  3PUX A;  2FXQ A;  4LF8 Q;  2LSS A;  3HFZ B;  4AR4 A;  1SR3 A;  1WJJ A;  3EBE A;  1XMO Q;  4DNI A;  1EIY B;  2I5H A;  2HHH L;  4AYB G;  1XNQ L;  5GAH C;  1L1O A;  2AHO B;  4JI2 Q;  1LKM A;  2VL6 A;  4DV5 L;  4EX5 A;  4B3S L;  4OWT B;  2AWN A;  1B13 A;  2KHI A;  4JOI A;  4DAM A;  5IWA L;  1OXV A;  4K0K L;  1C0A A;  2NZO A;  1EWI A;  4POG A;  4GN3 B;  1ASZ A;  3TRZ A;  2JJQ A;  5FJ8 H;  1Q81 C;  4LFC L;  4B3M L;  3S1R H;  3PCO B;  4HJ8 A;  1J5E L;  4MZ9 A;  3RZO H;  4B3T L;  3HOX H;  4DV1 Q;  4BY7 H;  3PZA A;  1OXU A;  1WCM G;  2RHQ B;  3K7U C;  2K5N A;  5J3B A;  5BR8 Q;  4DPG A;  1TWF H;  5IE8 A;  4IPH A;  1JMC A;  4A3J H;  3S14 H;  3KDF B;  4DV3 Q;  1E7Z A;  1WI5 A;  4A3E G;  4BY1 H;  4BXX H;  3E9I A;  3CME A;  1GO3 E;  1VQO A;  2JE6 I;  4R4O A;  4PZ7 A;  1E1T A;  1N34 L;  3KYU A;  2KCM A;  1X3G A;  1HR0 W;  2R7Z G;  1GM5 A;  4JI5 Q;  6RXN A;  2RF4 A;  1E24 A;  2ZTD A;  3JC6 6;  1X56 A;  1VQD A;  3KJO A;  4AQY L;  2E2J H;  2Q2T A;  1IRO A;  2IHF A;  4DR3 L;  2YU9 H;  2B3G A;  4WJ3 M;  3M3Y H;  2JA6 H;  2UUB Q;  1X6O A;  3NEN A;  4NPS A;  5GRO A;  4DR7 L;  1E22 A;  3KFU A;  2OTJ A;  2F4V L;  1YK4 A;  3RZD H;  1R0H A;  1E1O A;  3HKZ G;  1YK5 A;  1GKH A;  1PYS B;  3FP9 A;  4KHP L;  1BE7 A;  1X54 A;  3K80 C;  3J80 i;  4DK6 C;  3AFP A;  2JEB I;  1B2O A;  2WAQ E;  1QCV A;  2ZTC A;  1S2Z A;  3BZC A;  3W1G A;  4X62 Q;  3JAM c;  3HOX G;  4DUY L;  4GNX B;  2E5L Q;  3S24 A;  2VW9 A;  4A3J G;  4LF7 L;  2NVQ H;  3PUY A;  3NEL A;  4DV7 Q;  1FJG L;  3S1Q H;  1AE2 A;  4TPU A;  2E8G A;  3KF8 B;  4HIK A;  3U58 A;  1QYB A;  4O0A A;  4HJ5 A;  1KIX A;  1TXY A;  4C3H H;  1Y1W H;  4HIM A;  1EUJ A;  3PUZ A;  4XTC S;  3L0O A;  1Q8K A;  3NEM A;  4HJA A;  4DR5 Q;  1D7Q A;  1TWH H;  2MO1 A;  2RDV A;  4LW1 A;  4X64 Q;  2R92 H;  1CKN B;  2HHH Q;  1YIT A;  7RXN A;  2JA6 G;  4TQU S;  4DV4 L;  4IOA A;  5IYD H;  3QVD A;  4LF6 L;  1A63 A;  4A3C G;  4B3S Q;  1QVF A;  1QUQ B;  1GVP A;  1A62 A;  2OTL A;  3HOY G;  2N78 A;  1IU5 A;  2GMG A;  1H95 A;  4IO9 A;  4LUZ A;  2DSX A;  4LF8 L;  2GN5 A;  3HKS A;  1VQI A;  3CC4 A;  1UEB A;  1J6Q A;  1BBW A;  4P75 A;  1K3R A;  5IYB G;  3OYY A;  3VDY A;  4UP8 A;  1NJI C;  1XNR Q;  1R0I A;  1S24 A;  1FVI A;  4OWW B;  3HOU H;  2A1A A;  1N8R C;  1XMQ L;  2YYZ A;  1X55 A;  4GN5 A;  5AI3 A;  3KF6 A;  2CKZ B;  1Y1W G;  3KYX A;  4GOP B;  4GLV B;  1JJG A;  4AR5 A;  2L15 A;  2GVA A;  4C3J H;  4LFA Q;  2UUC L;  4DV1 L;  2UXC Q;  2PQA B;  4GKJ L;  2R92 G;  1FGU A;  3CPF A;  1VQC A;  2NN6 G;  1L1O C;  5JEA J;  1KRT A;  3UDF A;  5IYD G;  4YWK A;  3S15 H;  2A8V A;  2LCQ A;  3CCS A;  3KYY A;  4JOI C;  4APV A;  5LMU Q;  4DR7 Q;  5AJ3 Q;  4A3D H;  1R0F A;  1EOV A;  1SLJ A;  5AI2 A;  3BJU A;  4JCV E;  2YV5 A;  4LWC A;  4JI5 L;  1R9T H;  1M1K C;  4JBJ A;  3HOZ H;  3BU2 A;  4KHP Q;  1JYB A;  3KJP A;  2MNA A;  1W3S A;  1Z47 A;  3RLO A;  4LF7 Q;  4DKA C;  3HOU G;  2K75 A;  3F1Z A;  3GTK H;  3I4O A;  3E9H A;  4LUO A;  5IP9 H;  5C0X G;  2MO0 A;  4YCV A;  1HR0 Q;  3H3V I;  4AR6 A;  4A3I H;  1IL2 A;  3A74 A;  3S1M H;  1RIP A;  3EN2 A;  1VQG A;  1WOC A;  2E5L L;  3W1B A;  2NVX H;  4YCW A;  3G6E A;  1BVS A;  2AKW B;  4IOC A;  2KN9 A;  4BA1 I;  3GTQ H;  1VQ8 A;  2PI2 A;  4GLA C;  4A3B H;  2RHS B;  3TS2 A;  1G29 1;  3ULL A;  1O7I A;  1EQR A;  1G51 A;  5HGQ A;  4DV7 L;  2AMC B;  5ELN A;  2K52 A;  4DR6 L;  1CUK A;  4LF6 Q;  3AQQ A;  1VS0 A;  1YNX A;  3RN2 A;  1YI2 A;  1P16 A;  4C2M H;  3HOZ G;  1SRO A;  2Z0S A;  4GN4 B;  4AYB E;  4X64 L;  4DR2 L;  4IFD G;  4QQB X;  1PH1 A;  4JI4 L;  2CFM A;  4HJ7 A;  1I6H H;  4PZ6 A;  1KAW A;  1VQN A;  4BBS H;  3L2P A;  1DX8 A;  3A44 A;  1CKO A;  3GO5 A;  1TWG H;  3LGJ A;  1K73 C;  1VQJ A;  5IP9 G;  3S2D H;  4JV5 Q;  4BBR H;  1T9P A;  1D8L A;  2HR5 A;  4A3K G;  1XMQ Q;  4JG2 A;  4A3I G;  1HNZ Q;  3RNU A;  2DUD A;  2PYA A;  3H0G H;  4A75 A;  1FHM A;  4YCU A;  4QGU A;  1QVC A;  2UXD L;  1HNW Q;  1VCI A;  4P73 A;  2I0Q A;  3UDG A;  5K36 G;  2K50 A;  1VQ7 A;  3D31 A;  3PIP A;  4DV6 Q;  1LKO A;  1ASY A;  2HIX A;  2UUC Q;  3I4M G;  3UDI A;  4A3B G;  1XNR L;  4QL5 A;  1B71 A;  3M4Q A;  3SGI A;  5LMN Q;  2JA8 H;  1K9M C;  2D62 A;  2F3I A; 
#chains in the Genus database with same CATH topology
 2B8F A;  4HMJ A;  5C3E H;  2EXD A;  3GTO H;  2UXC L;  4ME3 A;  1ONL A;  4KHZ A;  5C44 H;  4CJ2 C;  5JJZ A;  2E2D C;  4AI0 A;  1WTP A;  4OO1 G;  1KNE A;  5ELC A;  3GV3 A;  2WII B;  2RSO A;  3V05 A;  1AN8 A;  4UDU C;  1PH7 A;  3P20 A;  4HAE A;  3ZJY C;  5FJ8 G;  3NBH B;  3U9S A;  2EIF A;  3KF6 B;  3MQK B;  4N9T A;  1Q3L A;  2JA5 H;  2VY3 A;  3AU7 A;  1ET6 A;  1VF7 A;  1MSH A;  2N8N A;  1WTH A;  1TY0 A;  2RA4 A;  4L63 B;  5D3I B;  3J7A 5;  3PO2 H;  2D2C C;  4P74 A;  2PCF B;  4JI4 Q;  4QMG A;  1K8A C;  2KVM A;  2NVX L;  5J22 A;  1EY0 A;  4JYA Q;  2DGY A;  4R4C A;  2PZW A;  4B08 A;  2NBF A;  3HOW H;  1ODH A;  1PMR A;  1YJN A;  1TS4 A;  2WAQ G;  1SMU A;  2F0W A;  2OEO A;  5H1S E;  1VQK A;  3I4N H;  1TWA H;  3S1N B;  5AFW A;  2MP1 A;  3T4A C;  4LF5 L;  4DAY B;  1ICW A;  4K5X A;  4KV6 A;  1VZG A;  4JV5 L;  4ME5 A;  3CRK C;  1Q90 A;  2AQC A;  1HZB A;  3NP8 A;  3J7A V;  1GD7 A;  1KD1 C;  4H02 A;  3TEH B;  3LWE A;  4XT3 B;  2HD3 A;  3MXN B;  1VQE A;  4E6Y A;  3M4Y A;  4N8F A;  1SNM A;  1Q86 C;  3JAM i;  3HOV G;  3F2D A;  1RDV A;  5KRU A;  5ELE A;  2V0E A;  4DR1 Q;  5MFP A;  2E2H H;  1DON A;  4FNF A;  3LWV B;  3PMF A;  3U50 C;  3D6W A;  3HEJ A;  1L1O B;  2JA8 L;  4U68 A;  5JJL A;  1ZKO A;  3CF5 A;  1XPO A;  4OXP A;  2BOS A;  2UXB Q;  4IPD A;  1LLR D;  5RXN A;  3CP0 A;  1N33 L;  2G9D A;  4A3M L;  5J39 A;  2ZT9 C;  1LTG D;  1SJE D;  5M3M L;  1YJW A;  2PSM C;  4WJ4 A;  4X66 L;  4NXN Q;  3W5O A;  5FO8 B;  4DK1 A;  3BVM A;  1WCM B;  3GTP H;  2H5X A;  3CKI B;  1BBX C;  2ERJ A;  2NUC A;  3M4O L;  2E2I L;  1XPU A;  4V0B A;  5C6A A;  5LL6 S;  1X3E A;  2KOL A;  5M3F B;  1M8A A;  1LTL A;  4C1N I;  3P1H A;  4A3D G;  4UP7 A;  4EGV A;  3HZX A;  1B7Y B;  5JEA H;  1RJT A;  4JI8 Q;  1PH6 A;  1Z9F A;  2HDM A;  4A3L L;  4ZUI A;  2VUM H;  4CKB A;  3D6C A;  4DA2 A;  4K6D A;  1T9O A;  1Q1B A;  4Y52 H;  4JI7 Q;  1PFS A;  2XJQ A;  3DWQ A;  4WFN 1;  4IUP A;  2JI3 A;  3DXJ C;  1TWF B;  3S14 B;  5BN3 A;  5IOC A;  3GTJ H;  1HZC A;  2R7Z H;  4FYD A;  4KJN A;  5JOB A;  1Y8P B;  3I90 A;  2B2W C;  1SE2 A;  1I50 L;  1NXG A;  4MTK A;  2OWO A;  1PTO F;  1EQV A;  1CSQ A;  4A3M H;  2M4V A;  1KRS A;  3ERS X;  4MNO A;  3EVQ A;  4B3R Q;  4HJ9 A;  2JA6 B;  5M3M H;  3M9B A;  2IJ0 A;  2KUM A;  4DV0 Q;  3HOY B;  2AWO A;  4RCO A;  4BBR G;  1O7L A;  3IFD A;  4HMI A;  4AI1 A;  1II3 A;  1CKM A;  1YZ6 A;  1KQS A;  2QW7 A;  4ZKB B;  5A2Q E;  3A54 A;  3DMU A;  1RYT A;  3IFT A;  3TSS A;  3WWN B;  3C46 A;  2YTX A;  1SMY C;  1P7P A;  2CKA A;  1U5K A;  5C3W A;  3GTM H;  2RCN A;  3AFQ A;  1S5D D;  1LUZ A;  4PNY A;  4OON A;  5CC4 A;  5C44 G;  1WTW A;  4IUU A;  1PFV A;  5IGD A;  5M9O A;  4RXN A;  1YIJ A;  4JI0 Q;  2ZJR A;  5GQO A;  4LFB Q;  1S5B D;  1JT8 A;  2R6G A;  1I3Q L;  1X65 A;  3NUC A;  4GS3 A;  2JA7 L;  1SN8 A;  5GAE C;  3CCR A;  4G4K A;  3H97 A;  4R4I A;  2YTV A;  4EQP A;  4ALP A;  4HID A;  2L55 A;  1HQM C;  1C7Y A;  1I50 H;  5GAG c;  3KDF A;  3HOU B;  2D0O A;  3RMH A;  2BDN A;  4OX9 L;  2BA1 A;  1SXT A;  1YUZ A;  3E0E A;  1NCV A;  3CQZ H;  3CCQ A;  4C3I L;  2A6H C;  4RGO S;  1A3U A;  1I6V C;  4J6H A;  3ND9 A;  3DM1 A;  2I5M X;  3K0Y A;  3J81 i;  1TU2 B;  5IT9 c;  2JSO A;  3S15 B;  3L9A X;  3A8J E;  2SNS A;  3NQT A;  1CHQ D;  5IGF A;  1Y14 B;  3EJI A;  1R0J A;  3HOW G;  2DNC A;  3BYY B;  3TRE A;  2OT2 A;  2Q8R E;  4QIW B;  1YNN C;  2OQ0 A;  2IX3 A;  5DM6 3;  4KMU C;  3BDO A;  2QGQ A;  2EYM A;  3EA6 A;  4NXM L;  2A6H D;  4JI6 L;  2WB1 P;  3PWF A;  4O42 A;  5HY6 A;  4A3K B;  5BR8 L;  1Q46 A;  1EZ8 A;  3OMC A;  1B70 B;  1EY8 A;  4DV3 L;  3CXC A;  1HHV A;  2OXP A;  5C5L A;  4KD4 A;  2NTT A;  1A6X A;  4L6T B;  1EL0 A;  1B3A A;  1RDP D;  2EYP A;  2B63 H;  2KHJ A;  1IBL Q;  3K7A H;  3B08 B;  4PZ8 A;  3PSI A;  1N36 Q;  1H9J A;  3PF4 A;  5JPN C;  1XPR A;  1PLF A;  1YNN D;  3MZ5 A;  1TT2 A;  2WP8 J;  5IOD A;  4C2M B;  4DUY Q;  4CDD C;  3PO3 L;  1IRN A;  2KEN A;  2XWB B;  3FHW A;  1FJG Q;  1STE A;  4BBS B;  5C4X G;  3VYT A;  2B2U C;  4QJF A;  2F0H A;  2Z3Q B;  3S2D B;  1B2J A;  4X62 L;  2C6A A;  1OWC A;  1O7Z A;  4UHV A;  4GOP A;  1PZJ D;  1YHQ A;  4A3F G;  2EQS A;  4DV4 Q;  4A3E H;  4IJL A;  2EYO A;  1A3T A;  3MXP A;  2PZT A;  2IPK D;  1JJ2 A;  4X3T A;  4LF8 Q;  2AUJ D;  2EE1 A;  2DJF C;  3R2T A;  1EIY B;  1F9P A;  2AHO B;  1LKM A;  4DV5 L;  4B3S L;  2K04 A;  4KN7 C;  4DAM A;  2YU9 B;  2EY5 A;  5IWA L;  4K0K L;  1S4Z A;  2NZO A;  1EWI A;  3HJY B;  1C48 A;  1B53 A;  1LV9 A;  3TRZ A;  1ENC A;  2QDL A;  3TP8 A;  1Q81 C;  3C2P A;  4HJ8 A;  2FHT A;  2N88 A;  2Y0S P;  2RHQ B;  3E6Z X;  5KIX A;  5CGK A;  3K7U C;  2O2L D;  1JIC A;  1E7Z A;  2H1E A;  1STG A;  3OHX C;  3SK4 A;  4BY1 H;  3CME A;  3K6O A;  3KYU A;  1X3G A;  3VYS A;  2R7Z G;  1BUV T;  5EKL A;  3S1Q B;  6RXN A;  2ZTD A;  3DEO A;  2WIN B;  4XYO A;  4WJ3 M;  1FYC A;  5KYI A;  3PO2 B;  3ITP A;  4NPS A;  1JWU D;  2F4V L;  1KLG D;  1ZXT A;  1GKH A;  4KHP L;  3J80 i;  3BZC A;  4V19 0;  2PO4 A;  3N52 A;  4FXK C;  3I4N B;  1PXU A;  4A3J G;  4LF7 L;  1TWA B;  4N9P A;  2Z9H A;  4HIK A;  3U58 A;  5CMD A;  4HJ5 A;  5CV7 A;  1D6E C;  4C3H H;  4X3U A;  2ZXP A;  4HIM A;  1D2B A;  1EUJ A;  1ML0 D;  1EWC A;  3PUZ A;  1EY6 A;  4XDX A;  3MXU A;  4ZAI A;  2C9O A;  4LW1 A;  4O1N A;  1CKN B;  7RXN A;  4Y7N L;  2KCN A;  5IYD H;  1A15 A;  1DOL A;  1LAB A;  5C3X A;  1A63 A;  1QVF A;  3TBI B;  1QUQ B;  4A3B L;  2N78 A;  1OWB A;  4IO9 A;  3F2U A;  4FP5 D;  2GN5 A;  1EEI D;  3HKS A;  4DK0 A;  1UEB A;  4P75 A;  1BBW A;  2A1A A;  1XMQ L;  1X55 A;  5C0X H;  4K6L A;  4PV1 C;  2EJG C;  1WTV A;  3KYX A;  1JJG A;  2L15 A;  2GVA A;  1CA6 A;  1T5X D;  4ABN A;  4B9W A;  3NBI A;  2HVY C;  5FJ8 L;  3CPF A;  1KDB A;  2PW5 A;  1L1O C;  2BDO A;  2NVX B;  3P7J A;  2LCQ A;  4JOI C;  3S14 L;  4DR7 Q;  2F0L A;  1R0F A;  3JAM L;  3BJU A;  1M1K C;  1S5C D;  2YV5 A;  3HOZ H;  1VZI A;  1LT3 D;  3TP5 A;  2ICE C;  2MNA A;  1KNA A;  1MGS A;  4CGY B;  2E2J L;  1CZG A;  3E9H A;  1TS5 A;  2EDG A;  1HUM A;  1B44 D;  2O5J C;  2VUM B;  3S16 L;  4E6I A;  1PZK D;  4C3J G;  3BVZ A;  3R93 A;  2E5L L;  2KN9 A;  1JOO A;  3D3R A;  1VQ8 A;  4OEM B;  4A3B H;  3FRP B;  3MEH A;  1SFO L;  4DV7 L;  5IT9 L;  5ELN A;  2K52 A;  1LT6 D;  4FF1 A;  5JVG 1;  3URY A;  1P16 A;  2JA8 B;  1HQR D;  2B5I D;  5ISR A;  1H9S B;  4QQB X;  2DJG C;  4JI4 L;  3J7Y 1;  2O5J D;  4OO1 H;  3L2P A;  3MAQ A;  5C4J L;  3J7A F;  4LHN A;  4A3M B;  4V19 6;  1W6K A;  1D5X C;  4JK1 C;  1K73 C;  2R92 L;  1VQJ A;  5M3M B;  1T9P A;  2HR5 A;  1EQT A;  5AN9 H;  1HNZ Q;  2DUD A;  1AZQ A;  2PYA A;  1BCP B;  3R3O A;  2F1M A;  1QVC A;  1HNW Q;  1VCI A;  4P73 A;  3SVM A;  1VQ7 A;  2UUC Q;  3D31 A;  1LKO A;  2K32 A;  3W2D A;  3G7L A;  1XNR L;  3M4O B;  2E2I B;  1B71 A;  1MI2 A;  3Q22 A;  3M4Q A;  3QWN A;  2MPM A;  3SK8 A;  1YIT A;  1XTC D;  1KL9 A;  4CJ0 B;  2KJX A;  3K57 A;  4XT1 B;  1SMW A;  2JN4 A;  2Y0S E;  4B8C D;  2JA9 A;  1TVX A;  3IL8 A;  1PA6 A;  3E5S A;  2LXK A;  1MD2 D;  4TSS A;  4DR1 L;  5IGE A;  3S16 H;  2K4K A;  2J0T D;  1PZX A;  1PHJ A;  5FK9 C;  1EFI D;  3E0J A;  2HUG A;  1KDC A;  4U67 3;  3MEF A;  5M5Y H;  4XQQ A;  2ID0 A;  3OWF A;  1YUX A;  4A3D L;  1VQL A;  4ODG A;  4RWS C;  1VQH A;  2CH4 A;  3NWS A;  2B2Y C;  1EIF A;  3AEV A;  1FNW A;  1HR0 L;  1PH9 A;  2N49 A;  4BY1 G;  3FKI H;  1I50 B;  4NXN L;  1VCX A;  5MLC 3;  2R93 G;  1Q1E A;  4JI3 Q;  3HS0 C;  5KND A;  1QZG A;  5EAY A;  3L7Z C;  4YY3 Q;  1NTG A;  5C4J H;  1FHH A;  3S1M L;  4IUQ A;  1OXS C;  5E7N A;  3CC7 A;  1PFW A;  3HOV H;  1RCV D;  4XQN A;  2KED A;  2B2W A;  3GTQ L;  1TWC L;  2VNU D;  1Y1V G;  3ND8 A;  2NVT H;  3I7F A;  2E75 C;  1MJC A;  2PPB C;  2UXD Q;  1QNK A;  1U4M A;  5ELF A;  5IY0 A;  2DY8 A;  1K3B C;  1KLU D;  5JPM C;  5FLM H;  2ERS A;  5EJW A;  2F0J A;  2R7D A;  1YBY A;  4JI7 L;  5E4X A;  4QY7 A;  4C3H G;  2OCE A;  2IWH A;  4BBR L;  3KOJ A;  3A5U A;  5ELO A;  4POF A;  1S5F D;  4RG1 A;  2HCC A;  5LMN L;  1JOR A;  5FO7 B;  5I4D A;  2B63 B;  3J81 L;  3GDE A;  1I3Q B;  2JA7 B;  2QEX A;  2VQF L;  1CTM A;  4LMQ D;  4B3R L;  1EYD A;  5C3E L;  3GTO L;  2JK8 A;  1HNX Q;  5C44 L;  2XVS A;  4DV0 L;  5HUR A;  3PIO A;  2F0V A;  4K2K A;  2PI2 E;  1G6P A;  3BYT B;  1EIG A;  4KY7 A;  1DCZ A;  2J7Z A;  4QIW P;  2K5V A;  2M6O A;  5I6Y A;  1TWC H;  3GD7 A;  1EOT A;  3AYH B;  4OEL B;  1R0G A;  4A3E B;  1IBM L;  4EQ5 A;  1VQP A;  5CV8 A;  5EIO C;  1PH8 A;  2Z6K A;  3LX0 A;  5CV4 A;  3MPS A;  3JC6 2;  1VZH A;  2JA5 L;  1KC8 C;  2Q2I A;  5KGU A;  1N32 L;  2MFI A;  4JI0 L;  1EYA A;  1X3F A;  4JBM A;  4A3G G;  5IP7 G;  2HCI A;  4LFB L;  3A8I E;  3UE1 A;  3HKZ B;  5MFZ A;  2FIN B;  3PIP 3;  2IHE A;  1XNQ Q;  4YHH Q;  4DR4 L;  4IJH A;  3M85 A;  1EYG A;  3HOW L;  1I4H A;  1X9N A;  2J4X A;  4X6A H;  5K2M E;  2LS0 1;  4UP9 A;  1GUW A;  2XRQ D;  3TZU A;  2BCO A;  3F2B A;  2NB0 A;  1NNQ A;  3T53 B;  5A35 A;  1STB A;  2OF1 A;  3E3X A;  4GKK Q;  1BO0 A;  3PO3 B;  1GUG A;  2MQH A;  2NVY H;  2J9U B;  1V9P A;  2PZU A;  5JJI A;  1PYB A;  1OXT A;  3P75 A;  1VMC A;  3IAY A;  1A0I A;  4R8I A;  2JI2 A;  3PUV A;  1AH9 A;  3PL5 A;  2E2H L;  4DNR B;  3KUP A;  1H9R A;  1Z92 B;  4I7Z C;  5M3F G;  2B39 A;  3A56 A;  4JW0 A;  1ZEQ X;  2UUA L;  1XJV A;  1RTN A;  1LTI D;  2RDF A;  3CAM A;  1BKB A;  3GP7 A;  1YEZ A;  5CV6 A;  3FPU B;  4QB4 A;  2JQO A;  3O13 A;  1X32 A;  3VA5 A;  3K0X A;  1BQ8 A;  4HSV A;  3M7N A;  2NTS A;  3V96 A;  3A0J A;  4A3F L;  1IBL L;  4IFD I;  1N36 L;  4YWM A;  3S2H L;  3GTP L;  3EFX D;  3PGZ A;  4ZQ3 A;  2F0F A;  4R1J A;  2Q8T A;  1JCK B;  5IT9 E;  1H7V A;  3J80 L;  2F0Q A;  3FDJ A;  2CWA A;  4P72 A;  1E3P A;  1J8I A;  3TQY A;  1T9H A;  1YV1 A;  3FKI G;  4JAF A;  2VUM L;  1HRJ A;  2CR8 A;  4UY8 C;  1WFQ A;  1GXD C;  4IFD J;  1L2F A;  1TKW B;  4Y52 L;  4IPG A;  1D1K A;  3ER0 A;  1K0S A;  1OTC A;  5M5W L;  1BFY A;  5LMN W;  3RLF A;  2AYJ A;  1PH5 A;  3JC6 3;  4X65 Q;  3Q0A A;  1SNP A;  4XIG S;  1RTO A;  4M8A A;  3WOF A;  1QVG A;  3I56 A;  1J5E Q;  4LFC Q;  3GTJ L;  2R7Z L;  1RYQ A;  4J8Q A;  3T1Y Q;  3ZG6 A;  3WWL A;  3DEP A;  3KLS X;  3NBH A;  1Y8O B;  2PYK A;  5C4X H;  3S9W A;  1SE8 A;  4DFA A;  1B3Q A;  4HCS A;  1VF5 C;  3LWP B;  5FLM G;  3RN5 A;  2AQ2 B;  2K5D A;  4RCN A;  1C09 A;  1HCZ A;  1RB9 A;  3M7G A;  2KEE A;  2WKD A;  2QDB A;  3D0F A;  1JQY D;  3BS1 A;  5ELD A;  4Y7N B;  4A3F H;  1BR9 A;  4KKT A;  1F2L A;  3NTI A;  4DAP A;  4DUZ Q;  3S2H H;  2L1B A;  4CDE C;  3K5L A;  4A3J L;  4A3B B;  3CCJ A;  3LWR B;  1RL2 A;  2CWP A;  1H9M A;  4CDF C;  2F52 A;  5EBC A;  2HQE A;  1ENA A;  4IFD H;  4JI1 L;  2UU9 Q;  3OTO Q;  1VQ6 A;  1N9W A;  4KKS A;  3I55 A;  1NBW A;  1AW7 A;  4DV2 Q;  4QIW E;  3GTM L;  2ZXR A;  2LFN A;  2B2T C;  1KXL A;  1M4V A;  1CHP D;  2IX1 A;  4HN7 A;  1STH A;  3PF5 A;  5K36 H;  3BDL A;  1K83 H;  3LWQ B;  3PV0 A;  3PIO 1;  2CQA A;  5FLX c;  5M5W H;  3I4M H;  1T9Q A;  5DM6 1;  1A3V A;  1D5M C;  3H9B A;  3CCE A;  2XIW A;  2B8G A;  3I4L A;  2MS3 A;  2KKD A;  1X3P A;  3CCU A;  2A5H A;  2I46 A;  3EBE A;  1XMO Q;  4DNI A;  4AYB G;  5GAH C;  1L1O A;  4F7X A;  2VL6 A;  1BCP C;  2E2J B;  2AWN A;  1B13 A;  4JOI A;  3CQZ L;  1ENF A;  1OXV A;  1PDQ A;  1SAP A;  1YNJ D;  1C0A A;  3H3V C;  1XYI A;  3S16 B;  2CKC A;  4GN3 B;  2JJQ A;  4B3M L;  3S1R H;  2RBM A;  2O5I C;  3RZO H;  4B3T L;  4DV1 Q;  4BY7 H;  2WAQ B;  2X69 A;  5J3B A;  5D3D A;  1F2Y A;  4IPH A;  1JMC A;  4A3J H;  2GA4 B;  3KDF B;  1SFO B;  1WI5 A;  1WJV A;  1S5E D;  4OIK A;  4DXG A;  1STY A;  1VQO A;  4PZ7 A;  1E1T A;  1UUP A;  4ZUJ A;  1N34 L;  4AHW A;  5T1I A;  1PRT B;  2SNM A;  1BCP D;  1PFU A;  3JC6 6;  1E24 A;  4AQY L;  1SEB D;  1X56 A;  4FVM A;  4XXE A;  1IRO A;  2IHF A;  4DR3 L;  1QJO A;  4C3J L;  1D5Z C;  2B3G A;  2ICI A;  2Z4H A;  5C4J B;  4MN3 A;  3I8Z A;  1EZ6 A;  1E2W A;  4DR7 L;  2R92 B;  3KFU A;  3MWY W;  3HOV B;  1YK4 A;  3RZD H;  1BE7 A;  1X54 A;  3JAM c;  1B2O A;  2B63 L;  1LTT D;  3HOX G;  2EJF C;  4GNX B;  3K7A L;  3S24 A;  2NVQ H;  2Z3R B;  3NEL A;  1F77 A;  1DYQ A;  4TPU A;  3OW7 A;  4O0A A;  1Q8I A;  2L5T A;  1GHJ A;  3SR1 A;  3Q23 A;  2RSN A;  1Q8K A;  1WVL A;  1I4Q A;  4K8I A;  4X64 Q;  2F3W A;  3P8B A;  5MF6 A;  1NSN S;  4QCL A;  3I73 A;  2RFK B;  3MC0 B;  3K59 A;  1EYC A;  1A62 A;  1GVP A;  1WD0 A;  2OTL A;  2NWG A;  3NHH A;  1IU5 A;  2GMG A;  2A6E C;  3BVG A;  4A3E L;  3D4W A;  4A3D B;  5HGT A;  3D4D A;  1IYV A;  1FNV A;  2FMM A;  1R0I A;  1N8R C;  1I6H L;  2YYZ A;  4GN5 A;  2XJR A;  3WOE A;  1Y1W G;  2AQ3 B;  4GLV B;  4GOP B;  4C3J H;  1HUN A;  4KY5 A;  2UUC L;  2UXC Q;  4F8M A;  2NYD A;  5DNF A;  3S1M B;  2A68 D;  4GKJ L;  2EVB A;  3NTH A;  2A6E D;  1KRT A;  4YWK A;  3HJW B;  3GTQ B;  1TWC B;  2A8V A;  4EQO A;  1E2V A;  1KAA A;  1SLJ A;  2IL8 A;  4JI5 L;  1R9T H;  2G5D A;  4BY1 L;  4WOR A;  4ZKC B;  5M5X L;  2XSC A;  1SE4 A;  1W3S A;  5COR A;  5KNB A;  1DXM A;  1Z47 A;  1TS3 A;  2WAC A;  3QQC E;  1NNX A;  3I4O A;  1GOZ A;  2PQE A;  2MO0 A;  2XJV A;  3LWU A;  1ICF B;  4AR6 A;  5T1G A;  1ZYR C;  3A74 A;  4ZCK A;  4AHZ A;  4OHJ A;  1Y1V L;  1VQG A;  3H94 A;  4BBR B;  2EPB A;  3W1B A;  4IOC A;  2M6P A;  4BA1 I;  3NTK A;  4GLA C;  2RHS B;  1G29 1;  1JWM D;  5HGQ A;  2AMC B;  1CUK A;  3AB9 A;  1VS0 A;  3RN2 A;  3T13 A;  2Z0S A;  4IFD G;  1E0B A;  5C3E B;  4C3H L;  3GTO B;  2BE5 C;  1I6H H;  4PZ6 A;  5C44 B;  1VQN A;  1ZYR D;  1CKO A;  2D9U A;  1TWG H;  3LGJ A;  4JV5 Q;  5IP9 G;  4A3I G;  5IYD L;  3QG1 A;  1FHM A;  2UXD L;  1DJR D;  5K36 G;  3UDG A;  1XX8 A;  3PIP A;  1BNZ A;  1ASY A;  3I4M G;  1RHP A;  3UDI A;  1F9S A;  2R3Z A;  4QL5 A;  2JYO A;  3HKZ P;  3QJY A;  3SGI A;  1RKN A;  2M2L A;  2F3I A;  3G4S A;  5M5X H;  2BE5 D;  2R93 H;  4LFA L;  2JA5 B;  3WWV A;  1HXY D;  2F0I A;  8RXN A;  2VB2 X;  4CKC A;  1S3O A;  3KK7 A;  5IYC H;  3CD6 A;  4HR7 B;  1N33 Q;  5LMU L;  2F03 A;  5AJ3 L;  1Y1V H;  1JB7 A;  1K8O A;  3H0G G;  3NSW A;  4X66 Q;  5EPJ A;  5CR3 A;  5FLX L;  5IGG A;  3J81 c;  3HOW B;  4BY7 G;  3K81 C;  1BQ9 A;  3HOZ L;  1WTQ A;  3TN2 A;  4PMW A;  1O80 A;  1GUS A;  2PVE A;  4AH6 A;  4Q5V A;  3CCL A;  4A3G L;  4DR6 Q;  1Q7Y C;  3AMU A;  2RVL A;  1U4L A;  1DVB A;  4Q0F A;  1DZ1 A;  2MHV A;  4A93 G;  1QB5 D;  1LO5 D;  2D5D A;  3QOJ A;  4WJW A;  2K5H A;  1DOK A;  2EY4 E;  1S40 A;  5D65 A;  5COY A;  2XJP A;  2F0U A;  1BCP F;  1LKP A;  1IYJ B;  1WD1 A;  2EXZ A;  1GHK A;  3U4V A;  4EVO A;  2E2H B;  3H6M A;  2F3V A;  3B6Y A;  1MSG A;  4P71 A;  3QOL A;  2V3B B;  4U67 1;  4XQJ A;  1SNC A;  1UE5 A;  4YHH L;  1NE3 A;  2EY1 A;  1EWH A;  3S1N L;  4DV6 L;  2BA0 A;  2F4I A;  2X6G A;  4FDB A;  4NKL A;  4A3F B;  3G48 A;  3L3O C;  3G71 A;  3S2H B;  1AFP A;  4LNQ A;  3GTP B;  3J7Z 1;  1EY9 A;  1IBK Q;  1W6J A;  4TVA B;  1LT4 D;  1YHB A;  3T1H Q;  4GKK L;  1PH2 A;  4F87 A;  2IW3 A;  3TS0 A;  4GS7 D;  4HIO A;  2NYZ D;  3Q6S A;  2XJS A;  2F0K A;  1I94 Q;  4IUT A;  3K8A A;  3SK6 A;  5EKK A;  5IP7 H;  4TRD A;  1S72 A;  4A3G H;  2ATW A;  5JVH 1;  3VYU A;  3ULJ A;  2HDL A;  1BBU A;  4QUC A;  5C4H A;  1LT5 D;  1MJE A;  1ILQ A;  5G3L D;  4LJZ C;  2VQE Q;  2XJT A;  1SMX A;  3I2Z A;  5M5W B;  3NFP I;  5M5Y L;  1CKN A;  4F88 A;  2PMZ P;  1YHA A;  1UE1 A;  2GVB A;  3STB D;  1QUQ A;  4JPB W;  4WRD A;  2WB1 G;  1HZA A;  4GZY C;  3GTJ B;  3ICE A;  2R7Z B;  2K6A A;  2ZM6 Q;  1QQT A;  2RKS A;  4ZLT F;  4HCE A;  3FKI L;  1L0W A;  2ZJQ A;  1O7Y A;  1NXE A;  1NAP A;  3IRB A;  3Q8D A;  4JYA L;  2QA4 A;  2QKI C;  1NR4 A;  1VQ4 A;  2PPT A;  3HRZ C;  1SND A;  3HOV L;  2Q2H A;  4OX9 Q;  1CQV A;  3S1N H;  2AUS B;  3EQL C;  3LPE B;  5KNC A;  3C1E A;  5I9P A;  1JOQ A;  1SRU A;  1F9Q A;  1SYC A;  2NVT L;  4DU9 A;  5I9O A;  5M3F H;  4A3J B;  3J80 c;  3RYG A;  4KY6 A;  3J7Z C;  1HA5 A;  1XXG A;  4PG3 A;  2WFW A;  1HJP A;  2JA7 G;  2K5W A;  3OSO A;  2JEA I;  1VDZ A;  2NZH A;  5GAG C;  1K0R A;  5FLM L;  3LWO B;  1B9N A;  2L0Z A;  2FMC A;  2I5L X;  2JP1 A;  2N55 A;  2O4X A;  2OQK A;  3RD4 A;  3H91 A;  3GTM B;  4H0L C;  2BH8 A;  2D0P A;  4A76 A;  4GLX A;  1V1P B;  1WTO A;  4X65 L;  3K5M A;  4NXM Q;  3HKZ E;  4C3I G;  4JI6 Q;  1I4P A;  2RQX A;  3SXH A;  3T1Y L;  1IL8 A;  2XTI A;  3VR2 A;  1PRT C;  2B2T A;  4J15 A;  1BQQ T;  3MA2 B;  2UXB L;  2PNR C;  1OXX K;  2B29 A;  2NVQ B;  3PIP 1;  1NMF A;  3W3A A;  4TVM A;  1HH2 P;  3MXG A;  2WAQ P;  3F8T A;  2Y0S G;  1QNU A;  4DUZ L;  2JI1 A;  2XWJ B;  1LYL A;  4A3C H;  3CQZ B;  4KLK A;  2PNH A;  3HOY H;  4GNX C;  1CSP A;  2K33 A;  1EY7 A;  5IYC G;  4BA2 I;  1IKM A;  4HED A;  2QIL A;  3N6R A;  4C2M 1;  5FO9 B;  2UU9 L;  1PRT D;  2B2V C;  3OTO L;  1YVC A;  2C35 B;  2I07 B;  3MHB A;  5IYB H;  4DV2 L;  1Z7T A;  1VQA A;  4NB3 A;  4JI8 L;  3UDX A;  1JE5 A;  1PFN A;  3CRL C;  1A8V A;  4KD3 A;  3PO3 G;  2F0D A;  5DAU A;  3J81 j;  2ALY B;  4C3J B;  3OW2 A;  3MSU A;  1M90 C;  1L0X B;  3CMA A;  2G9H D;  2K2D A;  4DV5 Q;  1XWE A;  2HQL A;  4K0K Q;  5IWA Q;  4L5T A;  4YIJ A;  4LF4 Q;  4RMF A;  4X6A L;  3M4P A;  1DD2 A;  3H99 A;  1XMO L;  4JAG A;  1BDO A;  3I70 A;  4RFB A;  3QO2 A;  1EQQ A;  3K7A B;  2K14 A;  4GOP C;  4BWG B;  2SOB A;  3KYW A;  5FOB B;  1Q82 C;  3VYR A;  1VQF A;  3VR4 A;  2NVY L;  1V8Q A;  2ZJP A;  4FF4 A;  1QZH A;  1B4O A;  3KF8 A;  5JVG 3;  4LF9 Q;  2VS1 A;  3QIA A;  1GJX A;  3HOX L;  2K28 A;  3UE0 A;  5A2Q L;  2KBN A;  5E1F A;  2ES2 A;  1CAD A;  2P5Z X;  1UE7 A;  4NDX A;  2F4V Q;  5D14 A;  5FLX E;  3A5Z B;  1DOM A;  4NMZ A;  3CPW A;  4XXB B;  4L5Q A;  2AUK A;  1B50 A;  4G6B A;  3PUW A;  1PTO H;  1I6H B;  2PMZ E;  4IPC A;  4A3K H;  3M3Y L;  4FXD A;  4RA8 A;  2TSS A;  1QWY A;  1RD9 D;  4OIJ A;  1AE3 A;  1YJ9 A;  1DGS A;  2QL0 A;  4AYB P;  1IU6 A;  2N3S A;  4FF3 A;  4OGQ C;  1JE4 A;  2Q2U A;  2XNA C;  1FGB D;  4XYQ A;  1SMM A;  5E3F A;  2IX0 A;  2PQA A;  1E2Z A;  1UAP A;  4RGM A;  2CQO A;  5IGC A;  1B1Z A;  2HIV A;  2VZA A;  5G3L F;  1LTS D;  4BS9 A;  1A2T A;  3PUX A;  4BY1 B;  1I4R A;  2LSS A;  1CT1 D;  1SR3 A;  1WJJ A;  1Y1W L;  3HFZ B;  5M5X B;  2I5H A;  2TMP A;  2WKC A;  4JI2 Q;  4RHS A;  4DAV A;  4UY8 1;  4EX5 A;  4OWT B;  1TWH L;  1Y8N B;  3J7Y W;  1KTK A;  3WDN A;  4POG A;  1ASZ A;  3I91 A;  1TQO A;  1Y1V B;  2M00 A;  1ET9 A;  3HOX H;  1QG7 A;  1WCM G;  5IE8 A;  2K5N A;  4CDC C;  4DPG A;  4ULL A;  1AZP A;  2K05 A;  3NXW A;  1L0Y B;  4K2L A;  4BXX H;  3JAM E;  1GO3 E;  2JE6 I;  4R4O A;  1HR0 W;  2B2U A;  4B9X A;  4QUF A;  1SYF A;  5C4X L;  1VQD A;  4G7Z C;  1G2S A;  4C3H B;  2YU9 H;  1FNU A;  1PZI D;  1SNQ A;  4XGH A;  2MUY A;  2UUB Q;  3M3Y H;  3HG9 A;  3GV6 A;  3LNN A;  2EY2 A;  5DM7 3;  2OTJ A;  1NR2 A;  1R0H A;  1E1O A;  5GAD c;  3DHQ A;  1PYS B;  4DK6 C;  3ERO A;  2JEB I;  2WAQ E;  2VB3 X;  1S2Z A;  4DUY L;  2E5L Q;  3MVV A;  2VW9 A;  1Z6H A;  4P2C B;  5IIF A;  4DV7 Q;  1FJG L;  3S1Q H;  1AE2 A;  1R4P B;  1Y1W H;  3GTK L;  5IP9 L;  3L0O A;  4DR5 Q;  1EEF D;  3NEM A;  1D7Q A;  4A3I L;  1TWH H;  2MO1 A;  2RDV A;  2CVR A;  1QOH A;  2EOT A;  2HHH Q;  4ZN3 B;  3KLS A;  4TQU S;  4DV4 L;  2JA6 G;  3QVD A;  1K83 L;  2F0G A;  2QCP X;  4A3C G;  3I4M L;  3HOY G;  3HGB A;  3VR5 A;  1F4L A;  4LF8 L;  3CC4 A;  1JB3 A;  5IYB G;  3HOZ B;  3OYY A;  2XN9 C;  1NJI C;  4IN3 A;  3RUZ A;  1XNR Q;  1PRT F;  4ZYS A;  1FVI A;  5EGT A;  2A74 C;  4A3G B;  3T16 A;  3KF6 A;  2CKZ B;  2PMZ B;  4CKE A;  3OMG A;  4AR5 A;  5F2D A;  4FO2 A;  2Q8I B;  1LTB D;  2Z8L A;  5CYU A;  3H3V M;  1HTP A;  3H0G L;  2R92 G;  3S1R L;  3RZO L;  1LTR D;  5EKI A;  5JEA J;  4BY7 L;  3HAX C;  4HSP A;  3CCS A;  3KYY A;  2VXW A;  1PH3 A;  1EY4 A;  4S3S A;  4JCV E;  1V1O A;  4JBJ A;  3BU2 A;  1LTA D;  1JYB A;  4IUR A;  3LNL A;  2LKV A;  4KJO A;  3GTG L;  4A93 L;  5I6W A;  1X3Q A;  4OL7 A;  2C6B A;  4DKA C;  3HOU G;  2K75 A;  3GTK H;  3H3V I;  4LUO A;  5IP9 H;  1HR0 Q;  4YCV A;  4DAY A;  2A69 C;  1AEX A;  3D8G A;  4A3I H;  4K14 A;  4PQX A;  1PYW D;  1TS2 A;  3GTL L;  3RZD L;  1WOC A;  1YNJ C;  2L4N A;  4YCW A;  4UAI A;  1BVS A;  2AKW B;  3G6E A;  2NVX H;  3K5N A;  1C8C A;  2PI2 A;  4IZ8 A;  1F2M A;  3A7A B;  1O7I A;  1EQR A;  1G51 A;  3MXN A;  3TP7 A;  1DM0 B;  4DR6 L;  2M9V A;  1G91 A;  4LF6 Q;  2RDH A;  2NVQ L;  1D1I A;  1YI2 A;  2V0F A;  4AYB E;  1K8M A;  1PH1 A;  1NUC A;  4HJ7 A;  2A69 D;  1EIH A;  1DX8 A;  3GO5 A;  1D8L A;  4A3K G;  4DN4 M;  3RNU A;  3H0G H;  4QGU A;  2EZV A;  2K50 A;  3OIP A;  5M5Y B;  2F0N A;  5E4W C;  3VA7 A;  2JA8 H;  5LMN Q;  3C1F A;  1I4G A;  3J81 E;  1K9M C;  2D62 A;  5I2Y A;  3QR8 A;  4RAU C;  4I7A A;  4JBK A;  3NK9 A;  3GTG H;  4A93 H;  3FKI B;  2KHS A;  1VQM A;  2VQF Q;  3DWA A;  4I65 A;  4L5R C;  1U4R A;  4BBS G;  1RDG A;  4CHT B;  5MGN A;  2ENB A;  1IBK L;  2C5C A;  2F0P A;  3T1H L;  1WYD A;  3GTL H;  1T5E A;  3H3V H;  4FF2 A;  2XRS D;  3M4O H;  3BG3 A;  4LUV A;  2E2I H;  1I94 L;  2NVT B;  1R9T L;  1LAC A;  1BRF A;  2L0C A;  4OWX B;  2SEB D;  2IY5 B;  1IBM Q;  4BXX G;  4RKL A;  1HPC A;  5KYL A;  5C3E G;  3SE0 A;  2VQE L;  3VR3 A;  4A3L H;  1WTR A;  3RLN A;  1EFW A;  3KBX A;  4FXG C;  5DEH A;  1PVO A;  1J9O A;  4DR2 Q;  3MFY A;  1N32 Q;  3S17 L;  1UEA B;  1ZRP A;  2YTY A;  2DNE A;  3DM3 A;  2A68 C;  2ZM6 L;  4AI2 A;  2K01 A;  3IKJ A;  1CM9 A;  2LMC B;  4JBW A;  4DR4 Q;  4K8J A;  4DXF A;  1SMY D;  2LY7 A;  4K9F A;  1F2Z A;  1K28 A;  1NY4 A;  2KA7 A;  4X3S A;  2JA5 G;  1HNZ L;  1FL0 A;  3MFG A;  1C4Q A;  2Z6B A;  2Z6K C;  4IUN A;  3TZD A;  5C4Z A;  1TWG L;  1HNW L;  1GUN A;  1VQB A;  5TSS A;  3PO2 G;  2CH4 W;  1U9R A;  3CC2 A;  4RGT A;  4L5S A;  1RWD A;  4DGZ A;  1I5F A;  5BN5 A;  5H1S c;  2B2Y A;  3R8B A;  3TP6 A;  2R7F A;  3H09 A;  4N8X 1;  3ULP A;  1STN A;  3I4N G;  1O78 A;  1U0L A;  3PIO 3;  2A19 A;  4GNX A;  2R93 L;  4AYB B;  2XGT A;  1UWV A;  1E8J A;  2HT1 A;  4WFN 3;  3BDC A;  2B2V A;  1PTO B;  3PQI A;  1ROD A;  4TKO B;  2UUA Q;  1V43 A;  5IYC L;  3RZT A;  2RDG A;  2F0E A;  2L11 A;  4ZK9 B;  2BH2 A;  3S17 H;  1IW7 C;  2ZXO A;  1C9O A;  1B8A A;  1SYB A;  4DK3 C;  4JAE A;  3H9C A;  1I3Q H;  1PH4 A;  2JA7 H;  1R4Q B;  5J1Z A;  4R4T A;  2A73 B;  5BN4 A;  1TR5 A;  2KCT A;  4JI3 L;  4ID6 A;  3X3N A;  3J80 E;  1HA6 A;  4YY3 L;  2F0M A;  3CW2 C;  3I72 A;  4JC0 A;  1FR3 A;  3OIQ A;  1WTX A;  4ILW A;  2NVY B;  5JJK A;  4LF5 Q;  3SS2 A;  1PV4 A;  3CCM A;  4C3I H;  5GAD C;  3DLL A;  1IW7 D;  3KYV A;  1W2B A;  3JR7 A;  4MTN A;  1BOS A;  3OPO A;  3HOX B;  3FMC A;  3RZ6 A;  1MBY A;  1UNS A;  4H44 C;  4K5V A;  3H15 A;  4R4Q A;  1SYE A;  2F0O A;  5CV9 A;  2APO B;  4G7H C;  1SE3 A;  2E76 C;  5EPK A;  1S30 A;  4YWL A;  2NN6 I;  3NPP A;  4G7O C;  5KEE A;  1STA A;  3P2A A;  5JEA G;  3FDT A;  3SEB A;  3KLW A;  4LF4 L;  3M3Y B;  3G6J B;  1HZ9 A;  2VUM G;  2L12 A;  3KBG A;  1IYU A;  3KLR A;  4AIM A;  1VQ9 A;  3OWE B;  1TY2 A;  5C0X I;  1PFM A;  4HTH A;  1HNX L;  3CCV A;  1NMG A;  1SDF A;  3PO3 H;  1JOK A;  1IHZ A;  4JAD A;  2JA8 G;  1MIU A;  1CA5 A;  4JI1 Q;  4LF9 L;  5IP7 L;  1Y1W B;  1ILP A;  1VQ5 A;  4Z9C B;  1TWH B;  4A3M G;  5M3M G;  1UE6 A;  3FVQ A;  5EBD A;  1P8L A;  2CHB D;  1HTL D;  5C0X J;  1IZ6 A;  1LM0 A;  1MHW C;  1IXR A;  2V4D A;  1SYG A;  4LAA A;  4MIU A;  3R2I A;  3K35 A;  2Z1C A;  1CAA A;  4KI0 A;  2H12 A;  5C4X B;  5ELB A;  3NQI A;  1K8G A;  2LXJ A;  1XNQ L;  3BZK A;  2ASB A;  3I3C A;  1JJC B;  1XTD A;  2NN6 H;  2IT1 A;  4A3L G;  5EIN C;  1WCM L;  2ZTE A;  3K5O A;  3GQB A;  4AR3 A;  3EIV A;  3UI2 A;  1GUT A;  3QB3 A;  5M3F L;  4OO1 I;  4B3M Q;  2MJ8 A;  3VR6 A;  3ZYY X;  4JI2 L;  1H9K A;  2R61 A;  4B3T Q;  2SDF A;  5EPL A;  1AP0 A;  3RR5 A;  3TME A;  3F2C A;  2M4Y A;  4QF4 A;  1ESF A;  4G57 A;  3STB C;  2CCZ A;  1CI3 M;  4R9W A;  4CJ1 B;  2MGS A;  2XJU A;  2F0S A;  2F0T A;  5CBA E;  1N34 Q;  4M1U B;  3GTK B;  3OOC A;  5LL6 X;  1KHI A;  2KCC A;  2PVX A;  1CK1 A;  1PFB A;  4PMB A;  4A3I B;  4AQY Q;  5FKA C;  2V1C C;  4DR3 Q;  1CFM A;  1K83 B;  1SJH D;  3I4M B;  1U4P A;  1TWF L;  1GUO A;  1Q12 A;  4IQZ A;  1ESR A;  2K7V A;  2WB1 E;  4A4I A;  4ZRZ A;  1V1Q A;  4H7B A;  3HP3 A;  4AHY A;  3NE5 B;  2UUB L;  3FEW X;  1RF2 D;  2JXM B;  3SHL A;  2ZIX A;  3TDQ A;  2JA6 L;  3FPP A;  3A8K E;  4A3C L;  3KYH C;  3HOY L;  4Y7N H;  3B0A B;  4KK7 A;  2FJ2 A;  1MKH A;  1WCM H;  3U9O A;  3BZD B;  3H0G B;  5DLQ E;  3U4Z A;  3ERQ A;  4UPA A;  3S1R B;  3RZO B;  4X3K A;  5C5M A;  3T56 B;  4BY7 B;  5IYB L;  2B63 G;  4O2D A;  4DR5 L;  2FXQ A;  4NP5 A;  4AR4 A;  1SSO A;  2HHH L;  4J1M A;  3GTG B;  4A93 B;  3DWP A;  1JC7 A;  2KHI A;  2E74 C;  1PFY A;  2K5Q A;  5JAV A;  5FJ8 H;  4LFC L;  2H4O A;  1J5E L;  3PCO B;  3GTL B;  3RZD B;  4MZ9 A;  4MHE A;  3PZA A;  1OXU A;  5BR8 Q;  4GKJ Q;  1CZW A;  1TWF H;  2EYL A;  3S14 H;  4DV3 Q;  3DUZ A;  3SDZ A;  4A3E G;  3PKJ A;  4LK1 C;  3E9I A;  2KCM A;  3HOU L;  4DNT B;  1GM5 A;  4JI5 Q;  3Q24 A;  2RF4 A;  3KJO A;  2Q2T A;  2WV6 D;  2E2J H;  3IU3 I;  4EQN A;  2EYJ A;  2EJM A;  1CQF A;  2QEJ C;  5NUC A;  4ZN1 B;  2JA6 H;  1H9S A;  1X6O A;  3NEN A;  3ONA B;  5GRO A;  1E22 A;  3S15 L;  3HKZ G;  1YK5 A;  2KQ3 A;  3FP9 A;  3K80 C;  3MTS A;  3AFP A;  1SFO H;  4X62 Q;  1QCV A;  2ZTC A;  3W1G A;  5CBE E;  4AHX A;  3PUY A;  4PMC A;  3VPB E;  2E8G A;  3KF8 B;  1QYB A;  2K1B A;  1KIX A;  1TXY A;  1B2T A;  1KAB A;  1HFN A;  4XTC S;  5K5P A;  5GAH c;  4A3K L;  2RCF A;  4HJA A;  4KN4 C;  3CU7 A;  3NWT A;  1G6Z A;  1G2T A;  3C3L A;  2R92 H;  4AI3 A;  4IOA A;  1EY5 A;  2NZ1 D;  4LF6 L;  4B3S Q;  1KDA A;  1Y69 U;  1V1P A;  4KTA A;  1IKL A;  5JVH 3;  2KEC A;  1H95 A;  2Z4I A;  4LUZ A;  2DSX A;  1A2U A;  2WB1 B;  1QIL A;  1VQI A;  2DN8 A;  1R9T B;  1J6Q A;  2AQ1 B;  1K3R A;  3VDY A;  5DM7 1;  2L9H A;  4UP8 A;  3A7L A;  1S24 A;  4OWW B;  3HOU H;  4RGN A;  4K5W A;  3T51 B;  3K58 A;  4BBS L;  3SK5 A;  5AI3 A;  2EYF A;  1OO9 B;  3S2D L;  4LFA Q;  4KKU A;  4DV1 L;  2PQA B;  3V2T A;  2FFK B;  5IGB A;  4LHL A;  1FGU A;  3X3M A;  3S17 B;  1VQC A;  2NN6 G;  3S15 H;  3UDF A;  5IYD G;  2K03 A;  1JR0 D;  4APV A;  5LMU Q;  5AJ3 Q;  4A3D H;  1EOV A;  4LWC A;  4C56 C;  1PTO C;  2X6L A;  4BXX L;  4KHP Q;  3KJP A;  1B9M A;  5GAE c;  3PKI A;  3RLO A;  4LF7 Q;  5L37 A;  2YU9 L;  1SNO A;  3F1Z A;  5C0X G;  4CBV A;  1BXT A;  1IL2 A;  3S1M H;  5I2X A;  4C3I B;  1QCB D;  1TWG B;  1RIP A;  2DY7 A;  3EN2 A;  3D4R A;  4RH6 A;  4RHR A;  4JVZ A;  3GTQ H;  1BF4 A;  4H13 C;  5CV5 A;  4R8N A;  3TS2 A;  3ULL A;  1PTO D;  1VMP A;  3AQQ A;  2CW0 C;  5EQ0 A;  1YNX A;  3HOZ G;  1QE6 A;  4C2M H;  3S1Q L;  1TII D;  1SRO A;  3A55 A;  1HFG A;  4GN4 B;  4L8J A;  4X64 L;  4DR2 L;  2R93 B;  2Y0S B;  2CFM A;  1JWS D;  1EU3 A;  1KAW A;  1SBB B;  4C1N K;  1SYD A;  4BBS H;  1FD7 D;  1F9R A;  3PO2 L;  3A44 A;  2EY6 A;  1G8Z D;  2QF7 A;  1EU4 A;  4IAL A;  3S2D H;  4BBR H;  1XMQ Q;  4JG2 A;  1I4X A;  2EYH A;  4A75 A;  4YCU A;  4KHV A;  2PW7 A;  2I0Q A;  4NW2 A;  4DV6 Q;  2CW0 D;  2HIX A;  4DF7 A;  3CHB D;  4A3B G;  3I4N L;  1TWA L;  4RKB A;  5LHY 1;  4IUV A;  5AI2 A; 
#chains in the Genus database with same CATH homology
 5C3E H;  3GTO H;  2EXD A;  2UXC L;  4ME3 A;  5C44 H;  4KHZ A;  4AI0 A;  4OO1 G;  1PH7 A;  3ZJY C;  5FJ8 G;  3NBH B;  2EIF A;  3KF6 B;  2JA5 H;  2VY3 A;  2N8N A;  3J7A 5;  3PO2 H;  4P74 A;  4JI4 Q;  1K8A C;  4JYA Q;  2DGY A;  4R4C A;  3HOW H;  1ODH A;  1YJN A;  2WAQ G;  1SMU A;  5H1S E;  1VQK A;  3I4N H;  1TWA H;  4LF5 L;  4DAY B;  1VZG A;  4JV5 L;  1HZB A;  1GD7 A;  1KD1 C;  4H02 A;  3TEH B;  3MXN B;  1VQE A;  4E6Y A;  1Q86 C;  3JAM i;  3HOV G;  3F2D A;  1RDV A;  4DR1 Q;  2V0E A;  5MFP A;  2E2H H;  3U50 C;  1L1O B;  5JJL A;  3CF5 A;  1XPO A;  4OXP A;  2UXB Q;  4IPD A;  5RXN A;  3CP0 A;  1N33 L;  1YJW A;  2PSM C;  4WJ4 A;  4X66 L;  4NXN Q;  3W5O A;  3GTP H;  2H5X A;  2ERJ A;  1XPU A;  1X3E A;  1LTL A;  4A3D G;  4UP7 A;  1B7Y B;  4JI8 Q;  1PH6 A;  1Z9F A;  2VUM H;  1T9O A;  1Q1B A;  4Y52 H;  4JI7 Q;  1PFS A;  2XJQ A;  4WFN 1;  2JI3 A;  3GTJ H;  1HZC A;  2R7Z H;  1NXG A;  2OWO A;  1CSQ A;  4A3M H;  2M4V A;  1KRS A;  3ERS X;  4MNO A;  4B3R Q;  4HJ9 A;  5M3M H;  3M9B A;  4DV0 Q;  2AWO A;  4BBR G;  4AI1 A;  1CKM A;  1YZ6 A;  1KQS A;  1RYT A;  3WWN B;  2YTX A;  2CKA A;  1U5K A;  3GTM H;  2RCN A;  3AFQ A;  1LUZ A;  4OON A;  5C44 G;  4RXN A;  1YIJ A;  4JI0 Q;  2ZJR A;  5GQO A;  4LFB Q;  1JT8 A;  2R6G A;  1X65 A;  4GS3 A;  1SN8 A;  5GAE C;  3CCR A;  4R4I A;  2YTV A;  4ALP A;  4HID A;  1C7Y A;  1I50 H;  5GAG c;  3KDF A;  2D0O A;  4OX9 L;  2BA1 A;  1YUZ A;  3E0E A;  3CCQ A;  3CQZ H;  2I5M X;  3J81 i;  5IT9 c;  1Y14 B;  1R0J A;  3HOW G;  3TRE A;  2OQ0 A;  2QGQ A;  4NXM L;  2A6H D;  4JI6 L;  3PWF A;  5HY6 A;  5BR8 L;  1Q46 A;  1B70 B;  4DV3 L;  3CXC A;  2B63 H;  2KHJ A;  1IBL Q;  3K7A H;  3B08 B;  4PZ8 A;  3PSI A;  1N36 Q;  3PF4 A;  1XPR A;  2WP8 J;  4DUY Q;  1IRN A;  2KEN A;  3FHW A;  1FJG Q;  5C4X G;  4QJF A;  2Z3Q B;  1B2J A;  4X62 L;  2C6A A;  1OWC A;  4GOP A;  1YHQ A;  4A3F G;  2EQS A;  4DV4 Q;  4A3E H;  4IJL A;  1JJ2 A;  4LF8 Q;  1EIY B;  2AHO B;  1LKM A;  4DV5 L;  4B3S L;  4DAM A;  4K0K L;  5IWA L;  2NZO A;  1EWI A;  3TRZ A;  1Q81 C;  4HJ8 A;  2RHQ B;  3K7U C;  1E7Z A;  4BY1 H;  3CME A;  3KYU A;  1X3G A;  2R7Z G;  6RXN A;  2ZTD A;  4WJ3 M;  4NPS A;  2F4V L;  1GKH A;  4KHP L;  3J80 i;  3BZC A;  4A3J G;  4LF7 L;  4HIK A;  3U58 A;  4HJ5 A;  4C3H H;  4HIM A;  1EUJ A;  3PUZ A;  4LW1 A;  1CKN B;  7RXN A;  5IYD H;  1A63 A;  1QVF A;  1QUQ B;  2N78 A;  1OWB A;  4IO9 A;  2GN5 A;  3HKS A;  1UEB A;  4P75 A;  1BBW A;  2A1A A;  1XMQ L;  1X55 A;  3KYX A;  1JJG A;  2L15 A;  2GVA A;  3CPF A;  1L1O C;  2LCQ A;  4JOI C;  4DR7 Q;  1R0F A;  3BJU A;  1M1K C;  2YV5 A;  3HOZ H;  1VZI A;  2MNA A;  3E9H A;  2E5L L;  2KN9 A;  1VQ8 A;  4A3B H;  4DV7 L;  5ELN A;  2K52 A;  5JVG 1;  1P16 A;  2B5I D;  4QQB X;  4JI4 L;  3J7Y 1;  2O5J D;  3L2P A;  4LHN A;  4V19 6;  1K73 C;  1VQJ A;  1T9P A;  2HR5 A;  1HNZ Q;  5AN9 H;  2DUD A;  2PYA A;  1QVC A;  1HNW Q;  1VCI A;  4P73 A;  1VQ7 A;  2UUC Q;  3D31 A;  1LKO A;  1XNR L;  1B71 A;  3M4Q A;  1YIT A;  1KL9 A;  1SMW A;  2Y0S E;  4B8C D;  2JA9 A;  1PA6 A;  2LXK A;  4DR1 L;  3S16 H;  2K4K A;  1PHJ A;  3MEF A;  5M5Y H;  2ID0 A;  1YUX A;  1VQL A;  1VQH A;  1EIF A;  3AEV A;  1HR0 L;  1PH9 A;  2N49 A;  4BY1 G;  3FKI H;  4NXN L;  1VCX A;  5MLC 3;  2R93 G;  1Q1E A;  4JI3 Q;  1QZG A;  5EAY A;  3L7Z C;  4YY3 Q;  1NTG A;  5C4J H;  1FHH A;  1OXS C;  5E7N A;  3CC7 A;  3HOV H;  2VNU D;  1Y1V G;  2NVT H;  3I7F A;  1MJC A;  2UXD Q;  5IY0 A;  5FLM H;  2ERS A;  2R7D A;  1YBY A;  4JI7 L;  4QY7 A;  2OCE A;  3KOJ A;  3A5U A;  5ELO A;  4POF A;  4RG1 A;  5LMN L;  3GDE A;  2QEX A;  2VQF L;  4B3R L;  2JK8 A;  1HNX Q;  4DV0 L;  3PIO A;  2PI2 E;  1G6P A;  2K5V A;  2M6O A;  1TWC H;  3GD7 A;  3AYH B;  1R0G A;  1IBM L;  4EQ5 A;  1VQP A;  5EIO C;  1PH8 A;  2Z6K A;  3MPS A;  3JC6 2;  1VZH A;  1KC8 C;  2Q2I A;  1N32 L;  2MFI A;  4JI0 L;  1X3F A;  4JBM A;  4A3G G;  5IP7 G;  4LFB L;  3UE1 A;  5MFZ A;  2IHE A;  1XNQ Q;  4YHH Q;  4DR4 L;  4IJH A;  3M85 A;  1EYG A;  1X9N A;  4X6A H;  5K2M E;  4UP9 A;  3F2B A;  1NNQ A;  4GKK Q;  2MQH A;  2NVY H;  2J9U B;  1V9P A;  5JJI A;  1PYB A;  1OXT A;  1A0I A;  2JI2 A;  3PUV A;  1AH9 A;  1Z92 B;  5M3F G;  2UUA L;  1XJV A;  3CAM A;  1BKB A;  1YEZ A;  2JQO A;  3K0X A;  1BQ8 A;  3M7N A;  3A0J A;  4IFD I;  1IBL L;  1N36 L;  4YWM A;  3PGZ A;  4R1J A;  1H7V A;  2CWA A;  4P72 A;  1E3P A;  3TQY A;  1T9H A;  1YV1 A;  3FKI G;  4JAF A;  4UY8 C;  2CR8 A;  1WFQ A;  4IFD J;  1L2F A;  4IPG A;  3ER0 A;  1OTC A;  1BFY A;  5LMN W;  3RLF A;  2AYJ A;  1PH5 A;  3JC6 3;  4X65 Q;  4XIG S;  1QVG A;  4LFC Q;  3I56 A;  1J5E Q;  1RYQ A;  3T1Y Q;  3ZG6 A;  3WWL A;  5C4X H;  1SE8 A;  3RN5 A;  5FLM G;  1C09 A;  1RB9 A;  3D0F A;  4A3F H;  3S2H H;  4DUZ Q;  3CCJ A;  1RL2 A;  2CWP A;  2F52 A;  4JI1 L;  2UU9 Q;  3OTO Q;  1VQ6 A;  1N9W A;  3I55 A;  1NBW A;  4DV2 Q;  4QIW E;  1KXL A;  2IX1 A;  3PF5 A;  1K83 H;  3PV0 A;  3PIO 1;  3I4M H;  5FLX c;  5M5W H;  1T9Q A;  5DM6 1;  3CCE A;  2MS3 A;  2KKD A;  3CCU A;  3EBE A;  1XMO Q;  4DNI A;  4AYB G;  5GAH C;  1L1O A;  2VL6 A;  2AWN A;  1B13 A;  4JOI A;  1OXV A;  1C0A A;  2CKC A;  4GN3 B;  2JJQ A;  4B3M L;  3S1R H;  3RZO H;  4B3T L;  4DV1 Q;  4BY7 H;  5J3B A;  4IPH A;  1JMC A;  4A3J H;  3KDF B;  1WI5 A;  1WJV A;  1VQO A;  4PZ7 A;  1E1T A;  1N34 L;  4AHW A;  3JC6 6;  1E24 A;  4AQY L;  1X56 A;  1IRO A;  2IHF A;  4DR3 L;  2B3G A;  4DR7 L;  3KFU A;  1YK4 A;  3RZD H;  1BE7 A;  1X54 A;  3JAM c;  1B2O A;  3HOX G;  4GNX B;  3S24 A;  2NVQ H;  2Z3R B;  3NEL A;  4TPU A;  4O0A A;  1Q8K A;  4X64 Q;  3P8B A;  5MF6 A;  1GVP A;  1A62 A;  2OTL A;  1IU5 A;  2GMG A;  1R0I A;  1N8R C;  2YYZ A;  4GN5 A;  2XJR A;  1Y1W G;  4GOP B;  4GLV B;  4C3J H;  2UUC L;  2UXC Q;  2NYD A;  4GKJ L;  2A68 D;  2A6E D;  1KRT A;  4YWK A;  2A8V A;  1SLJ A;  1R9T H;  4JI5 L;  1W3S A;  1Z47 A;  3QQC E;  3I4O A;  2MO0 A;  2XJV A;  4AR6 A;  3A74 A;  4AHZ A;  1VQG A;  3W1B A;  4IOC A;  2M6P A;  4BA1 I;  4GLA C;  2RHS B;  1G29 1;  5HGQ A;  2AMC B;  1CUK A;  1VS0 A;  3RN2 A;  2Z0S A;  4IFD G;  1I6H H;  4PZ6 A;  1VQN A;  1CKO A;  1TWG H;  3LGJ A;  4JV5 Q;  5IP9 G;  4A3I G;  1FHM A;  2UXD L;  5K36 G;  3UDG A;  3PIP A;  1ASY A;  3I4M G;  3UDI A;  4QL5 A;  3SGI A;  2F3I A;  3G4S A;  5M5X H;  2BE5 D;  2R93 H;  4LFA L;  3WWV A;  8RXN A;  1S3O A;  5IYC H;  3CD6 A;  1N33 Q;  5LMU L;  5AJ3 L;  1Y1V H;  1JB7 A;  3H0G G;  4X66 Q;  3J81 c;  4BY7 G;  3K81 C;  1BQ9 A;  4PMW A;  2PVE A;  4AH6 A;  3CCL A;  4DR6 Q;  1Q7Y C;  1DVB A;  4A93 G;  2K5H A;  1S40 A;  2XJP A;  1LKP A;  1IYJ B;  3U4V A;  3B6Y A;  4P71 A;  2V3B B;  4U67 1;  4YHH L;  1UE5 A;  1NE3 A;  4DV6 L;  2BA0 A;  4FDB A;  3G48 A;  3G71 A;  4LNQ A;  3J7Z 1;  1IBK Q;  4TVA B;  1YHB A;  3T1H Q;  4GKK L;  1PH2 A;  3TS0 A;  4GS7 D;  4HIO A;  2XJS A;  1I94 Q;  3K8A A;  1S72 A;  5IP7 H;  4A3G H;  2ATW A;  5JVH 1;  3ULJ A;  1BBU A;  1MJE A;  2VQE Q;  2XJT A;  1SMX A;  3I2Z A;  3NFP I;  1CKN A;  1YHA A;  1UE1 A;  2GVB A;  3STB D;  1QUQ A;  2WB1 G;  1HZA A;  3ICE A;  2ZM6 Q;  1L0W A;  2ZJQ A;  1NXE A;  3IRB A;  3Q8D A;  4JYA L;  2QA4 A;  1VQ4 A;  2PPT A;  4OX9 Q;  2Q2H A;  3S1N H;  3LPE B;  1SRU A;  5M3F H;  3J80 c;  3RYG A;  3J7Z C;  4PG3 A;  2WFW A;  1HJP A;  2JA7 G;  2JEA I;  2NZH A;  5GAG C;  1K0R A;  2L0Z A;  2I5L X;  2OQK A;  2BH8 A;  2D0P A;  4A76 A;  4GLX A;  4X65 L;  4NXM Q;  3HKZ E;  4JI6 Q;  3T1Y L;  2XTI A;  4J15 A;  2UXB L;  1OXX K;  2B29 A;  3PIP 1;  1NMF A;  4TVM A;  1HH2 P;  3F8T A;  2Y0S G;  4DUZ L;  2JI1 A;  1LYL A;  4A3C H;  4KLK A;  2PNH A;  3HOY H;  4GNX C;  1CSP A;  4BA2 I;  5IYC G;  2UU9 L;  3OTO L;  1YVC A;  2C35 B;  5IYB H;  4DV2 L;  1VQA A;  4NB3 A;  4JI8 L;  3UDX A;  1JE5 A;  1A8V A;  3PO3 G;  3J81 j;  2ALY B;  3OW2 A;  3MSU A;  1M90 C;  3CMA A;  2K2D A;  4DV5 Q;  2HQL A;  4K0K Q;  5IWA Q;  4L5T A;  4LF4 Q;  4RMF A;  3M4P A;  1XMO L;  4JAG A;  1EQQ A;  2K14 A;  4GOP C;  3KYW A;  1Q82 C;  1VQF A;  2ZJP A;  1QZH A;  4LF9 Q;  2VS1 A;  3UE0 A;  2KBN A;  2ES2 A;  1CAD A;  1UE7 A;  2F4V Q;  3A5Z B;  3CPW A;  4XXB B;  4L5Q A;  4G6B A;  3PUW A;  2PMZ E;  4IPC A;  4A3K H;  1YJ9 A;  1AE3 A;  1DGS A;  2QL0 A;  1IU6 A;  2N3S A;  2Q2U A;  1SMM A;  2IX0 A;  2PQA A;  2CQO A;  2HIV A;  2VZA A;  3PUX A;  2LSS A;  3HFZ B;  1SR3 A;  1WJJ A;  2I5H A;  4JI2 Q;  4UY8 1;  4EX5 A;  4OWT B;  4POG A;  1ASZ A;  3HOX H;  1WCM G;  5IE8 A;  2K5N A;  4DPG A;  4BXX H;  1GO3 E;  2JE6 I;  4R4O A;  1HR0 W;  1VQD A;  2YU9 H;  4XGH A;  3M3Y H;  2UUB Q;  2OTJ A;  1R0H A;  1E1O A;  5GAD c;  1PYS B;  4DK6 C;  2JEB I;  2WAQ E;  1S2Z A;  4DUY L;  2E5L Q;  2VW9 A;  4DV7 Q;  1FJG L;  3S1Q H;  1AE2 A;  1Y1W H;  3L0O A;  4DR5 Q;  3NEM A;  1D7Q A;  1TWH H;  2MO1 A;  2RDV A;  2HHH Q;  4ZN3 B;  2JA6 G;  4TQU S;  4DV4 L;  3QVD A;  4A3C G;  3HOY G;  4LF8 L;  3CC4 A;  5IYB G;  3OYY A;  1NJI C;  1XNR Q;  1FVI A;  3KF6 A;  2CKZ B;  4AR5 A;  2R92 G;  5JEA J;  3CCS A;  3KYY A;  1PH3 A;  4JCV E;  4JBJ A;  3BU2 A;  1JYB A;  3LNL A;  2C6B A;  4DKA C;  3HOU G;  2K75 A;  3GTK H;  3H3V I;  4LUO A;  5IP9 H;  1HR0 Q;  4YCV A;  4A3I H;  1WOC A;  2NVX H;  4YCW A;  3G6E A;  1BVS A;  2AKW B;  2PI2 A;  1O7I A;  1EQR A;  1G51 A;  4DR6 L;  4LF6 Q;  1YI2 A;  2V0F A;  4AYB E;  1PH1 A;  4HJ7 A;  2A69 D;  1DX8 A;  3GO5 A;  1D8L A;  4A3K G;  3RNU A;  3H0G H;  4QGU A;  2K50 A;  2JA8 H;  5LMN Q;  1K9M C;  2D62 A;  4JBK A;  3GTG H;  4A93 H;  1VQM A;  2VQF Q;  4L5R C;  4BBS G;  1RDG A;  5MGN A;  1IBK L;  3T1H L;  1WYD A;  3GTL H;  3H3V H;  3M4O H;  4LUV A;  2E2I H;  1I94 L;  1BRF A;  4OWX B;  2IY5 B;  1IBM Q;  4BXX G;  5C3E G;  2VQE L;  4A3L H;  3RLN A;  1EFW A;  1PVO A;  4DR2 Q;  1N32 Q;  1ZRP A;  2YTY A;  3DM3 A;  2ZM6 L;  4AI2 A;  4JBW A;  4DR4 Q;  4K9F A;  1NY4 A;  2JA5 G;  1HNZ L;  1FL0 A;  2Z6K C;  1HNW L;  1VQB A;  3PO2 G;  3CC2 A;  4L5S A;  1RWD A;  1I5F A;  5H1S c;  2R7F A;  3ULP A;  3I4N G;  1U0L A;  2A19 A;  4GNX A;  2XGT A;  1UWV A;  1E8J A;  2HT1 A;  2UUA Q;  1V43 A;  3RZT A;  2BH2 A;  3S17 H;  1C9O A;  1B8A A;  4DK3 C;  4JAE A;  1I3Q H;  1PH4 A;  2JA7 H;  4R4T A;  2KCT A;  4JI3 L;  4YY3 L;  3CW2 C;  4JC0 A;  5JJK A;  4LF5 Q;  3SS2 A;  1PV4 A;  3CCM A;  4C3I H;  5GAD C;  3DLL A;  1IW7 D;  3KYV A;  1W2B A;  4MTN A;  3RZ6 A;  3H15 A;  4R4Q A;  1S30 A;  4YWL A;  2NN6 I;  3P2A A;  5JEA G;  3KLW A;  4LF4 L;  1HZ9 A;  2VUM G;  4AIM A;  1VQ9 A;  5C0X I;  1HNX L;  3CCV A;  1NMG A;  3PO3 H;  2JA8 G;  4JAD A;  1MIU A;  4JI1 Q;  4LF9 L;  1VQ5 A;  4A3M G;  5M3M G;  1UE6 A;  1P8L A;  5C0X J;  1IZ6 A;  1LM0 A;  1IXR A;  3K35 A;  1CAA A;  4KI0 A;  2H12 A;  1K8G A;  2LXJ A;  1XNQ L;  3BZK A;  2ASB A;  1JJC B;  1XTD A;  2IT1 A;  4A3L G;  5EIN C;  2ZTE A;  4AR3 A;  3EIV A;  4OO1 I;  4B3M Q;  4JI2 L;  4B3T Q;  3RR5 A;  3F2C A;  2M4Y A;  3STB C;  2CCZ A;  2XJU A;  1N34 Q;  1KHI A;  2PVX A;  4AQY Q;  2V1C C;  4DR3 Q;  1Q12 A;  2WB1 E;  4A4I A;  1V1Q A;  4AHY A;  2UUB L;  2ZIX A;  3KYH C;  4Y7N H;  3B0A B;  1MKH A;  1WCM H;  5DLQ E;  3U4Z A;  4UPA A;  2B63 G;  4O2D A;  4DR5 L;  2FXQ A;  4AR4 A;  2HHH L;  2KHI A;  5FJ8 H;  4LFC L;  1J5E L;  3PCO B;  4MZ9 A;  3PZA A;  1OXU A;  5BR8 Q;  4GKJ Q;  1TWF H;  3S14 H;  4DV3 Q;  4A3E G;  3PKJ A;  3E9I A;  2KCM A;  1GM5 A;  4JI5 Q;  2RF4 A;  3KJO A;  2Q2T A;  2E2J H;  3IU3 I;  4ZN1 B;  2JA6 H;  1X6O A;  3NEN A;  5GRO A;  1E22 A;  3HKZ G;  1YK5 A;  3FP9 A;  3K80 C;  3AFP A;  1SFO H;  4X62 Q;  1QCV A;  2ZTC A;  3W1G A;  4AHX A;  3PUY A;  3VPB E;  2E8G A;  3KF8 B;  1QYB A;  1KIX A;  1TXY A;  4XTC S;  5GAH c;  4HJA A;  2R92 H;  4AI3 A;  4IOA A;  4LF6 L;  4B3S Q;  1H95 A;  4LUZ A;  2DSX A;  1VQI A;  1J6Q A;  1K3R A;  3VDY A;  5DM7 1;  4UP8 A;  1S24 A;  4OWW B;  3HOU H;  5AI3 A;  4LFA Q;  4DV1 L;  2PQA B;  4LHL A;  1FGU A;  1VQC A;  2NN6 G;  3S15 H;  3UDF A;  5IYD G;  4APV A;  5LMU Q;  5AJ3 Q;  4A3D H;  1EOV A;  4LWC A;  4KHP Q;  3KJP A;  5GAE c;  3PKI A;  3RLO A;  4LF7 Q;  3F1Z A;  5C0X G;  1IL2 A;  3S1M H;  1RIP A;  3EN2 A;  3GTQ H;  3TS2 A;  3ULL A;  3AQQ A;  1YNX A;  3HOZ G;  4C2M H;  1SRO A;  4GN4 B;  4DR2 L;  4X64 L;  2CFM A;  1KAW A;  4BBS H;  3A44 A;  3S2D H;  4BBR H;  1XMQ Q;  4JG2 A;  4A75 A;  4YCU A;  2I0Q A;  4DV6 Q;  2HIX A;  4A3B G;  5AI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...