4POFA

Pfmcm n-terminal domain without dna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
255
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
publication title A conserved MCM single-stranded DNA binding element is essential for replication initiation.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication, dna binding protein
total genus 60
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4pofA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4pofA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4pofA01
4UY8C 2EQSA 1R9TH 3D0FA 2MNAA 1IBKL 3A5UA 3I2ZA 3AQQA 1OTCA 1XPRA 3A5ZB 3STBC 2I5LX 4JCVE 4UP8A 1E8JA 1EIYB 4X64L 2NN6I 3HFZB 3WWVA 4JI2Q 1IZ6A 3HOWH 3PO2G 1YNXA 3G6EA 1R0GA 2VS1A 2YTVA 3G48A 4NXNL 2VNUD 2DSXA 4C3IH 4YY3L 4J15A 4RMFA 3S24A 3TQYA 3U4ZA 2KCTA 1PH1A 2JA5H 1LUZA 4R4OA 3I55A 1BFYA 1VQEA 2IHEA 1N9WA 2ZJRA 1HR0W 4YWLA 4X64Q 1FHHA 1PFSA 4XIGS 3U58A 3PSIA 3L2PA 1C7YA 2R92G 1KXLA 2F52A 2MQHA 1RB9A 1JE5A 1SN8A 2B63H 1TWGH 4NXNQ 1HZAA 1X9NA 1EUJA 4EQ5A 2AMCB 1FJGL 3GTOH 1SR3A 2VY3A 3F1ZA 1PYSB 2LCQA 4DR5L 4A3KH 1VQKA 2VUMH 4A3BG 1AH9A 3RNUA 3NELA 1YK4A 1G51A 3HOXH 1Z9FA 4HJ8A 4A3FG 2R7ZH 2WB1E 3F2DA 4QGUA 2V1CC 1EOVA 1BE7A 3PCOB 4R4IA 5H1SE 3I4NH 1I6HH 3K80C 4AH6A 1PH6A 3B6YA 3EBEA 4DK3C 3E9IA 3TREA 4DR5Q 1YUZA 4DR7L 1WOCA 2B63G 2MO0A 2PI2A 1M1KC 2F4VL 1J6QA 3GTJH 3ULPA 1V43A 1FGUA 2A1AA 3F2BA 1YI2A 5K36G 1LYLA 2JA9A 4R4TA 4QJFA 4C2MH 4IOAA 3F2CA 1K9MC 1OXUA 3M7NA 2KENA 1YVCA 1Z47A 4QY7A 1TWFH 1LKMA 4DV2L 2OTLA 3AFPA 4RXNA 5RXNA 1LM0A 3FP9A 4A3DH 2Y0SG 4NPSA 3J81c 2ZJQA 3PF4A 1L0WA 2F4VQ 1YJWA 4JYAL 1NNQA 4AR3A 4FDBA 1R0FA 4UP7A 4A3GG 1A63A 4PG3A 1BBUA 1N36L 4B3ML 4TQUS 2K4KA 3GTGH 4DUYL 1VQOA 1DX8A 2AKWB 4X62L 1VQ5A 4JG2A 1IBMQ 4NXML 1UE1A 3PWFA 4DR2Q 1E24A 1LKPA 4B3SQ 5FJ8H 1W2BA 3QVDA 1Q46A 4YCVA 5GQOA 1KC8C 4JI4Q 4JYAQ 1L1OB 4LWCA 1GD7A 4C3HH 4OX9L 3UDFA 2ZTDA 2YU9H 1I94L 3A74A 1S24A 2UXDL 3HKZE 4GNXB 1SMUA 2MO1A 1AE3A 1VS0A 4AQYL 2UXBQ 3J81j 3PGZA 1HZBA 5IWAL 4A3CG 3GTMH 1YJNA 2OQKA 2IX1A 3H3VI 1EWIA 5IYBG 1YHBA 3UE1A 3KYXA 3E0EA 1W3SA 1FHMA 4JOIA 3CCUA 4A3EG 1NTGA 5M5XH 4DK6C 2UUAQ 4OX9Q 1I94Q 1BQ9A 4IPGA 1GVPA 5M3MG 2QA4A 1IROA 2VQEQ 5JJKA 3H3VH 4X66Q 5M5YH 2JA7H 3L0OA 4JI0L 1X54A 5IWAQ 1BKBA 3OYYA 2Z6KA 4IFDI 4DPGA 1VQNA 4BY1G 1XMQL 4R4CA 2JA8G 4LUZA 3ICEA 3J7A5 1M90C 1FL0A 4YCWA 4A75A 1X55A 1AE2A 2Q2TA 5HGQA 3JC66 4BBRG 1L1OC 3RLOA 2N3SA 4XTCS 3HOUH 1U5KA 3H0GG 2V3BB 4LF4L 4JI8L 3UDIA 1B71A 1YUXA 3KF6A 4KLKA 1PH3A 1TWCH 1WFQA 1A62A 3RLFA 1XMQQ 3PUXA 4DV5L 1HH2P 3JC63 1V9PA 2OQ0A 1LTLA 4P74A 4HJAA 1RYTA 5HY6A 4HIOA 4BBSG 3BZKA 4B3TL 1CKNA 3RZOH 1Q1EA 2K14A 1QZHA 1SLJA 2UXCL 2A8VA 3UE0A 4LF4Q 2RDVA 8RXNA 3NENA 4JI8Q 1KIXA 4B3RQ 1VQ9A 4WJ4A 1QYBA 1WJJA 3E9HA 3CPFA 1Q86C 4LF5L 4DR3L 1B7YB 2NVYH 2RCNA 5C0XJ 3EN2A 4AYBE 2UU9L 1YITA 3VDYA 2YTXA 2UUBL 3HOVG 1YEZA 3KJPA 4DR1Q 1VQLA 2I0QA 1PYBA 2RF4A 4LUVA 4JI3L 4B3TQ 1E22A 1X56A 1YHQA 2BH8A 3M4QA 1NMFA 5M5WH 4L5QA 4LFCQ 3H15A 2ATWA 2ZM6L 3OTOL 4HIMA 1K8AC 5AJ3L 2R92H 3TRZA 2EXDA 1S30A 2RHSB 1ASYA 2KCMA 4DKAC 4DV3Q 4GOPC 1YJ9A 1QZGA 2UUBQ 4DR6L 2MFIA 3W1GA 4DAMA 1B2JA 4DV4Q 1IU5A 1D8LA 1VQ6A 4A3BH 1CSPA 1TWHH 1I50H 1IBKQ 1CAAA 1NY4A 4EX5A 2IX0A 1G291 3CMAA 4A3FH 1N32L 1T9PA 4LUOA 2CFMA 1VQ8A 3KFUA 4DR6Q 1TWAH 2A19A 1NE3A 1YV1A 1Q8KA 2M4YA 2B29A 1SRUA 2QL0A 2JEAI 4A3JG 1D7QA 1FVIA 1Y14B 4LF8L 2K2DA 4R4QA 4KHPL 2XTIA 4YY3Q 2WAQE 4DR4L 2NVQH 1X65A 2BA0A 4DAYB 4A3LG 2ZTCA 3ER0A 4P73A 4TPUA 3UDGA 1ZRPA 2GVAA 1VQMA 4AR5A 5FLXc 3G4SA 3MEFA 4POGA 2LXKA 5LMNL 4DV1L 4JI7L 1L2FA 4LFBL 2E5LL 2NZOA 5GAHC 4KHPQ 5C3EG 4A3GH 1C09A 1NMGA 2I5HA 1FJGQ 4AR6A 3RN2A 1XNRL 1V1QA 4JV5L 4A3MG 5C4XG 2CWPA 1EYGA 3OW2A 1UWVA 4POFA 5LMNQ 1YIJA 2OWOA 4KI0A 3KJOA 1MJEA 4JI7Q 3HOZG 1EQQA 5IE8A 3NBHB 2PNHA 1IBLL 1VQAA 4JBMA 2PVEA 1XNRQ 4PMWA 3BU2A 4JV5Q 4DR7Q 3M85A 1R0HA 3CCEA 1SMMA 3RZTA 1B8AA 3PO3G 4A3IG 4A3CH 3S2DH 4DUZL 2ID0A 1N33L 1JJGA 5JJIA 5IYBH 2PQAB 4IPHA 4L5TA 4HJ5A 1VQGA 4OONA 4DV2Q 2BA1A 1IBLQ 2R93G 2AWNA 4A3EH 1PH7A 5GAGC 4IPCA 4C3JH 1K8GA 4Y52H 2QEXA 3S1MH 3K7AH 2HIXA 3MXNB 5M3MH 4UPAA 1HZCA 2HQLA 3KLWA 1QVFA 3UDXA 3HOYG 4WJ3M 1N36Q 4B3MQ 1N34L 4OO1G 4DUZQ 4K0KL 4K9FA 1CKMA 3PUZA 3I4OA 2Z0SA 4DUYQ 3T1HL 4BY1H 1YK5A 4X62Q 4NXMQ 2GVBA 2JA8H 1ASZA 2VQFL 5GAEC 2VL6A 5FLMG 2IT1A 2B3GA 4BBRH 4DNIA 4LF6L 3PZAA 1CSQA 3I7FA 5JEAJ 1HNZL 3A44A 3M3YH 1XJVA 1VQIA 4RG1A 3H0GH 1PVOA 2JA6G 4MNOA 3HKSA 1N34Q 2Y0SE 2UXDQ 4K0KQ 4OWTB 1EQRA 2XGTA 3T1HQ 1VCIA 1VQFA 4AQYQ 1J5EL 4IOCA 4X65L 2VQFQ 3CXCA 1CUKA 2AWOA 2E2IH 3CCVA 3J80i 4JI1L 1DVBA 2PMZE 4BBSH 4LF6Q 4GS3A 4YWMA 3KDFB 5IYDG 1T9OA 4GN5A 4QQBX 3FKIG 4HIDA 5IT9c 4APVA 3GTKH 3KF8B 3ULJA 1VQPA 5LMUL 1UEBA 4O0AA 4X65Q 4JI0Q 1B70B 4JI6L 4LFAL 3HOVH 2BH2A 3RZ6A 1JMCA 4H02A 3PUWA 5BR8L 4GOPB 4BY7G 4JOIC 2PI2E 3PF5A 7RXNA 3BJUA 4GLAC 1QVGA 1PV4A 1CKOA 4JI5L 1Y1VG 2FXQA 4LNQA 3PUYA 3CW2C 3U50C 2WP8J 1Y1WG 2CWAA 1QUQA 4A76A 1PH5A 3TS2A 5LMUQ 2DGYA 4HJ9A 4JI6Q 2ALYB 2RHQB 2Z6KC 1SE8A 1QCVA 1PH4A 4YWKA 5IP9G 2CKZB 1E1OA 3PIOA 3KOJA 2N49A 1T9HA 4DV5Q 2QGQA 1KAWA 1SFOH 2HHHL 2Q2UA 2K52A 1Q7YC 4JI5Q 1IRNA 1E7ZA 4P71A 4JC0A 5IP7G 4IFDJ 1Q82C 2YTYA 1SMXA 2UXCQ 3RR5A 5M3FG 1VQCA 4KHZA 4OWXB 3FHWA 1DGSA 3CCSA 3RYGA 1KQSA 1GM5A 1BRFA 4DR3Q 1VQ7A 4LF5Q 1KRTA 3IRBA 2UU9Q 2HHHQ 1XTDA 2LXJA 4OXPA 1OXTA 5C0XG 2JE6I 2OCEA 4A3JH 2E8GA 4DV7L 1S40A 2E2HH 4JI3Q 1Q81C 3M4PA 2H5XA 2ES2A 1B2OA 5DLQE 5EAYA 3AYHB 4A3LH 1U0LA 1XPUA 5J3BA 3ZJYC 1HJPA 5IYCG 2ZM6Q 1TXYA 3OTOQ 3LGJA 1WYDA 1NBWA 5AJ3Q 3T1YL 4A93G 3EIVA 2KHIA 1VQHA 2C35B 5C44G 4DV7Q 4JI2L 1NJIC 2JJQA 1K73C 5C3EH 1RDGA 6RXNA 2NVTH 3MPSA 4UP9A 4R1JA 1WCMG 2N78A 1CADA 4A3MH 5C4XH 4GN3B 2WB1G 2YYZA 3T1YQ 4OWWB 4LF9L 3CCQA 1B13A 2KHJA 4YHHL 3GTPH 4HIKA 3S2HH 3HOZH 1N32Q 1C0AA 3KYWA 1KHIA 1EFWA 1RIPA 1E1TA 3CP0A 3CAMA 4BXXG 4IPDA 3GD7A 3RN5A 1HR0L 3I4MG 1S3OA 4GN4B 3M4OH 2KBNA 2D0OA 3J80c 3K7UC 4QL5A 1R0IA 1SROA 4LF8Q 1XNQL 2OTJA 3GTQH 2DUDA 2YV5A 2ASBA 4LF9Q 1BBWA 4DR4Q 4PZ8A 4YHHQ 2KN9A 5LMNW 1KRSA 2GMGA 4A3IH 1LKOA 2PVXA 4L5RC 2CCZA 1KD1C 3JC62 4PZ7A 5AI3A 2MS3A 2D0PA 3SS2A 2Q2IA 2R93H 1QVCA 3CF5A 1EIFA 1HR0Q 4DV1Q 4OO1I 1BVSA 1K3RA 4ALPA 3K0XA 1PH2A 2E5LQ 1XNQQ 3S15H 4LFBQ 1HNWL 3HOWG 2F3IA 1I5FA 1IXRA 3HOYH 3PUVA 3CD6A 3CC7A 5AI2A 1H95A 2NN6G 3F8TA 4TVAB 2IY5B 2WFWA 2JA5G 2JQOA 4IJLA 1A8VA 2ZTEA 1VCXA 1MIUA 4NB3A 5FLMH 1X6OA 1BQ8A 1PHJA 3U4VA 1HNWQ 1RWDA 1YBYA 2HT1A 5E7NA 1VQJA 2PYAA 1IU6A 3HKZG 2JA6H 1MKHA 1JT8A 4P75A 4GLXA 2ZJPA 3S1RH 2UUCL 3S1NH 1N8RC 1JJCB 2JEBI 4A3KG 4P72A 4L5SA 2VUMG 4BA2I 4GKKL 4IO9A 1PH8A 3A0JA 5IY0A 2AHOB 4MTNA 3HOXG 3TS0A 4AR4A 2GN5A 2K5NA 2Q2HA 1IBML 1N33Q 2R7ZG 4DR2L 3S14H 5IYDH 1VQ4A 3JAMi 3FKIH 4B3SL 3KYUA 4O2DA 1O7IA 1YZ6A 3CQZH 2UUCQ 4JI4L 2E2JH 3I4NG 1X3FA 4JBJA 1K83H 2HIVA 1A0IA 2K50A 4GKKQ 3CMEA 3GO5A 1OXXK 3GTLH 1Q12A 3CCMA 3S1QH 1H7VA 2UXBL 2PQAA 3TEHB 3PIPA 3L7ZC 3K8AA 4BY7H 1Q1BA 2JK8A 3D31A 4DV0L 1Y1VH 3K81C 1HNZQ 1X3EA 3AFQA 3ULLA 1Y1WH 2K5VA 2UUAL 4A3DG 1L1OA 4A4IA 1GO3E 2LSSA 5JEAG 2VQEL 4LW1A 1X3GA 3DM3A 4X66L 4GNXA 3CCLA 3SGIA 2N8NA 3Q8DA 5IP9H 1JB7A 4Y7NH 3STBD 3KF6B 1J5EQ 1P16A 5ELOA 1YHAA 2R6GA 4ME3A 4JI1Q 1R0JA 4DV0Q 5IP7H 1S72A 1XMOL 3PO3H 1OXVA 5M3FH 5FJ8G 1S2ZA 1E3PA 1KL9A 1CKNB 4MZ9A 5C0XI 2K5HA 1QUQB 1G6PA 5ELNA 4AYBG 4X6AH 3BZCA 1SMWA 3DLLA 3AEVA 1OXSC 3CC4A 4LFAQ 1K0RA 3ERSX 1IYJB 4AIMA 1I3QH 3KDFA 4BA1I 3I56A 3S17H 1HNXL 4GKJL 1XMOQ 4DV6L 2I5MX 5BR8Q 3M9BA 5C4JH 1IL2A 3J7ZC 2IHFA 4GNXC 5IYCH 1HZ9A 4HJ7A 4B3RL 1RDVA 1VQBA 4JBWA 5GADC 3PV0A 1P8LA 4PZ6A 1JJ2A 2HR5A 4A93H 2JA7G 3KYVA 5C44H 1HNXQ 1WI5A 4GOPA 4GKJQ 3J81i 4DV6Q 1UE5A 1C9OA 1VQDA 4IJHA 4QIWE 2NZHA 1JYBA 3CPWA 4DR1L 1RL2A 1PH9A 2NVXH 1WCMH 2R7DA 4LF7L 4YCUA 1PA6A 2L15A 3S16H 4LFCL 2VZAA 2K75A 3GDEA 3CC2A 4IFDG 3KYHC 4GLVB 2EIFA 3KYYA 1XPOA 3HOUG 2R7FA 2KKDA 3W5OA 1UE6A 5GROA 3W1BA 3CCJA 4DV3L 1MJCA 4JBKA 3PO2H 4BXXH 1UE7A 2VW9A 3I4MH 1T9QA 1GKHA 5JJLA 2WAQG 3G71A 4DV4L 3RZDH 4LF7Q 3NEMA 2D62A 3RLNA 3CCRA 2CQOA 3JAMc
chains in the Genus database with same CATH superfamily
1E2VA 2F0VA 1NNXA 2EQSA 1R9TH 4RFBA 1IBKL 2MNAA 3OPOA 1KABA 4X3TA 1EY0A 1LTTD 1JOQA 3PKJA 3MXGA 5K5PA 1STGA 1DONA 4QMGA 3WWVA 3PO2G 3DWQA 4FP5D 4A3KB 3ZG6A 2N88A 3CKIB 3BYYB 1J8IA 1M8AA 1BFYA 2RDHA 2ZJRA 1HR0W 4X64Q 2R92G 3NTIA 3LWRB 3O13A 4IUVA 3H91A 4NXNQ 3J7YW 5EINC 3GTJB 2AMCB 1FJGL 4AI1A 2LCQA 5FO7B 4A3KH 4RKBA 4C2MB 1AH9A 3BG3A 3NELA 2L0CA 1Z9FA 1TWFB 3CRKC 2WB1E 3F2DA 4A3DB 3C46A 1NCVA 5KYIA 2E74C 1E2ZA 1PH6A 1YUZA 4XQJA 2PI2A 2PNRC 1WTVA 3GTJH 3LX0A 3ULPA 1PFMA 3DWAA 5K36G 1LLRD 4C2MH 2NVTL 3M7NA 1B3QA 1W6KA 2KENA 3WDNA 1ODHA 3H9BA 1TWFH 5C4XL 1Y69U 3MQKB 1GJXA 2RBMA 4RXNA 4AYBB 4A3DH 2X69A 3S2HL 1VZHA 5L37A 3J81c 3HGBA 2F4VQ 4HEDA 3NTHA 3I8ZA 4AR3A 5JEAH 1A63A 1BBUA 3M4OL 1HRJA 1SEBD 4FF3A 1HXYD 1VQOA 1DX8A 4OHJA 3T51B 5FJ8H 5JVH1 1Q46A 3MXNA 2Z8LA 4LWCA 1CA5A 3UDFA 2UXDL 1I94L 3A74A 4GNXB 2L1BA 3P20A 3FPUB 1VS0A 3PGZA 2PQEA 1YJNA 2BE5C 1PFWA 3JR7A 5IYBG 3NE5B 2F0GA 1W3SA 3VYRA 5GAHc 4G4KA 4OX9Q 1YNNC 2RA4A 2QA4A 2CVRA 1AFPA 1RCVD 4AHYA 1UAPA 1X54A 3MZ5A 3OYYA 2Z6KA 1LT3D 4ZUIA 4BY1G 1WJVA 3G7LA 1H9RA 4FO2A 1M90C 2Q2TA 1B9NA 3I91A 1EZ6A 3K35A 2N3SA 5JVH3 4XTCS 1LO5D 1U5KA 4LF4L 2XRQD 4KLKA 3RLFA 3NUCA 1XYIA 1LTAD 2OQ0A 2K5WA 1K83L 4HIOA 2O5JD 1WTHA 4N9TA 3BZKA 3S1QL 4IUPA 1SLJA 5C4HA 3UE0A 4K6DA 5DM61 2PPBC 1LV9A 3E9HA 5EPKA 2IWHA 2CH4W 1Y1VL 1SMYC 2UU9L 4AYBE 3QG1A 2UUBL 1VQLA 4B3TQ 4OIKA 4PNYA 5IP9L 3H3VM 4LFCQ 4J8QA 1PTOB 4HIMA 4IUTA 4CDEC 1Z6HA 4HR7B 1ASYA 4DKAC 3SE0A 1F4LA 5HGTA 2B63B 5EKKA 5LHY1 2G9HD 4DAMA 4DAVA 2XJVA 4DV4Q 2EYJA 3R93A 2LMCB 1IU5A 4ZYSA 3H97A 4ULLA 1I3QL 2IX0A 5DM63 3Q6SA 1T9PA 1PTOH 1JQYD 5C4JL 1TS5A 1YV1A 5ELFA 3GV6A 1EL0A 4A3JG 1Y14B 1HTLD 1STEA 3HZXA 4YY3Q 4DR4L 1X65A 2BA0A 3LWUA 2ZTCA 1ZYRD 4RCNA 2NVXL 5C4ZA 1WCML 4AR5A 3LNLA 5FLXc 4K2LA 3S16L 4CHTB 5LMNL 2E5LL 4WFN1 2F3VA 4KHPQ 2IX3A 1C09A 4ABNA 1V1QA 4XT1B 1TU2B 5BN3A 5KEEA 1XWEA 4JI7Q 2OWOA 1AP0A 2B2WA 1RYQA 3V96A 2IPKD 3K7AB 2PNHA 2G9DA 5M3MB 4HMIA 2F0HA 1KDCA 4DR7Q 1R0HA 1V1PB 1I4GA 3CCEA 2JA8B 1SMMA 1R4PB 5CGKA 4A3IG 4A3CH 1BXTA 3BYTB 5JJIA 1R4QB 2B8FA 5IGBA 4IPHA 4L5TA 1KLGD 4DV2Q 2A6HC 2BA1A 2D2CC 3H09A 2AWNA 3VYTA 5IGDA 2RVLA 1K8GA 4Y52H 1QCBD 3K7AH 5M3MH 5MFZA 3LWOB 1QVFA 2FHTA 4JW0A 1N36Q 2E2IB 2K03A 1F9QA 1TWGL 3PIO1 1TS2A 2AUJD 3T1HL 3D6CA 3E5SA 5JPMC 4X62Q 2JA8H 4BBSB 3GTOL 1ASZA 5GAEC 5TSSA 1CSQA 1BCPD 1BDOA 2B2VA 2R7ZL 3DHQA 2JA6G 4K0KQ 1MSGA 2XGTA 4AQYQ 2E2IH 2AWOA 2Y0SP 2JP1A 3J80i 1SAPA 2KVMA 4UDUC 4BBSH 4QQBX 3FKIG 4HIDA 3NK9A 3LPEB 4LHLA 2R3ZA 3SDZA 5J22A 1QG7A 1VQPA 2FINB 5LMUL 4X65Q 1MBYA 1B70B 3DMUA 2EE1A 1JOOA 3BJUA 4N9PA 3BDOA 4ODGA 1CKOA 4JI5L 1FNWA 5G3LD 1FNVA 3CW2C 2F03A 3TS2A 1QUQA 1EZ8A 4KK7A 4JI6Q 3G6JB 4YWKA 5I2YA 1DYQA 1KAWA 1WTXA 1II3A 1DZ1A 4HCSA 4B8CD 2QDBA 1SMXA 2CW0D 5M3FG 2DN8A 4BBRL 1VQ7A 4LF5Q 1G6ZA 1HQRD 3IRBA 2HHHQ 5D3IB 1TVXA 1XTDA 2LXJA 2NVTB 2JE6I 4ZCKA 4DV7L 3OMCA 5C4XB 4JI3Q 1EEFD 5M5YL 2JA7L 5DLQE 5EAYA 1JWMD 3AYHB 2ICIA 3S2HB 5J3BA 1HHVA 5IYCG 3OTOQ 3LWEA 3M4OB 2X6GA 1VQHA 5C44G 1ENFA 1K73C 2B2YA 2NVTH 4B9WA 1SBBB 4R1JA 2N78A 1EQVA 2EVBA 1S5CD 5C4XH 2A6EC 1G8ZD 2C6BA 5C6AA 2A69C 2A5HA 2EYFA 3S2HH 4LF9L 2NB0A 1B13A 2KHJA 3MWYW 2ERJA 1U4LA 3ND9A 4HIKA 1N32Q 2SNMA 2WAQP 1PLFA 4BXXG 3J7AF 1PZJD 3NQIA 3I4MG 3M4OH 4QUFA 3TP7A 1XNQL 4LF8Q 2NVYL 2ICEC 1FYCA 1DM0B 2L9HA 1K8MA 4H44C 4LJZC 3N6RA 2EYLA 5LMNW 1LKOA 4TRDA 1KD1C 3PIP1 2NBFA 3CF5A 1PZXA 4OO1I 5M5WL 1ILPA 1K3RA 4LFBQ 1G2TA 2R92L 3HOWG 1IXRA 1E0BA 2LS01 3J7Z1 3C1FA 3HS0C 5AI2A 4C3IG 2NN6G 3F8TA 1JCKB 5D14A 1A8VA 2ZTEA 3H6MA 4CDFC 4R8IA 1MIUA 1X6OA 5E4XA 2J4XA 3IAYA 2R61A 2XNAC 1K83B 1B44D 2XJPA 1VQJA 4IUUA 5KGUA 4P75A 4GLXA 1KAAA 1N8RC 3S1QB 1MI2A 1K3BC 1KDBA 4P72A 4BA2I 3HOXG 1I4PA 1EOTA 4AR4A 2K01A 4UAIA 1Y1VB 3PIP3 3TDQA 3JAMi 1O7IA 4G6BA 4RCOA 1K83H 2K50A 1A0IA 3CMEA 1WTQA 1Q12A 3S1QH 3DEOA 1H7VA 2PQAA 3L7ZC 3BVMA 1ENCA 1WTRA 1KNAA 3KLRA 3QIAA 1Y1VH 3K81C 1HNZQ 4YIJA 3DM3A 4GNXA 3SGIA 4KKSA 5IP9H 1I3QB 3R2IA 5MFPA 4JI1Q 5C4JB 2DNCA 4MTKA 1S72A 3A54A 3NBIA 4EQOA 2EZVA 5IYBL 3TP6A 1OXSC 1HQMC 3A8JE 3SXHA 2NVXB 5C0XH 1IYJB 4AIMA 1I3QH 1WCMB 4B9XA 3S16B 2PZTA 5BR8Q 5C4JH 3KF8A 1O80A 2IHFA 4BY1L 4GNXC 1CA6A 3NXWA 3PV0A 1P8LA 4PZ6A 3CQZL 3M3YL 3M4YA 1WI5A 4GOPA 4GKJQ 2EY1A 4IJHA 4V0BA 2NVXH 1WCMH 1PA6A 2L15A 3S16H 4LFCL 2VXWA 3NHHA 3HAXC 3KYYA 1IW7C 2JI3A 4ZN3B 3BDLA 3W5OA 4JBKA 4J1MA 2MJ8A 4CJ0B 4DV4L 2DJGC 3CCRA 2A8VA 3DLLA 4UY8C 4M8AA 3D0FA 3AQQA 5A2QL 1XPRA 3STBC 2AQ1B 2F0LA 2HUGA 5I9PA 5EJWA 4FXKC 1PFNA 5KNDA 3W2DA 2DJFC 3TZUA 1TWGB 1QWYA 3GTOB 1EU3A 4OL7A 3G48A 1CHPD 1NSNS 4YY3L 1I4XA 4J15A 4XYOA 2RDGA 2R7ZB 1OWCA 1PFSA 1CHQD 4TVMA 4XIGS 1PMRA 2X6LA 1RB9A 1JE5A 1A15A 4DK1A 4FXDA 2BE5D 1TWGH 1HZAA 3J81L 1PTOC 4ME5A 2NTSA 3GTOH 1SR3A 3F1ZA 1RTNA 4A3BG 1WTWA 2BDOA 5IODA 1YNND 2MUYA 4P2CB 1YK4A 2K7VA 4A3JL 2E2HL 2FMCA 2R7ZH 2C9OA 5CORA 5IIFA 1LABA 1EOVA 1VF7A 3B6YA 4DK3C 3E9IA 3TREA 4DR5Q 4DR7L 1UNSA 2RFKB 1M1KC 1V43A 4IUQA 1IKLA 1YI2A 1L0YB 4BY7B 1Z47A 4QY7A 1LKMA 4DF7A 4DV2L 2HCIA 2J7ZA 2Y0SG 3GTPL 4K2KA 1YJWA 4JYAL 4A3GG 1SDFA 4CDDC 1BBXC 4PG3A 1N36L 3PL5A 2OT2A 2AKWB 4X62L 4JG2A 2B2TA 1IBMQ 1EEID 3PWFA 2RCFA 4DNTB 2FMMA 4DR2Q 1LKPA 3ND8A 1UEAB 4A3IL 5IT9L 4YCVA 2CH4A 5GQOA 1KC8C 5M5YB 2JA7B 1L1OB 3SK5A 2ZTDA 1SMUA 1PZKD 4AQYL 2F1MA 4V196 5IWAL 3HKZP 1K28A 2G5DA 3UE1A 1RKNA 2LY7A 3QO2A 4JOIA 4A3EG 4DK6C 2UUAQ 3TSSA 2PCFB 4JADA 5M5YH 4X66Q 2JA7H 5CBAE 2B2TC 3L0OA 4JVZA 2WAQB 4DPGA 4RGOS 2JA6L 4K5WA 4R4CA 5C5LA 4LUZA 3S1NL 4CBVA 4A75A 2F0SA 1X55A 3A56A 3QOJA 3JC66 4QB4A 4BBRG 2LFNA 1EFID 2M2LA 3D4WA 1RD9D 5D3DA 3RLOA 4IFDH 1QOHA 3H0GG 2V3BB 2NVYB 4JI8L 2KECA 1YUXA 3KF6A 1Q8IA 2A74C 3FKIL 3PO2B 1XMQQ 4Q0FA 3PUXA 5EKLA 1GXDC 2E2JL 5IGCA 1NXEA 3GP7A 4P74A 4NKLA 5M5WB 1CKNA 4FXGC 5JVG1 2P5ZX 1Q1EA 2PZUA 2R92B 8RXNA 1A3VA 4B3RQ 1QYBA 3CPFA 1PFBA 4LF5L 1B7YB 2NVYH 2PYKA 2QW7A 2RCNA 4DNRB 1STAA 1YITA 3VDYA 2YTXA 3HOVG 2I0QA 4DR1Q 1PYBA 4JI3L 1Y8OB 1EY9A 3M4QA 5M5WH 1W6JA 3H15A 1NUCA 5FOBB 3OTOL 2R92H 3TRZA 5FLXL 2RHSB 1I6VC 1SJHD 1X3QA 5FKAC 4DV3Q 5M3FL 4WRDA 5CYUA 2MFIA 2GA4B 3VA5A 3W1GA 1B2JA 1A3TA 1QE6A 1U4RA 5EIOC 1D8LA 1CSPA 4RGTA 1XTCD 3WOEA 5JVG3 3K0YA 1NY4A 2QKIC 1N32L 4LUOA 4XXBB 2CFMA 1VQ8A 3BVGA 4DR6Q 3I73A 1NE3A 5NUCA 2B29A 3MEHA 5IYCL 4NMZA 2F0DA 5ELBA 1D7QA 1QILA 4LF8L 2PMZB 3WWLA 4R4QA 2WAQE 5K36H 5C44L 4DAYB 4A3LG 4P73A 3UDGA 1XXGA 2GVAA 1GUTA 2CR8A 1L2FA 1LTSD 4LFBL 2NZOA 5I2XA 2C5CA 5C3EG 2L5TA 1XNRL 4JV5L 4BXXL 3I4ML 4IN3A 1SE2A 1Q3LA 1ENAA 1UWVA 2WIIB 4KI0A 3VYSA 5I6YA 5IE8A 4AI3A 1DOMA 2OF1A 4U671 3E6ZX 3K6OA 2DY7A 4BY1B 2K1BA 3RZTA 1PYWD 3HOWL 4IZ8A 3SK6A 4DUZL 5IYBH 4C3IL 2PQAB 1IBLQ 3M3YB 3EJIA 2Z6BA 1PH7A 3BVZA 2EJMA 3TP5A 4UPAA 2IJ0A 3UDXA 3FDJA 4WJ3M 1JICA 4B3MQ 3A8IE 1CKMA 3PUZA 4CKEA 3I4OA 3Q0AA 4DUYQ 4BY1H 4R8NA 1IHZA 1ONLA 3NFPI 2VL6A 2IT1A 3SEBA 5E1FA 4DNIA 4LF6L 3PZAA 1HNZL 5JEAJ 3A44A 3M3YH 3HOXL 1XJVA 4U673 1F77A 2B5ID 1N34Q 3WWNB 4OWTB 1EQRA 2TMPA 3Q23A 2VQFQ 4JI1L 1DVBA 2PMZE 1JORA 4FYDA 1TT2A 4YWMA 1CFMA 4X3SA 5IT9c 3KF8B 2KJXA 1QNKA 2A6ED 1BF4A 2A69D 1LTRD 4RHSA 3SK4A 4JI0Q 2BH2A 3RZ6A 4OEMB 4AHXA 2HCCA 2ZIXA 5BR8L 4GOPB 3PF5A 7RXNA 3C1EA 4GLAC 4RA8A 1QVGA 1PV4A 2Q8TA 3QJYA 1Y1WG 2WP8J 1IYVA 2XJTA 2F0JA 2Z6KC 3SVMA 1PRTB 4A3JB 1E1OA 4DV5Q 1C4QA 2E2HB 1T9HA 2H1EA 2YU9L 5KIXA 1E7ZA 4JK1C 1Q82C 1FGBD 3A8KE 3RR5A 4KHZA 4OWXB 1UUPA 4B08A 4L8JA 1SE4A 1GM5A 1BRFA 4DR3Q 2E75C 5M5XL 4EQNA 1QQTA 2RKSA 1U4MA 4A3JH 2E8GA 2V4DA 2E2HH 1SE3A 1Q81C 3M4PA 4C2M1 1U0LA 3GTPB 3BS1A 2ZM6Q 1TXYA 1WTPA 1ILQA 1NBWA 5AJ3Q 3EIVA 1LTID 3IL8A 1NJIC 2JJQA 4U68A 4E6IA 4E6YA 1FD7D 3IFTA 3PQIA 4RHRA 6RXNA 1FR3A 4UP9A 1TWCL 4A3IB 3AB9A 4KD4A 5A2QE 3T1YQ 4YHHL 3GTPH 3U9SA 1LT5D 3RZOL 2C6AA 5CV5A 2XVSA 4FNFA 4IPDA 1S3OA 4GN4B 4ZAIA 5KYLA 2KBNA 1EY4A 2DUDA 3GV3A 2ASBA 4A3IH 1ESFA 2GMGA 1KRSA 1U4PA 2F0NA 3JC62 5GADc 5AI3A 4LAAA 2D0PA 4AHZA 2Q2IA 4RWSC 1QVCA 1EIFA 1HR0Q 4DV1Q 1BVSA 3J81E 2JA6B 1PH2A 4ALPA 3K0XA 3S1NB 1JWSD 1CZGA 4KTAA 3CC7A 3EROA 4TVAB 2WFWA 2JA5G 4ZLTF 3K59A 3FKIB 4A3BL 1BO0A 1BQ8A 1TWHL 4KJOA 4KY5A 3QR8A 1I50L 1HNWQ 1RWDA 2E2JB 2APOB 2Q8RE 1ET9A 1D1KA 2VB3X 1IU6A 3HKZG 2JA6H 1MKHA 1LT6D 2ZJPA 2JYOA 2UUCL 3S1NH 1TWAL 1JJCB 3QWNA 1D2BA 4WFN3 2VUMG 2XWBB 5CR3A 1PH8A 3A0JA 2NTTA 5IY0A 4A3ML 2AHOB 2B2WC 4PMCA 2Q2HA 3ERQA 5HURA 1IBML 4HSPA 4DR2L 4PV1C 1AN8A 3FDTA 2NVQL 1VQ4A 3FKIH 1PRTF 4G7OC 3I4NG 2EJFC 2E2JH 4JBJA 4IALA 4GKKQ 3RD4A 3B0AB 4F87A 3GO5A 1F2ZA 4UY81 2HDLA 3CCMA 3J7Y1 2PPTA 1STBA 4A3GL 1PTOF 5IT9E 5M3FB 4EVOA 2WKCA 4DV0L 2J0TD 1GHKA 3AFQA 4RKLA 1PXUA 2UUAL 1L1OA 1GO3E 4LW1A 4X66L 1RJTA 2N8NA 1EYDA 1SYEA 3STBD 3KF6B 1J5EQ 1CK1A 1YHAA 3UI2A 3TN2A 3PIO3 2B2VC 3I4LA 1OXVA 5M3FH 2I46A 4AI0A 3NWSA 3S2DL 1CKNB 5C0XI 1G6PA 2K5HA 3KBGA 4XT3B 4C3HG 5C44B 3P2AA 4A3EL 2NUCA 3P75A 2WACA 3S1ML 1XMOQ 1QJOA 2F0OA 1H9SB 2A68D 3M9BA 5IGEA 1B9MA 5IYCH 1HZ9A 4HJ7A 4MHEA 5D65A 4FF2A 4B3RL 1RDVA 1VQBA 2B2UA 4FF1A 2HR5A 3I4MB 3KYVA 4WJWA 5C44H 1JC7A 1HNXQ 4K5VA 1A2UA 2AUKA 3J81i 1STYA 3H0GL 4DFAA 4DV6Q 4DR1L 1EQTA 1JYBA 2QF7A 1RL2A 3DEPA 2R7DA 4LF7L 4FF4A 4YCUA 1HTPA 1NR4A 4QIWP 2VZAA 1H9KA 3CC2A 3LWPB 3KYHC 4GLVB 3CU7A 2ZXRA 3HOUG 2R7FA 2L4NA 3C2PA 5GROA 1H9JA 1ZKOA 4DV3L 3HOWB 4BXXH 4DAPA 2VW9A 3I4MH 5JJLA 3OOCA 3GTKL 4C3IB 3RLNA 2CQOA 1TIID 3HOVL 4G57A 1Y8PB 3I2ZA 4ZKBB 3A5UA 1OTCA 3A5ZB 5FLXE 4R9WA 2I5LX 1B3AA 4UP8A 1O7LA 4X64L 3HFZB 4DU9A 3HOWH 1PFVA 1YNXA 2Z1CA 3G6EA 1R0GA 1SXTA 2VS1A 2MPMA 2YTVA 4NXNL 2DSXA 4C3IH 1GUWA 3S24A 4RMFA 2NN6H 3TQYA 3U4ZA 2KCTA 3HOXB 4DXFA 4KY6A 4R4OA 2IHEA 1VQEA 5KNBA 1N9WA 1FHHA 3PSIA 3L2PA 1MGSA 2F52A 1K0SA 1G2SA 2AQ3B 1SN8A 2B2YC 3J7AV 4EQ5A 1O7YA 2VY3A 1PYSB 2JI1A 4DAYA 3RNUA 3HOXH 4A3FG 2O5JC 4A3LL 2V1CC 1BE7A 4R4IA 3EBEA 5EQ0A 2MO0A 2F4VL 2PZWA 2RQXA 1LYLA 2JA9A 4MIUA 4QJFA 5C3EL 4G7ZC 3F2CA 2JSOA 5J1ZA 1OXUA 3TZDA 5IOCA 3T53B 3OSOA 2OTLA 3AFPA 1LM0A 3FP9A 4NPSA 1JWUD 1L0WA 2K6AA 2YU9B 3OHXC 1NNQA 5I9OA 4B3ML 2K05A 2JN4A 1EWHA 4DUYL 3IKJA 1MD2D 1VQ5A 3E3XA 3GTQL 1UE1A 4K8JA 3BZDB 1E24A 5M5XB 1NR2A 2EXZA 1I4QA 1W2BA 3QVDA 1STNA 2XRSD 2CKCA 3Q24A 4OGQC 1A3UA 1GD7A 4OX9L 2YU9H 1S24A 3HP3A 1RDPD 1AE3A 3T4AC 3R8BA 3MSUA 1HZBA 4C1NK 3J81j 2OQKA 2RSOA 3QQCE 1EWIA 3TMEA 4UHVA 3E0EA 1FHMA 1ET6A 4Z9CB 3CCUA 2M9VA 1NTGA 5M5XH 4C3JG 1SNQA 1I94Q 1BQ9A 2V0EA 1GVPA 1TWCB 3W3AA 4IPGA 2VQEQ 5JJKA 3H3VH 1CTMA 4JI0L 1CQVA 3GQBA 4K14A 4IFDI 1VQNA 1ZXTA 2CKAA 3J7A5 3RZOB 1AW7A 1FL0A 1ICFB 4YCWA 1J9OA 3SR1A 1KDAA 3KUPA 2XJRA 4IURA 3VYUA 3S14L 3UDIA 1PH3A 1TWCH 4DV5L 3D4RA 1HH2P 4LMQD 1V9PA 4ZKCB 1WVLA 1RYTA 2Z3QB 5AN9H 2I07B 2L0ZA 5HY6A 3S9WA 4B3TL 3RZOH 4O42A 4RH6A 1QZHA 5CV4A 4LF4Q 2RDVA 3NENA 1KIXA 2MP1A 1WJJA 1XX8A 1Q86C 4O1NA 4DR3L 5C0XJ 3EN2A 1Y1WL 3FEWX 1YEZA 4A3BB 1TWHB 1D5XC 1I50B 4AYBP 1X56A 1YHQA 4Y7NL 2XJUA 4L5QA 2ATWA 2L55A 3A7LA 1TWAB 2ZM6L 1K8AC 1B4OA 4HSVA 1NXGA 5AJ3L 2EXDA 1S30A 2K28A 2LKVA 2KCMA 4GOPC 1QZGA 2UUBQ 2KA7A 1PFUA 1AEXA 1WD0A 3J80L 2AQCA 4RGNA 4DK0A 2NVQB 4A3BH 1TWHH 1I50H 1PRTC 5ISRA 4EX5A 1G291 5BN5A 1X3PA 3HJWB 4TSSA 1GHJA 3F2UA 3KFUA 1TWAH 2A19A 2O4XA 2Y0SB 1HA6A 2M4YA 4A3GB 1SRUA 3NQTA 3K5NA 2QL0A 2JEAI 1IKMA 3VPBE 3MFGA 2PW5A 4KHPL 5EBDA 2NVQH 2F3WA 5I6WA 3K5MA 1GUGA 1SYBA 4OELB 2EYHA 4XQNA 3G4SA 3ZYYX 4POGA 2JXMB 4DV1L 4JI7L 5GAHC 4A3GH 1M4VA 4AR6A 3RN2A 1GUSA 3OMGA 4A3MG 1F9PA 5AFWA 3S2DB 1EYGA 3OW2A 5LMNQ 4POFA 3HOZG 1YIJA 1DD2A 4A3EB 3KJOA 1MJEA 4XQQA 1EQQA 1PZID 3S1MB 3NBHB 4CJ2C 2CW0C 3K58A 1VQAA 2PVEA 4N8FA 5BN4A 4PMWA 2BOSA 3PO3G 3S2DH 1SNOA 2ID0A 1JJGA 4BBRB 2R93G 1ICWA 5EBCA 2JA5L 1SMYD 4A3EH 3H0GB 3MVVA 1EY8A 2QEXA 3S1MH 1HZCA 2H12A 3KLWA 3I72A 3HOYG 2DY8A 2FFKB 4OO1G 2MHVA 2B63L 3SHLA 4K0KL 2Z0SA 2XIWA 4NXMQ 1YNJC 3HRZC 5FLMG 2VUML 4BBRH 3GTKB 1QNUA 2NWGA 3H0GH 2E76C 2Y0SE 3HOVB 4QCLA 3T1HQ 4GS7D 1I6HL 1VCIA 2QILA 1VQFA 3I4NL 1J5EL 4CKBA 4X65L 4IOCA 2FJ2A 1CUKA 3CXCA 1MHWC 4H13C 2PSMC 1VF5C 4GS3A 5IYDG 1T9OA 3EQLC 4ILWA 1RF2D 5CMDA 2CHBD 2M6PA 3GTKH 4Q5VA 3ULJA 3D3RA 1AZPA 5CV8A 3E0JA 4JI6L 1S4ZA 3HOVH 5CC4A 1JMCA 2E2DC 4H02A 3OWEB 3PUWA 4BY7G 3DWPA 4JOIC 1JOKA 5ELDA 1JB3A 2FXQA 3GTGL 3PUYA 1PH5A 3OIPA 5LMUQ 5GAGc 1DOKA 3URYA 2ALYB 2RHQB 3KK7A 1BUVT 1PH4A 5JPNC 4A76A 4QUCA 4KN4C 2HHHL 4C3HL 2Q2UA 1EY6A 1H9SA 3X3MA 3JAML 1Q7YC 4JI5Q 1IRNA 4KKTA 4IFDJ 5IP7G 1C8CA 4CJ1B 2YTYA 3P7JA 4ZUJA 2UXCQ 4N8X1 3GTML 4WORA 1EIHA 3CCSA 4XGHA 3RYGA 1CM9A 1KRTA 5C3EB 2OCEA 3HEJA 1S40A 1T5XD 1IYUA 1TQOA 2H5XA 2ES2A 1B2OA 2A6HD 3IU3I 2KUMA 4A3LH 3ZJYC 3B08B 4A93G 3OIQA 2C35B 2Z3RB 4DV7Q 3HOUL 3GTQB 5C3EH 1RDGA 2K33A 2F0MA 1SYCA 2WB1G 2KHSA 2YYZA 4OWWB 3CCQA 4LHNA 1C0AA 3KYWA 1KHIA 1S5BD 4OIJA 3P8BA 1I4RA 3CAMA 3GD7A 4LK1C 3RN5A 2D0OA 2MGSA 1TR5A 2K32A 3K7UC 4QL5A 3J80c 2OTJA 3GTQH 1BR9A 1X32A 3D8GA 4LF9Q 2ERSA 4L5RC 2EY2A 2PVXA 2CCZA 2MS3A 3V05A 1K8OA 3A55A 2XWJB 2B8GA 1EY7A 1CI3M 1XNQQ 3L3OC 2HD3A 2M4VA 1P7PA 3IFDA 3PUVA 2BDNA 4KY7A 5DNFA 3CD6A 1H95A 3FVQA 1HUNA 3S14B 2VB2X 1H9MA 3U4VA 3CQZB 1Z7TA 2HT1A 5E7NA 5M9OA 4A3FL 1TKWB 1JT8A 2WINB 5H1Sc 2JEBI 4A3KG 4L5SA 4IO9A 5FK9C 3LNNA 3PF4A 3TS0A 2CQAA 2GN5A 1N33Q 3S14H 1Y1WB 3KYUA 1Z92B 3CQZH 3I3CA 1RTOA 2HIVA 2IW3A 4Y7NB 5K2ME 5MGNA 3MXUA 1OXXK 3LWQB 1KLUD 3T13A 3K8AA 1STHA 2EYMA 2EDGA 1EYAA 2JK8A 3D31A 3MXPA 2F0KA 3H94A 1X3EA 3ULLA 1Y1WH 4A3DG 2K5VA 4A4IA 2JI2A 3A7AB 2LSSA 5JEAG 2VQEL 1X3GA 3CRLC 1RODA 2ZXPA 3MFYA 3Q8DA 3NSWA 1JB7A 4Y7NH 2DNEA 5E4WC 5EKIA 5ELOA 1PDQA 1VZIA 4ME3A 3P1HA 1GOZA 1BCPB 4XYQA 5FJ8G 1S2ZA 1KL9A 1EYCA 3MHBA 4AYBG 1WD1A 3AEVA 2KCNA 3CC4A 4C3JL 4LFAQ 1KNEA 3KDFA 4BA1I 1U9RA 4GKJL 3H3VC 2Z9HA 2D5DA 2EY6A 3DXJC 1FNUA 4ZQ3A 1IL2A 2D9UA 2NYZD 3EFXD 3K57A 1C9OA 1VQDA 4I7ZC 1A2TA 1TS4A 4NW2A 2K75A 1CQFA 2EIFA 3CHBD 4HTHA 3X3NA 5MF6A 1JR0D 4K5XA 2KKDA 3W1BA 3CCJA 1S5DD 1GKHA 3G71A 4NP5A 2F0UA 2JA5B 3JAMc 1G91A 3KLSX 2J9UB 4JCVE 1E8JA 3J80E 4XXEA 1EIYB 3HKZB 2NN6I 4JI2Q 1IZ6A 1NAPA 1RHPA 4DXGA 2VUMB 2VNUD 2QEJC 1PH1A 1SFOL 1LUZA 2JA5H 4F88A 1TS3A 3HG9A 3I55A 2KOLA 4YWLA 2OEOA 3U58A 1KXLA 1I6HB 1C7YA 2F4IA 3I4NB 4KN7C 3H99A 2MQHA 3LWVB 2B63H 2KQ3A 4X3UA 1X9NA 1EUJA 1VQKA 5T1GA 4CGYB 4DR5L 2VUMH 4S3SA 4KD3A 4KJNA 1G51A 4HJ8A 1Y8NB 2F0PA 1VMPA 4KV6A 4JAGA 1V8QA 4QGUA 3PCOB 1I6HH 5H1SE 3I4NH 3K80C 4AH6A 2SOBA 3L9AX 1WOCA 1SYFA 2B63G 5JJZA 3GTGB 1J6QA 1FGUA 2A1AA 5LL6X 5J39A 3F2BA 4AI2A 1BCPF 1EU4A 4R4TA 4IOAA 1DCZA 1K9MC 1MSHA 4CDCC 1YVCA 3NBHA 3C3LA 5RXNA 1VMCA 2O5IC 4C3HB 2ZJQA 3SK8A 3HOZL 4FDBA 4UP7A 1R0FA 3RMHA 1HUMA 4TQUS 1CT1D 2K4KA 3GTGH 3GTMB 4NXML 1IW7D 2K5DA 3PO3L 4B3SQ 4JYAQ 4JI4Q 4C3HH 2R93L 4EQPA 4RGMA 3HKZE 5FO8B 2SEBD 2F0FA 2MO1A 1SNPA 2RDFA 4K8IA 5FO9B 3S15L 2UXBQ 5G3LF 2M00A 4A3CG 3GTMH 1SNCA 2IX1A 3HOYL 3H3VI 1YHBA 3KYXA 2HVYC 3HOUB 1B53A 5M3MG 5FLML 1IROA 4V190 1QB5D 1PRTD 4GZYC 2EOTA 5IWAQ 1BKBA 3HJYB 4M1UB 1BOSA 1XMQL 3ICEA 2JA8G 3S1RL 4TKOB 1AE2A 4KHVA 5HGQA 1L1OC 5T1IA 3HOUH 5CV9A 1PTOD 2ZXOA 5JAVA 1B71A 5IYDL 2F0IA 1WFQA 1A62A 3JC63 1F2LA 1LTLA 4ZN1B 4HJAA 3NWTA 3DUZA 3KBXA 3MTSA 4BBSG 3R3OA 3GTLL 2K5QA 2K14A 2UXCL 1IL8A 5F2DA 4JI8Q 5KNCA 4WJ4A 4I65A 4BY7L 1VQ9A 5C5MA 4JPBW 3JAME 3KJPA 2RF4A 4LUVA 3D4DA 1E22A 1SSOA 1Q90A 2BH8A 1NMFA 4A3FB 4CKCA 5C3WA 2B2UC 1OO9B 3TBIB 2L12A 5IP7L 5EPJA 1YJ9A 4DR6L 1LTBD 3RUZA 4HN7A 4X6AL 4DGZA 1CZWA 3N52A 1VQ6A 5IGFA 1IBKQ 1CAAA 3S17L 1EY5A 3CMAA 4A3FH 1EIGA 2WV6D 4EGVA 1Q8KA 4ID6A 2L11A 2ENBA 1V1OA 1YNJD 4A93L 1FVIA 2K2DA 2XTIA 2RSNA 5DM71 3D6WA 3ER0A 4TPUA 1B50A 1ZRPA 1VQMA 5EGTA 2KEEA 3R2TA 3MEFA 2LXKA 2Q8IB 3KLSA 5CV6A 3MA2B 3OWFA 2WB1P 1NMGA 2I5HA 1FJGQ 3PO2L 1KTKA 5C4XG 2CWPA 1S5FD 2WKDA 3RZDL 3VR2A 1EWCA 1B2TA 2QCPX 4C3JB 3FPPA 1R9TL 1C48A 1D5MC 1SJED 3VR4A 1IBLL 4JBMA 2Z4HA 2N55A 2B39A 1XNRQ 3BU2A 4JV5Q 2AQ2B 3M85A 1GUOA 2NZ1D 1B8AA 5DM73 1ML0D 2SDFA 2XJSA 1N33L 4HJ5A 1VQGA 4OONA 2F0EA 4PMBA 5GAGC 4IPCA 2OXPA 4C3JH 2XSCA 2HIXA 3MXNB 2K04A 4IQZA 2HQLA 3ITPA 5DAUA 4DA2A 1WTOA 3OW7A 1N34L 5ELEA 4DUZQ 2EYPA 4K9FA 2O2LD 1YK5A 4QF4A 2AYJA 2GVBA 1SYDA 2VQFL 2HQEA 2KEDA 4A3KL 2B3GA 3I7FA 1HFNA 1LT4D 1VQIA 4RG1A 1PVOA 1ZYRC 1D5ZC 3HKSA 4MNOA 1DOLA 2UXDQ 1F2YA 3CCVA 1F9SA 1O7ZA 2XN9C 4LF6Q 3GTJL 3KDFB 4GN5A 2PMZP 4APVA 1ESRA 4HCEA 4ZRZA 1TWFL 4H0LC 1BQQT 1UEBA 1SFOB 4O0AA 4I7AA 4A3DL 4LFAL 1D1IA 3QOLA 2Z4IA 2PI2E 1Y1VG 4LNQA 3U50C 1JE4A 2CWAA 1HPCA 2DGYA 3FRPB 4HJ9A 1I4HA 5ELCA 1SE8A 1QCVA 1T5EA 5IP9G 5FJ8L 2CKZB 3PIOA 3KOJA 2N49A 1SFOH 2QGQA 1LTGD 2K52A 4PQXA 4P71A 4JC0A 5GAEc 3DM1A 3EVQA 1VQCA 1ZEQX 5KRUA 3FHWA 5DEHA 1DGSA 1KQSA 5LL6S 5JOBA 1OWBA 3VR5A 1SYGA 2UU9Q 4OXPA 1BCPC 1OXTA 5C0XG 2BCOA 4A3MB 4JAEA 3U9OA 2F0QA 1XPUA 3PKIA 3HOZB 1HJPA 3V2TA 5IGGA 3LGJA 1WYDA 3T1YL 2KHIA 4JI2L 1TY2A 2IL8A 1HFGA 3MPSA 3PO3B 1WCMG 1CADA 1HCZA 4A3MH 4GN3B 3Q22A 4L6TB 5C3XA 2R93B 3M7GA 3H9CA 3HOZH 2H4OA 3I70A 2PW7A 1EFWA 1RIPA 3K5LA 3S15B 1E1TA 3CP0A 1DXMA 1HR0L 3HOYB 1R0IA 1SROA 2EJGC 3TP8A 2ZT9C 2YV5A 4DR4Q 1BBWA 2SNSA 4PZ8A 4YHHQ 2KN9A 3PO3H 1SNDA 2PO4A 4F7XA 4PZ7A 1L0XB 3ONAB 2EPBA 3SS2A 2A68C 2R93H 2EY5A 1AZQA 4IUNA 2E5LQ 3S1RB 3VR3A 3S15H 1HNWL 2F3IA 1I5FA 3HOYH 1O78A 4OO1H 2IY5B 2JQOA 4IJLA 1VCXA 4L63B 4NB3A 5FLMH 4XDXA 4C56C 1D6EC 5A35A 1A6XA 1PHJA 2EY4E 1YBYA 2PYAA 4HAEA 4QIWB 4BWGB 1VDZA 3S1RH 3GTLB 2F0WA 3FMCA 4GKKL 2XJQA 1F9RA 4MTNA 3NP8A 3NPPA 2K5NA 2R7ZG 5IYDH 4FVMA 4HMJA 1B1ZA 4B3SL 4O2DA 1YZ6A 2TSSA 4JI4L 3EA6A 2UUCQ 3T56B 1V1PA 1X3FA 5CV7A 3GTLH 4RAUC 3MC0B 2UXBL 3TEHB 5CBEE 2F0TA 4KMUC 3PIPA 4BY7H 1Q1BA 1S5ED 1TY0A 3VR6A 3NTKA 2KCCA 1SNMA 4DN4M 3CCLA 3MAQA 3S17B 5MLC3 4JAFA 1P16A 4K6LA 1VZGA 2R6GA 1R0JA 4DV0Q 5IP7H 1XMOL 1BNZA 1PFYA 1LACA 3BDCA 5E3FA 3T16A 4BS9A 4A3CL 1E3PA 4AHWA 3WOFA 1DJRD 1E2WA 4MZ9A 4A93B 1QUQB 5ELNA 4X3KA 4X6AH 1GUNA 2EYOA 1SMWA 3BZCA 4G7HC 3PMFA 4Y52L 1K0RA 2HDMA 3K7AL 5M3ML 3ERSX 3I56A 3S17H 2V0FA 1HNXL 2AUSB 3I90A 4DV6L 2WB1B 2I5MX 4F8MA 5I4DA 3J7ZC 2JA8L 2QDLA 3K5OA 4JBWA 5GADC 1JJ2A 4ZK9B 4A93H 2JA7G 1HA5A 3RZDB 1F2MA 1UE5A 3AU7A 4QIWE 1PH9A 2NZHA 3CPWA 3AMUA 2NYDA 4MN3A 1R9TB 2E2IL 3GDEA 4IFDG 4C1NI 1XPOA 4BBSL 4J6HA 3QB3A 4NDXA 2A73B 1UE6A 5COYA 3PO2H 1MJCA 2M6OA 1UE7A 1T9QA 3VA7A 2WAQG 3RZDH 4LF7Q 5EPLA 3NEMA 4KKUA 2D62A 4H7BA
chains in the Genus database with same CATH topology
2EQSA 1R9TH 1IBKL 2MNAA 3PKJA 3WWVA 3PO2G 3ZG6A 1BFYA 2ZJRA 1HR0W 4X64Q 2R92G 4NXNQ 5EINC 2AMCB 1FJGL 4AI1A 2LCQA 4A3KH 1AH9A 3NELA 1Z9FA 2WB1E 3F2DA 1PH6A 1YUZA 2PI2A 3GTJH 3ULPA 5K36G 4C2MH 3M7NA 2KENA 1ODHA 1TWFH 4RXNA 4A3DH 1VZHA 3J81c 2F4VQ 4AR3A 1A63A 1BBUA 1VQOA 1DX8A 5FJ8H 5JVH1 1Q46A 4LWCA 3UDFA 2UXDL 1I94L 3A74A 4GNXB 1VS0A 3PGZA 1YJNA 5IYBG 1W3SA 5GAHc 4OX9Q 2QA4A 4AHYA 1X54A 3OYYA 2Z6KA 4BY1G 1WJVA 1M90C 2Q2TA 3K35A 2N3SA 4XTCS 1U5KA 4LF4L 4KLKA 3RLFA 2OQ0A 4HIOA 2O5JD 3BZKA 1SLJA 3UE0A 5DM61 3E9HA 2UU9L 4AYBE 2UUBL 1VQLA 4B3TQ 4LFCQ 4HIMA 1ASYA 4DKAC 4DAMA 2XJVA 4DV4Q 1IU5A 2IX0A 1T9PA 1YV1A 4A3JG 1Y14B 4YY3Q 4DR4L 1X65A 2BA0A 2ZTCA 4AR5A 3LNLA 5FLXc 5LMNL 2E5LL 4WFN1 4KHPQ 1C09A 1V1QA 4JI7Q 2OWOA 1RYQA 2PNHA 4DR7Q 1R0HA 3CCEA 1SMMA 4A3IG 4A3CH 5JJIA 4IPHA 4L5TA 4DV2Q 2BA1A 2AWNA 1K8GA 4Y52H 3K7AH 5M3MH 5MFZA 1QVFA 1N36Q 3T1HL 3PIO1 2JA8H 4X62Q 1ASZA 5GAEC 1CSQA 2JA6G 4K0KQ 2XGTA 4AQYQ 2E2IH 2AWOA 3J80i 4BBSH 4QQBX 3FKIG 4HIDA 3LPEB 4LHLA 1VQPA 5LMUL 4X65Q 1B70B 3BJUA 1CKOA 4JI5L 3CW2C 3TS2A 1QUQA 4JI6Q 4YWKA 1KAWA 4B8CD 1SMXA 5M3FG 1VQ7A 4LF5Q 3IRBA 2HHHQ 1XTDA 2LXJA 2JE6I 4DV7L 4JI3Q 5DLQE 5EAYA 3AYHB 5J3BA 5IYCG 3OTOQ 1VQHA 5C44G 1K73C 2NVTH 4R1JA 2N78A 5C4XH 2C6BA 3S2HH 4LF9L 1B13A 2KHJA 2ERJA 4HIKA 1N32Q 4BXXG 3M4OH 3I4MG 1XNQL 4LF8Q 5LMNW 1LKOA 1KD1C 3PIP1 3CF5A 4OO1I 1K3RA 4LFBQ 3HOWG 1IXRA 3J7Z1 5AI2A 2NN6G 3F8TA 1A8VA 2ZTEA 1MIUA 1X6OA 1VQJA 2XJPA 4P75A 4GLXA 1N8RC 4P72A 4BA2I 3HOXG 4AR4A 3JAMi 1O7IA 4G6BA 1K83H 2K50A 1A0IA 3CMEA 1Q12A 3S1QH 1H7VA 2PQAA 3L7ZC 1Y1VH 3K81C 1HNZQ 3DM3A 4GNXA 3SGIA 5IP9H 5MFPA 4JI1Q 1S72A 1OXSC 1IYJB 4AIMA 1I3QH 5BR8Q 5C4JH 2IHFA 4GNXC 3PV0A 1P8LA 4PZ6A 4GKJQ 1WI5A 4GOPA 4IJHA 2NVXH 1WCMH 1PA6A 2L15A 3S16H 4LFCL 3KYYA 2JI3A 4ZN3B 3W5OA 4JBKA 4DV4L 3CCRA 2A8VA 3DLLA 4UY8C 3D0FA 3AQQA 1XPRA 3STBC 3G48A 4YY3L 4J15A 1OWCA 1PFSA 4XIGS 4TVMA 1RB9A 1JE5A 2BE5D 1TWGH 1HZAA 3GTOH 1SR3A 3F1ZA 4A3BG 1YK4A 2R7ZH 1EOVA 3B6YA 4DK3C 3E9IA 3TREA 4DR5Q 4DR7L 1M1KC 1V43A 1YI2A 1Z47A 4QY7A 1LKMA 4DV2L 2Y0SG 1YJWA 4JYAL 4A3GG 4PG3A 1N36L 2AKWB 4X62L 4JG2A 1IBMQ 3PWFA 4DR2Q 1LKPA 4YCVA 5GQOA 1KC8C 1L1OB 2ZTDA 1SMUA 4AQYL 4V196 5IWAL 3UE1A 4JOIA 4A3EG 4DK6C 2UUAQ 4JADA 5M5YH 4X66Q 2JA7H 3L0OA 4DPGA 4R4CA 4LUZA 4A75A 1X55A 3JC66 4BBRG 3RLOA 3H0GG 2V3BB 4JI8L 1YUXA 3KF6A 1XMQQ 3PUXA 1NXEA 4P74A 1CKNA 5JVG1 1Q1EA 8RXNA 4B3RQ 1QYBA 3CPFA 4LF5L 1B7YB 2NVYH 2RCNA 1YITA 3VDYA 2YTXA 3HOVG 2I0QA 4DR1Q 1PYBA 4JI3L 3M4QA 5M5WH 3H15A 3OTOL 2R92H 3TRZA 2RHSB 4DV3Q 2MFIA 3W1GA 1B2JA 5EIOC 1D8LA 1CSPA 1NY4A 1N32L 4LUOA 4XXBB 2CFMA 1VQ8A 4DR6Q 1NE3A 2B29A 1D7QA 4LF8L 3WWLA 4R4QA 2WAQE 4DAYB 4A3LG 4P73A 3UDGA 2GVAA 2CR8A 1L2FA 4LFBL 2NZOA 5C3EG 1XNRL 4JV5L 1UWVA 4KI0A 5IE8A 4AI3A 4U671 3RZTA 4DUZL 5IYBH 2PQAB 1IBLQ 1PH7A 4UPAA 3UDXA 4WJ3M 4B3MQ 4BY1H 1CKMA 3PUZA 3I4OA 4DUYQ 3NFPI 2VL6A 2IT1A 4DNIA 4LF6L 3PZAA 1HNZL 5JEAJ 3A44A 3M3YH 1XJVA 2B5ID 1N34Q 3WWNB 4OWTB 1EQRA 2VQFQ 4JI1L 1DVBA 2PMZE 4YWMA 5IT9c 3KF8B 2A6ED 2A69D 4JI0Q 2BH2A 3RZ6A 4AHXA 2ZIXA 5BR8L 4GOPB 3PF5A 7RXNA 4GLAC 1QVGA 1PV4A 1Y1WG 2WP8J 2XJTA 2Z6KC 1E1OA 4DV5Q 1T9HA 1E7ZA 1Q82C 3RR5A 4KHZA 4OWXB 1GM5A 1BRFA 4DR3Q 4A3JH 2E8GA 2E2HH 1Q81C 3M4PA 1U0LA 2ZM6Q 1TXYA 5AJ3Q 1NBWA 3EIVA 1NJIC 2JJQA 4E6YA 6RXNA 4UP9A 3T1YQ 4YHHL 3GTPH 2C6AA 4IPDA 1S3OA 4GN4B 2KBNA 2DUDA 2ASBA 4A3IH 1KRSA 2GMGA 3JC62 5GADc 5AI3A 2D0PA 4AHZA 2Q2IA 1QVCA 1EIFA 1HR0Q 4DV1Q 1BVSA 1PH2A 4ALPA 3K0XA 3CC7A 4TVAB 2WFWA 2JA5G 1BQ8A 1HNWQ 1RWDA 1IU6A 3HKZG 2JA6H 1MKHA 2ZJPA 3S1NH 2UUCL 1JJCB 2VUMG 1PH8A 3A0JA 5IY0A 2AHOB 1IBML 2Q2HA 4DR2L 1VQ4A 3FKIH 3I4NG 2E2JH 4JBJA 4GKKQ 3B0AB 3GO5A 4UY81 3CCMA 3J7Y1 2PPTA 4DV0L 3AFQA 2UUAL 1L1OA 1GO3E 4LW1A 4X66L 2N8NA 3STBD 3KF6B 1J5EQ 1YHAA 1OXVA 5M3FH 4AI0A 5C0XI 1G6PA 1CKNB 2K5HA 3P2AA 1XMOQ 2A68D 3M9BA 5IYCH 1HZ9A 4HJ7A 4B3RL 1RDVA 1VQBA 2HR5A 3KYVA 5C44H 1HNXQ 3J81i 4DV6Q 4DR1L 1JYBA 1RL2A 2R7DA 4LF7L 4YCUA 2VZAA 3CC2A 3KYHC 4GLVB 3HOUG 2R7FA 5GROA 4DV3L 4BXXH 2VW9A 3I4MH 5JJLA 3RLNA 2CQOA 3A5UA 3I2ZA 1OTCA 3A5ZB 2I5LX 4UP8A 4X64L 3HFZB 3HOWH 1YNXA 3G6EA 1R0GA 2VS1A 2YTVA 4NXNL 2DSXA 4C3IH 3S24A 4RMFA 3TQYA 3U4ZA 2KCTA 4R4OA 2IHEA 1VQEA 1N9WA 1FHHA 3PSIA 3L2PA 2F52A 1SN8A 4EQ5A 2VY3A 1PYSB 2JI1A 3RNUA 3HOXH 4A3FG 2V1CC 1BE7A 4R4IA 3EBEA 2MO0A 2F4VL 1LYLA 2JA9A 4QJFA 3F2CA 1OXUA 2OTLA 3AFPA 1LM0A 3FP9A 4NPSA 1L0WA 1NNQA 4B3ML 4DUYL 1VQ5A 1UE1A 1E24A 1W2BA 3QVDA 2CKCA 1GD7A 4OX9L 2YU9H 1S24A 1AE3A 3J81j 3MSUA 1HZBA 2OQKA 3QQCE 1EWIA 3E0EA 1FHMA 3CCUA 1NTGA 5M5XH 1I94Q 1BQ9A 2V0EA 1GVPA 4IPGA 5JJKA 2VQEQ 3H3VH 4JI0L 4IFDI 1VQNA 2CKAA 3J7A5 1FL0A 4YCWA 2XJRA 3UDIA 1PH3A 1TWCH 4DV5L 1HH2P 1V9PA 1RYTA 2Z3QB 5AN9H 5HY6A 2L0ZA 4B3TL 3RZOH 1QZHA 4LF4Q 2RDVA 3NENA 1KIXA 1WJJA 1Q86C 4DR3L 5C0XJ 3EN2A 1YEZA 1X56A 1YHQA 2XJUA 4L5QA 2ATWA 2ZM6L 1K8AC 5AJ3L 1NXGA 2EXDA 1S30A 2KCMA 4GOPC 1QZGA 2UUBQ 4A3BH 1TWHH 1I50H 4EX5A 1G291 3KFUA 1TWAH 2A19A 2M4YA 1SRUA 2QL0A 2JEAI 3VPBE 4KHPL 2NVQH 3G4SA 4POGA 4DV1L 4JI7L 5GAHC 4A3GH 4AR6A 3RN2A 4A3MG 1EYGA 3OW2A 5LMNQ 4POFA 3HOZG 1YIJA 3KJOA 1MJEA 1EQQA 3NBHB 1VQAA 2PVEA 4PMWA 3PO3G 3S2DH 2ID0A 1JJGA 2R93G 4A3EH 2QEXA 3S1MH 1HZCA 2H12A 3KLWA 3HOYG 4OO1G 4K0KL 2Z0SA 4NXMQ 5FLMG 4BBRH 3H0GH 2Y0SE 3T1HQ 4GS7D 1VCIA 1VQFA 1J5EL 4IOCA 4X65L 3CXCA 1CUKA 2PSMC 4GS3A 5IYDG 1T9OA 2M6PA 3GTKH 3ULJA 4JI6L 3HOVH 1JMCA 4H02A 3PUWA 4BY7G 4JOIC 2FXQA 3PUYA 1PH5A 5LMUQ 5GAGc 2ALYB 2RHQB 1PH4A 4A76A 2HHHL 2Q2UA 1Q7YC 4JI5Q 1IRNA 4IFDJ 5IP7G 2YTYA 2UXCQ 3CCSA 4XGHA 3RYGA 1KRTA 2OCEA 1S40A 2H5XA 2ES2A 1B2OA 2A6HD 3IU3I 4A3LH 3ZJYC 3B08B 4A93G 2C35B 2Z3RB 4DV7Q 5C3EH 1RDGA 2WB1G 2YYZA 4OWWB 3CCQA 4LHNA 1C0AA 3KYWA 1KHIA 3P8BA 3CAMA 3GD7A 3RN5A 2D0OA 3J80c 3K7UC 4QL5A 2OTJA 3GTQH 4LF9Q 2ERSA 4L5RC 2PVXA 2CCZA 2MS3A 1XNQQ 2M4VA 3PUVA 3CD6A 1H95A 3U4VA 2HT1A 5E7NA 1JT8A 5H1Sc 2JEBI 4A3KG 4L5SA 4IO9A 3PF4A 3TS0A 1N33Q 2GN5A 3S14H 3KYUA 1Z92B 3CQZH 2HIVA 5K2ME 5MGNA 1OXXK 3K8AA 2JK8A 3D31A 1X3EA 3ULLA 1Y1WH 4A3DG 2K5VA 4A4IA 2JI2A 2LSSA 5JEAG 2VQEL 1X3GA 3Q8DA 1JB7A 4Y7NH 5ELOA 1VZIA 4ME3A 5FJ8G 1S2ZA 1KL9A 4AYBG 3AEVA 3CC4A 4LFAQ 3KDFA 4BA1I 4GKJL 1IL2A 1C9OA 1VQDA 2K75A 2EIFA 5MF6A 2KKDA 3W1BA 3CCJA 1GKHA 3G71A 3JAMc 2J9UB 4JCVE 1E8JA 1EIYB 2NN6I 4JI2Q 1IZ6A 2VNUD 1PH1A 2JA5H 1LUZA 3I55A 4YWLA 3U58A 1KXLA 1C7YA 2MQHA 2B63H 1X9NA 1EUJA 1VQKA 4DR5L 2VUMH 1G51A 4HJ8A 4JAGA 4QGUA 3PCOB 1I6HH 5H1SE 3I4NH 3K80C 4AH6A 1WOCA 2B63G 1J6QA 1FGUA 2A1AA 3F2BA 4AI2A 4R4TA 4IOAA 1K9MC 1YVCA 5RXNA 2ZJQA 4FDBA 4UP7A 1R0FA 4TQUS 2K4KA 3GTGH 4NXML 1IW7D 4B3SQ 4JYAQ 4JI4Q 4C3HH 3HKZE 2MO1A 2UXBQ 4A3CG 3GTMH 2IX1A 3H3VI 1YHBA 3KYXA 5M3MG 1IROA 5IWAQ 1BKBA 1XMQL 3ICEA 2JA8G 1AE2A 5HGQA 1L1OC 3HOUH 1B71A 1WFQA 1A62A 3JC63 1LTLA 4ZN1B 4HJAA 4BBSG 2K14A 2UXCL 4JI8Q 4WJ4A 1VQ9A 3KJPA 2RF4A 4LUVA 1E22A 2BH8A 1NMFA 1YJ9A 4DR6L 1VQ6A 1IBKQ 1CAAA 3CMAA 4A3FH 1Q8KA 1FVIA 2K2DA 2XTIA 5DM71 3ER0A 4TPUA 1ZRPA 1VQMA 3MEFA 2LXKA 1NMGA 2I5HA 1FJGQ 5C4XG 2CWPA 1IBLL 4JBMA 1XNRQ 4JV5Q 3BU2A 3M85A 1B8AA 2XJSA 1N33L 4HJ5A 1VQGA 4OONA 5GAGC 4IPCA 4C3JH 2HIXA 3MXNB 2HQLA 1N34L 4DUZQ 4K9FA 1YK5A 2AYJA 2GVBA 2VQFL 2B3GA 3I7FA 1VQIA 4RG1A 1PVOA 4MNOA 3HKSA 2UXDQ 3CCVA 4LF6Q 3KDFB 4GN5A 4APVA 1UEBA 4O0AA 4LFAL 2PI2E 1Y1VG 4LNQA 3U50C 2CWAA 2DGYA 4HJ9A 1SE8A 1QCVA 5IP9G 3PIOA 2CKZB 3KOJA 2N49A 1SFOH 2QGQA 2K52A 4P71A 4JC0A 5GAEc 1VQCA 3FHWA 1DGSA 1KQSA 1OWBA 2UU9Q 4OXPA 1OXTA 5C0XG 4JAEA 1XPUA 3PKIA 1HJPA 3LGJA 1WYDA 3T1YL 2KHIA 4JI2L 3MPSA 1WCMG 1CADA 4A3MH 4GN3B 3HOZH 1EFWA 1RIPA 1E1TA 3CP0A 1HR0L 1R0IA 1SROA 2YV5A 4DR4Q 1BBWA 4PZ8A 4YHHQ 2KN9A 3PO3H 4PZ7A 3SS2A 2R93H 2E5LQ 3S15H 1HNWL 2F3IA 1I5FA 3HOYH 2IY5B 2JQOA 4IJLA 1VCXA 4NB3A 5FLMH 1PHJA 1YBYA 2PYAA 3S1RH 4GKKL 2XJQA 4MTNA 2K5NA 2R7ZG 5IYDH 4B3SL 4O2DA 1YZ6A 4JI4L 2UUCQ 1X3FA 3GTLH 2UXBL 3TEHB 3PIPA 4BY7H 1Q1BA 3CCLA 5MLC3 4JAFA 1P16A 1VZGA 2R6GA 1R0JA 4DV0Q 5IP7H 1XMOL 1E3PA 4AHWA 4MZ9A 1QUQB 5ELNA 4X6AH 3BZCA 1SMWA 1K0RA 3ERSX 3I56A 3S17H 2V0FA 1HNXL 4DV6L 2I5MX 3J7ZC 4JBWA 5GADC 1JJ2A 4A93H 2JA7G 1UE5A 4QIWE 1PH9A 2NZHA 3CPWA 2NYDA 3GDEA 4IFDG 1XPOA 1UE6A 3PO2H 1MJCA 2M6OA 1UE7A 1T9QA 2WAQG 3RZDH 4LF7Q 3NEMA 2D62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UY8 C;  2EQS A;  1R9T H;  3D0F A;  2MNA A;  1IBK L;  3A5U A;  3I2Z A;  3AQQ A;  1OTC A;  1XPR A;  3A5Z B;  3STB C;  2I5L X;  4JCV E;  4UP8 A;  1E8J A;  1EIY B;  4X64 L;  2NN6 I;  3HFZ B;  3WWV A;  4JI2 Q;  1IZ6 A;  3HOW H;  3PO2 G;  1YNX A;  3G6E A;  1R0G A;  2VS1 A;  2YTV A;  3G48 A;  4NXN L;  2VNU D;  2DSX A;  4C3I H;  4YY3 L;  4J15 A;  4RMF A;  3S24 A;  3TQY A;  3U4Z A;  2KCT A;  1PH1 A;  2JA5 H;  1LUZ A;  4R4O A;  3I55 A;  1BFY A;  1VQE A;  2IHE A;  1N9W A;  2ZJR A;  1HR0 W;  4YWL A;  4X64 Q;  1FHH A;  1PFS A;  4XIG S;  3U58 A;  3PSI A;  3L2P A;  1C7Y A;  2R92 G;  1KXL A;  2F52 A;  2MQH A;  1RB9 A;  1JE5 A;  1SN8 A;  2B63 H;  1TWG H;  4NXN Q;  1HZA A;  1X9N A;  1EUJ A;  4EQ5 A;  2AMC B;  1FJG L;  3GTO H;  1SR3 A;  2VY3 A;  3F1Z A;  1PYS B;  2LCQ A;  4DR5 L;  4A3K H;  1VQK A;  2VUM H;  4A3B G;  1AH9 A;  3RNU A;  3NEL A;  1YK4 A;  1G51 A;  3HOX H;  1Z9F A;  4HJ8 A;  4A3F G;  2R7Z H;  2WB1 E;  3F2D A;  4QGU A;  2V1C C;  1EOV A;  1BE7 A;  3PCO B;  4R4I A;  5H1S E;  3I4N H;  1I6H H;  3K80 C;  4AH6 A;  1PH6 A;  3B6Y A;  3EBE A;  4DK3 C;  3E9I A;  3TRE A;  4DR5 Q;  1YUZ A;  4DR7 L;  1WOC A;  2B63 G;  2MO0 A;  2PI2 A;  1M1K C;  2F4V L;  1J6Q A;  3GTJ H;  3ULP A;  1V43 A;  1FGU A;  2A1A A;  3F2B A;  1YI2 A;  5K36 G;  1LYL A;  2JA9 A;  4R4T A;  4QJF A;  4C2M H;  4IOA A;  3F2C A;  1K9M C;  1OXU A;  3M7N A;  2KEN A;  1YVC A;  1Z47 A;  4QY7 A;  1TWF H;  1LKM A;  4DV2 L;  2OTL A;  3AFP A;  4RXN A;  5RXN A;  1LM0 A;  3FP9 A;  4A3D H;  2Y0S G;  4NPS A;  3J81 c;  2ZJQ A;  3PF4 A;  1L0W A;  2F4V Q;  1YJW A;  4JYA L;  1NNQ A;  4AR3 A;  4FDB A;  1R0F A;  4UP7 A;  4A3G G;  1A63 A;  4PG3 A;  1BBU A;  1N36 L;  4B3M L;  4TQU S;  2K4K A;  3GTG H;  4DUY L;  1VQO A;  1DX8 A;  2AKW B;  4X62 L;  1VQ5 A;  4JG2 A;  1IBM Q;  4NXM L;  1UE1 A;  3PWF A;  4DR2 Q;  1E24 A;  1LKP A;  4B3S Q;  5FJ8 H;  1W2B A;  3QVD A;  1Q46 A;  4YCV A;  5GQO A;  1KC8 C;  4JI4 Q;  4JYA Q;  1L1O B;  4LWC A;  1GD7 A;  4C3H H;  4OX9 L;  3UDF A;  2ZTD A;  2YU9 H;  1I94 L;  3A74 A;  1S24 A;  2UXD L;  3HKZ E;  4GNX B;  1SMU A;  2MO1 A;  1AE3 A;  1VS0 A;  4AQY L;  2UXB Q;  3J81 j;  3PGZ A;  1HZB A;  5IWA L;  4A3C G;  3GTM H;  1YJN A;  2OQK A;  2IX1 A;  3H3V I;  1EWI A;  5IYB G;  1YHB A;  3UE1 A;  3KYX A;  3E0E A;  1W3S A;  1FHM A;  4JOI A;  3CCU A;  4A3E G;  1NTG A;  5M5X H;  4DK6 C;  2UUA Q;  4OX9 Q;  1I94 Q;  1BQ9 A;  4IPG A;  1GVP A;  5M3M G;  2QA4 A;  1IRO A;  2VQE Q;  5JJK A;  3H3V H;  4X66 Q;  5M5Y H;  2JA7 H;  3L0O A;  4JI0 L;  1X54 A;  5IWA Q;  1BKB A;  3OYY A;  2Z6K A;  4IFD I;  4DPG A;  1VQN A;  4BY1 G;  1XMQ L;  4R4C A;  2JA8 G;  4LUZ A;  3ICE A;  3J7A 5;  1M90 C;  1FL0 A;  4YCW A;  4A75 A;  1X55 A;  1AE2 A;  2Q2T A;  5HGQ A;  3JC6 6;  4BBR G;  1L1O C;  3RLO A;  2N3S A;  4XTC S;  3HOU H;  1U5K A;  3H0G G;  2V3B B;  4LF4 L;  4JI8 L;  3UDI A;  1B71 A;  1YUX A;  3KF6 A;  4KLK A;  1PH3 A;  1TWC H;  1WFQ A;  1A62 A;  3RLF A;  1XMQ Q;  3PUX A;  4DV5 L;  1HH2 P;  3JC6 3;  1V9P A;  2OQ0 A;  1LTL A;  4P74 A;  4HJA A;  1RYT A;  5HY6 A;  4HIO A;  4BBS G;  3BZK A;  4B3T L;  1CKN A;  3RZO H;  1Q1E A;  2K14 A;  1QZH A;  1SLJ A;  2UXC L;  2A8V A;  3UE0 A;  4LF4 Q;  2RDV A;  8RXN A;  3NEN A;  4JI8 Q;  1KIX A;  4B3R Q;  1VQ9 A;  4WJ4 A;  1QYB A;  1WJJ A;  3E9H A;  3CPF A;  1Q86 C;  4LF5 L;  4DR3 L;  1B7Y B;  2NVY H;  2RCN A;  5C0X J;  3EN2 A;  4AYB E;  2UU9 L;  1YIT A;  3VDY A;  2YTX A;  2UUB L;  3HOV G;  1YEZ A;  3KJP A;  4DR1 Q;  1VQL A;  2I0Q A;  1PYB A;  2RF4 A;  4LUV A;  4JI3 L;  4B3T Q;  1E22 A;  1X56 A;  1YHQ A;  2BH8 A;  3M4Q A;  1NMF A;  5M5W H;  4L5Q A;  4LFC Q;  3H15 A;  2ATW A;  2ZM6 L;  3OTO L;  4HIM A;  1K8A C;  5AJ3 L;  2R92 H;  3TRZ A;  2EXD A;  1S30 A;  2RHS B;  1ASY A;  2KCM A;  4DKA C;  4DV3 Q;  4GOP C;  1YJ9 A;  1QZG A;  2UUB Q;  4DR6 L;  2MFI A;  3W1G A;  4DAM A;  1B2J A;  4DV4 Q;  1IU5 A;  1D8L A;  1VQ6 A;  4A3B H;  1CSP A;  1TWH H;  1I50 H;  1IBK Q;  1CAA A;  1NY4 A;  4EX5 A;  2IX0 A;  1G29 1;  3CMA A;  4A3F H;  1N32 L;  1T9P A;  4LUO A;  2CFM A;  1VQ8 A;  3KFU A;  4DR6 Q;  1TWA H;  2A19 A;  1NE3 A;  1YV1 A;  1Q8K A;  2M4Y A;  2B29 A;  1SRU A;  2QL0 A;  2JEA I;  4A3J G;  1D7Q A;  1FVI A;  1Y14 B;  4LF8 L;  2K2D A;  4R4Q A;  4KHP L;  2XTI A;  4YY3 Q;  2WAQ E;  4DR4 L;  2NVQ H;  1X65 A;  2BA0 A;  4DAY B;  4A3L G;  2ZTC A;  3ER0 A;  4P73 A;  4TPU A;  3UDG A;  1ZRP A;  2GVA A;  1VQM A;  4AR5 A;  5FLX c;  3G4S A;  3MEF A;  4POG A;  2LXK A;  5LMN L;  4DV1 L;  4JI7 L;  1L2F A;  4LFB L;  2E5L L;  2NZO A;  5GAH C;  4KHP Q;  5C3E G;  4A3G H;  1C09 A;  1NMG A;  2I5H A;  1FJG Q;  4AR6 A;  3RN2 A;  1XNR L;  1V1Q A;  4JV5 L;  4A3M G;  5C4X G;  2CWP A;  1EYG A;  3OW2 A;  1UWV A;  4POF A;  5LMN Q;  1YIJ A;  2OWO A;  4KI0 A;  3KJO A;  1MJE A;  4JI7 Q;  3HOZ G;  1EQQ A;  5IE8 A;  3NBH B;  2PNH A;  1IBL L;  1VQA A;  4JBM A;  2PVE A;  1XNR Q;  4PMW A;  3BU2 A;  4JV5 Q;  4DR7 Q;  3M85 A;  1R0H A;  3CCE A;  1SMM A;  3RZT A;  1B8A A;  3PO3 G;  4A3I G;  4A3C H;  3S2D H;  4DUZ L;  2ID0 A;  1N33 L;  1JJG A;  5JJI A;  5IYB H;  2PQA B;  4IPH A;  4L5T A;  4HJ5 A;  1VQG A;  4OON A;  4DV2 Q;  2BA1 A;  1IBL Q;  2R93 G;  2AWN A;  4A3E H;  1PH7 A;  5GAG C;  4IPC A;  4C3J H;  1K8G A;  4Y52 H;  2QEX A;  3S1M H;  3K7A H;  2HIX A;  3MXN B;  5M3M H;  4UPA A;  1HZC A;  2HQL A;  3KLW A;  1QVF A;  3UDX A;  3HOY G;  4WJ3 M;  1N36 Q;  4B3M Q;  1N34 L;  4OO1 G;  4DUZ Q;  4K0K L;  4K9F A;  1CKM A;  3PUZ A;  3I4O A;  2Z0S A;  4DUY Q;  3T1H L;  4BY1 H;  1YK5 A;  4X62 Q;  4NXM Q;  2GVB A;  2JA8 H;  1ASZ A;  2VQF L;  5GAE C;  2VL6 A;  5FLM G;  2IT1 A;  2B3G A;  4BBR H;  4DNI A;  4LF6 L;  3PZA A;  1CSQ A;  3I7F A;  5JEA J;  1HNZ L;  3A44 A;  3M3Y H;  1XJV A;  1VQI A;  4RG1 A;  3H0G H;  1PVO A;  2JA6 G;  4MNO A;  3HKS A;  1N34 Q;  2Y0S E;  2UXD Q;  4K0K Q;  4OWT B;  1EQR A;  2XGT A;  3T1H Q;  1VCI A;  1VQF A;  4AQY Q;  1J5E L;  4IOC A;  4X65 L;  2VQF Q;  3CXC A;  1CUK A;  2AWO A;  2E2I H;  3CCV A;  3J80 i;  4JI1 L;  1DVB A;  2PMZ E;  4BBS H;  4LF6 Q;  4GS3 A;  4YWM A;  3KDF B;  5IYD G;  1T9O A;  4GN5 A;  4QQB X;  3FKI G;  4HID A;  5IT9 c;  4APV A;  3GTK H;  3KF8 B;  3ULJ A;  1VQP A;  5LMU L;  1UEB A;  4O0A A;  4X65 Q;  4JI0 Q;  1B70 B;  4JI6 L;  4LFA L;  3HOV H;  2BH2 A;  3RZ6 A;  1JMC A;  4H02 A;  3PUW A;  5BR8 L;  4GOP B;  4BY7 G;  4JOI C;  2PI2 E;  3PF5 A;  7RXN A;  3BJU A;  4GLA C;  1QVG A;  1PV4 A;  1CKO A;  4JI5 L;  1Y1V G;  2FXQ A;  4LNQ A;  3PUY A;  3CW2 C;  3U50 C;  2WP8 J;  1Y1W G;  2CWA A;  1QUQ A;  4A76 A;  1PH5 A;  3TS2 A;  5LMU Q;  2DGY A;  4HJ9 A;  4JI6 Q;  2ALY B;  2RHQ B;  2Z6K C;  1SE8 A;  1QCV A;  1PH4 A;  4YWK A;  5IP9 G;  2CKZ B;  1E1O A;  3PIO A;  3KOJ A;  2N49 A;  1T9H A;  4DV5 Q;  2QGQ A;  1KAW A;  1SFO H;  2HHH L;  2Q2U A;  2K52 A;  1Q7Y C;  4JI5 Q;  1IRN A;  1E7Z A;  4P71 A;  4JC0 A;  5IP7 G;  4IFD J;  1Q82 C;  2YTY A;  1SMX A;  2UXC Q;  3RR5 A;  5M3F G;  1VQC A;  4KHZ A;  4OWX B;  3FHW A;  1DGS A;  3CCS A;  3RYG A;  1KQS A;  1GM5 A;  1BRF A;  4DR3 Q;  1VQ7 A;  4LF5 Q;  1KRT A;  3IRB A;  2UU9 Q;  2HHH Q;  1XTD A;  2LXJ A;  4OXP A;  1OXT A;  5C0X G;  2JE6 I;  2OCE A;  4A3J H;  2E8G A;  4DV7 L;  1S40 A;  2E2H H;  4JI3 Q;  1Q81 C;  3M4P A;  2H5X A;  2ES2 A;  1B2O A;  5DLQ E;  5EAY A;  3AYH B;  4A3L H;  1U0L A;  1XPU A;  5J3B A;  3ZJY C;  1HJP A;  5IYC G;  2ZM6 Q;  1TXY A;  3OTO Q;  3LGJ A;  1WYD A;  1NBW A;  5AJ3 Q;  3T1Y L;  4A93 G;  3EIV A;  2KHI A;  1VQH A;  2C35 B;  5C44 G;  4DV7 Q;  4JI2 L;  1NJI C;  2JJQ A;  1K73 C;  5C3E H;  1RDG A;  6RXN A;  2NVT H;  3MPS A;  4UP9 A;  4R1J A;  1WCM G;  2N78 A;  1CAD A;  4A3M H;  5C4X H;  4GN3 B;  2WB1 G;  2YYZ A;  3T1Y Q;  4OWW B;  4LF9 L;  3CCQ A;  1B13 A;  2KHJ A;  4YHH L;  3GTP H;  4HIK A;  3S2H H;  3HOZ H;  1N32 Q;  1C0A A;  3KYW A;  1KHI A;  1EFW A;  1RIP A;  1E1T A;  3CP0 A;  3CAM A;  4BXX G;  4IPD A;  3GD7 A;  3RN5 A;  1HR0 L;  3I4M G;  1S3O A;  4GN4 B;  3M4O H;  2KBN A;  2D0O A;  3J80 c;  3K7U C;  4QL5 A;  1R0I A;  1SRO A;  4LF8 Q;  1XNQ L;  2OTJ A;  3GTQ H;  2DUD A;  2YV5 A;  2ASB A;  4LF9 Q;  1BBW A;  4DR4 Q;  4PZ8 A;  4YHH Q;  2KN9 A;  5LMN W;  1KRS A;  2GMG A;  4A3I H;  1LKO A;  2PVX A;  4L5R C;  2CCZ A;  1KD1 C;  3JC6 2;  4PZ7 A;  5AI3 A;  2MS3 A;  2D0P A;  3SS2 A;  2Q2I A;  2R93 H;  1QVC A;  3CF5 A;  1EIF A;  1HR0 Q;  4DV1 Q;  4OO1 I;  1BVS A;  1K3R A;  4ALP A;  3K0X A;  1PH2 A;  2E5L Q;  1XNQ Q;  3S15 H;  4LFB Q;  1HNW L;  3HOW G;  2F3I A;  1I5F A;  1IXR A;  3HOY H;  3PUV A;  3CD6 A;  3CC7 A;  5AI2 A;  1H95 A;  2NN6 G;  3F8T A;  4TVA B;  2IY5 B;  2WFW A;  2JA5 G;  2JQO A;  4IJL A;  1A8V A;  2ZTE A;  1VCX A;  1MIU A;  4NB3 A;  5FLM H;  1X6O A;  1BQ8 A;  1PHJ A;  3U4V A;  1HNW Q;  1RWD A;  1YBY A;  2HT1 A;  5E7N A;  1VQJ A;  2PYA A;  1IU6 A;  3HKZ G;  2JA6 H;  1MKH A;  1JT8 A;  4P75 A;  4GLX A;  2ZJP A;  3S1R H;  2UUC L;  3S1N H;  1N8R C;  1JJC B;  2JEB I;  4A3K G;  4P72 A;  4L5S A;  2VUM G;  4BA2 I;  4GKK L;  4IO9 A;  1PH8 A;  3A0J A;  5IY0 A;  2AHO B;  4MTN A;  3HOX G;  3TS0 A;  4AR4 A;  2GN5 A;  2K5N A;  2Q2H A;  1IBM L;  1N33 Q;  2R7Z G;  4DR2 L;  3S14 H;  5IYD H;  1VQ4 A;  3JAM i;  3FKI H;  4B3S L;  3KYU A;  4O2D A;  1O7I A;  1YZ6 A;  3CQZ H;  2UUC Q;  4JI4 L;  2E2J H;  3I4N G;  1X3F A;  4JBJ A;  1K83 H;  2HIV A;  1A0I A;  2K50 A;  4GKK Q;  3CME A;  3GO5 A;  1OXX K;  3GTL H;  1Q12 A;  3CCM A;  3S1Q H;  1H7V A;  2UXB L;  2PQA A;  3TEH B;  3PIP A;  3L7Z C;  3K8A A;  4BY7 H;  1Q1B A;  2JK8 A;  3D31 A;  4DV0 L;  1Y1V H;  3K81 C;  1HNZ Q;  1X3E A;  3AFQ A;  3ULL A;  1Y1W H;  2K5V A;  2UUA L;  4A3D G;  1L1O A;  4A4I A;  1GO3 E;  2LSS A;  5JEA G;  2VQE L;  4LW1 A;  1X3G A;  3DM3 A;  4X66 L;  4GNX A;  3CCL A;  3SGI A;  2N8N A;  3Q8D A;  5IP9 H;  1JB7 A;  4Y7N H;  3STB D;  3KF6 B;  1J5E Q;  1P16 A;  5ELO A;  1YHA A;  2R6G A;  4ME3 A;  4JI1 Q;  1R0J A;  4DV0 Q;  5IP7 H;  1S72 A;  1XMO L;  3PO3 H;  1OXV A;  5M3F H;  5FJ8 G;  1S2Z A;  1E3P A;  1KL9 A;  1CKN B;  4MZ9 A;  5C0X I;  2K5H A;  1QUQ B;  1G6P A;  5ELN A;  4AYB G;  4X6A H;  3BZC A;  1SMW A;  3DLL A;  3AEV A;  1OXS C;  3CC4 A;  4LFA Q;  1K0R A;  3ERS X;  1IYJ B;  4AIM A;  1I3Q H;  3KDF A;  4BA1 I;  3I56 A;  3S17 H;  1HNX L;  4GKJ L;  1XMO Q;  4DV6 L;  2I5M X;  5BR8 Q;  3M9B A;  5C4J H;  1IL2 A;  3J7Z C;  2IHF A;  4GNX C;  5IYC H;  1HZ9 A;  4HJ7 A;  4B3R L;  1RDV A;  1VQB A;  4JBW A;  5GAD C;  3PV0 A;  1P8L A;  4PZ6 A;  1JJ2 A;  2HR5 A;  4A93 H;  2JA7 G;  3KYV A;  5C44 H;  1HNX Q;  1WI5 A;  4GOP A;  4GKJ Q;  3J81 i;  4DV6 Q;  1UE5 A;  1C9O A;  1VQD A;  4IJH A;  4QIW E;  2NZH A;  1JYB A;  3CPW A;  4DR1 L;  1RL2 A;  1PH9 A;  2NVX H;  1WCM H;  2R7D A;  4LF7 L;  4YCU A;  1PA6 A;  2L15 A;  3S16 H;  4LFC L;  2VZA A;  2K75 A;  3GDE A;  3CC2 A;  4IFD G;  3KYH C;  4GLV B;  2EIF A;  3KYY A;  1XPO A;  3HOU G;  2R7F A;  2KKD A;  3W5O A;  1UE6 A;  5GRO A;  3W1B A;  3CCJ A;  4DV3 L;  1MJC A;  4JBK A;  3PO2 H;  4BXX H;  1UE7 A;  2VW9 A;  3I4M H;  1T9Q A;  1GKH A;  5JJL A;  2WAQ G;  3G71 A;  4DV4 L;  3RZD H;  4LF7 Q;  3NEM A;  2D62 A;  3RLN A;  3CCR A;  2CQO A;  3JAM c; 
#chains in the Genus database with same CATH topology
 1E2V A;  2F0V A;  1NNX A;  2EQS A;  1R9T H;  4RFB A;  1IBK L;  2MNA A;  3OPO A;  1KAB A;  4X3T A;  1EY0 A;  1LTT D;  1JOQ A;  3PKJ A;  3MXG A;  5K5P A;  1STG A;  1DON A;  4QMG A;  3WWV A;  3PO2 G;  3DWQ A;  4FP5 D;  4A3K B;  3ZG6 A;  2N88 A;  3CKI B;  3BYY B;  1J8I A;  1M8A A;  1BFY A;  2RDH A;  2ZJR A;  1HR0 W;  4X64 Q;  2R92 G;  3NTI A;  3LWR B;  3O13 A;  4IUV A;  3H91 A;  4NXN Q;  3J7Y W;  5EIN C;  3GTJ B;  2AMC B;  1FJG L;  4AI1 A;  2LCQ A;  5FO7 B;  4A3K H;  4RKB A;  4C2M B;  1AH9 A;  3BG3 A;  3NEL A;  2L0C A;  1Z9F A;  1TWF B;  3CRK C;  2WB1 E;  3F2D A;  4A3D B;  3C46 A;  1NCV A;  5KYI A;  2E74 C;  1E2Z A;  1PH6 A;  1YUZ A;  4XQJ A;  2PI2 A;  2PNR C;  1WTV A;  3GTJ H;  3LX0 A;  3ULP A;  1PFM A;  3DWA A;  5K36 G;  1LLR D;  4C2M H;  2NVT L;  3M7N A;  1B3Q A;  1W6K A;  2KEN A;  3WDN A;  1ODH A;  3H9B A;  1TWF H;  5C4X L;  1Y69 U;  3MQK B;  1GJX A;  2RBM A;  4RXN A;  4AYB B;  4A3D H;  2X69 A;  3S2H L;  1VZH A;  5L37 A;  3J81 c;  3HGB A;  2F4V Q;  4HED A;  3NTH A;  3I8Z A;  4AR3 A;  5JEA H;  1A63 A;  1BBU A;  3M4O L;  1HRJ A;  1SEB D;  4FF3 A;  1HXY D;  1VQO A;  1DX8 A;  4OHJ A;  3T51 B;  5FJ8 H;  5JVH 1;  1Q46 A;  3MXN A;  2Z8L A;  4LWC A;  1CA5 A;  3UDF A;  2UXD L;  1I94 L;  3A74 A;  4GNX B;  2L1B A;  3P20 A;  3FPU B;  1VS0 A;  3PGZ A;  2PQE A;  1YJN A;  2BE5 C;  1PFW A;  3JR7 A;  5IYB G;  3NE5 B;  2F0G A;  1W3S A;  3VYR A;  5GAH c;  4G4K A;  4OX9 Q;  1YNN C;  2RA4 A;  2QA4 A;  2CVR A;  1AFP A;  1RCV D;  4AHY A;  1UAP A;  1X54 A;  3MZ5 A;  3OYY A;  2Z6K A;  1LT3 D;  4ZUI A;  4BY1 G;  1WJV A;  3G7L A;  1H9R A;  4FO2 A;  1M90 C;  2Q2T A;  1B9N A;  3I91 A;  1EZ6 A;  3K35 A;  2N3S A;  5JVH 3;  4XTC S;  1LO5 D;  1U5K A;  4LF4 L;  2XRQ D;  4KLK A;  3RLF A;  3NUC A;  1XYI A;  1LTA D;  2OQ0 A;  2K5W A;  1K83 L;  4HIO A;  2O5J D;  1WTH A;  4N9T A;  3BZK A;  3S1Q L;  4IUP A;  1SLJ A;  5C4H A;  3UE0 A;  4K6D A;  5DM6 1;  2PPB C;  1LV9 A;  3E9H A;  5EPK A;  2IWH A;  2CH4 W;  1Y1V L;  1SMY C;  2UU9 L;  4AYB E;  3QG1 A;  2UUB L;  1VQL A;  4B3T Q;  4OIK A;  4PNY A;  5IP9 L;  3H3V M;  4LFC Q;  4J8Q A;  1PTO B;  4HIM A;  4IUT A;  4CDE C;  1Z6H A;  4HR7 B;  1ASY A;  4DKA C;  3SE0 A;  1F4L A;  5HGT A;  2B63 B;  5EKK A;  5LHY 1;  2G9H D;  4DAM A;  4DAV A;  2XJV A;  4DV4 Q;  2EYJ A;  3R93 A;  2LMC B;  1IU5 A;  4ZYS A;  3H97 A;  4ULL A;  1I3Q L;  2IX0 A;  5DM6 3;  3Q6S A;  1T9P A;  1PTO H;  1JQY D;  5C4J L;  1TS5 A;  1YV1 A;  5ELF A;  3GV6 A;  1EL0 A;  4A3J G;  1Y14 B;  1HTL D;  1STE A;  3HZX A;  4YY3 Q;  4DR4 L;  1X65 A;  2BA0 A;  3LWU A;  2ZTC A;  1ZYR D;  4RCN A;  2NVX L;  5C4Z A;  1WCM L;  4AR5 A;  3LNL A;  5FLX c;  4K2L A;  3S16 L;  4CHT B;  5LMN L;  2E5L L;  4WFN 1;  2F3V A;  4KHP Q;  2IX3 A;  1C09 A;  4ABN A;  1V1Q A;  4XT1 B;  1TU2 B;  5BN3 A;  5KEE A;  1XWE A;  4JI7 Q;  2OWO A;  1AP0 A;  2B2W A;  1RYQ A;  3V96 A;  2IPK D;  3K7A B;  2PNH A;  2G9D A;  5M3M B;  4HMI A;  2F0H A;  1KDC A;  4DR7 Q;  1R0H A;  1V1P B;  1I4G A;  3CCE A;  2JA8 B;  1SMM A;  1R4P B;  5CGK A;  4A3I G;  4A3C H;  1BXT A;  3BYT B;  5JJI A;  1R4Q B;  2B8F A;  5IGB A;  4IPH A;  4L5T A;  1KLG D;  4DV2 Q;  2A6H C;  2BA1 A;  2D2C C;  3H09 A;  2AWN A;  3VYT A;  5IGD A;  2RVL A;  1K8G A;  4Y52 H;  1QCB D;  3K7A H;  5M3M H;  5MFZ A;  3LWO B;  1QVF A;  2FHT A;  4JW0 A;  1N36 Q;  2E2I B;  2K03 A;  1F9Q A;  1TWG L;  3PIO 1;  1TS2 A;  2AUJ D;  3T1H L;  3D6C A;  3E5S A;  5JPM C;  4X62 Q;  2JA8 H;  4BBS B;  3GTO L;  1ASZ A;  5GAE C;  5TSS A;  1CSQ A;  1BCP D;  1BDO A;  2B2V A;  2R7Z L;  3DHQ A;  2JA6 G;  4K0K Q;  1MSG A;  2XGT A;  4AQY Q;  2E2I H;  2AWO A;  2Y0S P;  2JP1 A;  3J80 i;  1SAP A;  2KVM A;  4UDU C;  4BBS H;  4QQB X;  3FKI G;  4HID A;  3NK9 A;  3LPE B;  4LHL A;  2R3Z A;  3SDZ A;  5J22 A;  1QG7 A;  1VQP A;  2FIN B;  5LMU L;  4X65 Q;  1MBY A;  1B70 B;  3DMU A;  2EE1 A;  1JOO A;  3BJU A;  4N9P A;  3BDO A;  4ODG A;  1CKO A;  4JI5 L;  1FNW A;  5G3L D;  1FNV A;  3CW2 C;  2F03 A;  3TS2 A;  1QUQ A;  1EZ8 A;  4KK7 A;  4JI6 Q;  3G6J B;  4YWK A;  5I2Y A;  1DYQ A;  1KAW A;  1WTX A;  1II3 A;  1DZ1 A;  4HCS A;  4B8C D;  2QDB A;  1SMX A;  2CW0 D;  5M3F G;  2DN8 A;  4BBR L;  1VQ7 A;  4LF5 Q;  1G6Z A;  1HQR D;  3IRB A;  2HHH Q;  5D3I B;  1TVX A;  1XTD A;  2LXJ A;  2NVT B;  2JE6 I;  4ZCK A;  4DV7 L;  3OMC A;  5C4X B;  4JI3 Q;  1EEF D;  5M5Y L;  2JA7 L;  5DLQ E;  5EAY A;  1JWM D;  3AYH B;  2ICI A;  3S2H B;  5J3B A;  1HHV A;  5IYC G;  3OTO Q;  3LWE A;  3M4O B;  2X6G A;  1VQH A;  5C44 G;  1ENF A;  1K73 C;  2B2Y A;  2NVT H;  4B9W A;  1SBB B;  4R1J A;  2N78 A;  1EQV A;  2EVB A;  1S5C D;  5C4X H;  2A6E C;  1G8Z D;  2C6B A;  5C6A A;  2A69 C;  2A5H A;  2EYF A;  3S2H H;  4LF9 L;  2NB0 A;  1B13 A;  2KHJ A;  3MWY W;  2ERJ A;  1U4L A;  3ND9 A;  4HIK A;  1N32 Q;  2SNM A;  2WAQ P;  1PLF A;  4BXX G;  3J7A F;  1PZJ D;  3NQI A;  3I4M G;  3M4O H;  4QUF A;  3TP7 A;  1XNQ L;  4LF8 Q;  2NVY L;  2ICE C;  1FYC A;  1DM0 B;  2L9H A;  1K8M A;  4H44 C;  4LJZ C;  3N6R A;  2EYL A;  5LMN W;  1LKO A;  4TRD A;  1KD1 C;  3PIP 1;  2NBF A;  3CF5 A;  1PZX A;  4OO1 I;  5M5W L;  1ILP A;  1K3R A;  4LFB Q;  1G2T A;  2R92 L;  3HOW G;  1IXR A;  1E0B A;  2LS0 1;  3J7Z 1;  3C1F A;  3HS0 C;  5AI2 A;  4C3I G;  2NN6 G;  3F8T A;  1JCK B;  5D14 A;  1A8V A;  2ZTE A;  3H6M A;  4CDF C;  4R8I A;  1MIU A;  1X6O A;  5E4X A;  2J4X A;  3IAY A;  2R61 A;  2XNA C;  1K83 B;  1B44 D;  2XJP A;  1VQJ A;  4IUU A;  5KGU A;  4P75 A;  4GLX A;  1KAA A;  1N8R C;  3S1Q B;  1MI2 A;  1K3B C;  1KDB A;  4P72 A;  4BA2 I;  3HOX G;  1I4P A;  1EOT A;  4AR4 A;  2K01 A;  4UAI A;  1Y1V B;  3PIP 3;  3TDQ A;  3JAM i;  1O7I A;  4G6B A;  4RCO A;  1K83 H;  2K50 A;  1A0I A;  3CME A;  1WTQ A;  1Q12 A;  3S1Q H;  3DEO A;  1H7V A;  2PQA A;  3L7Z C;  3BVM A;  1ENC A;  1WTR A;  1KNA A;  3KLR A;  3QIA A;  1Y1V H;  3K81 C;  1HNZ Q;  4YIJ A;  3DM3 A;  4GNX A;  3SGI A;  4KKS A;  5IP9 H;  1I3Q B;  3R2I A;  5MFP A;  4JI1 Q;  5C4J B;  2DNC A;  4MTK A;  1S72 A;  3A54 A;  3NBI A;  4EQO A;  2EZV A;  5IYB L;  3TP6 A;  1OXS C;  1HQM C;  3A8J E;  3SXH A;  2NVX B;  5C0X H;  1IYJ B;  4AIM A;  1I3Q H;  1WCM B;  4B9X A;  3S16 B;  2PZT A;  5BR8 Q;  5C4J H;  3KF8 A;  1O80 A;  2IHF A;  4BY1 L;  4GNX C;  1CA6 A;  3NXW A;  3PV0 A;  1P8L A;  4PZ6 A;  3CQZ L;  3M3Y L;  3M4Y A;  1WI5 A;  4GOP A;  4GKJ Q;  2EY1 A;  4IJH A;  4V0B A;  2NVX H;  1WCM H;  1PA6 A;  2L15 A;  3S16 H;  4LFC L;  2VXW A;  3NHH A;  3HAX C;  3KYY A;  1IW7 C;  2JI3 A;  4ZN3 B;  3BDL A;  3W5O A;  4JBK A;  4J1M A;  2MJ8 A;  4CJ0 B;  4DV4 L;  2DJG C;  3CCR A;  2A8V A;  3DLL A;  4UY8 C;  4M8A A;  3D0F A;  3AQQ A;  5A2Q L;  1XPR A;  3STB C;  2AQ1 B;  2F0L A;  2HUG A;  5I9P A;  5EJW A;  4FXK C;  1PFN A;  5KND A;  3W2D A;  2DJF C;  3TZU A;  1TWG B;  1QWY A;  3GTO B;  1EU3 A;  4OL7 A;  3G48 A;  1CHP D;  1NSN S;  4YY3 L;  1I4X A;  4J15 A;  4XYO A;  2RDG A;  2R7Z B;  1OWC A;  1PFS A;  1CHQ D;  4TVM A;  4XIG S;  1PMR A;  2X6L A;  1RB9 A;  1JE5 A;  1A15 A;  4DK1 A;  4FXD A;  2BE5 D;  1TWG H;  1HZA A;  3J81 L;  1PTO C;  4ME5 A;  2NTS A;  3GTO H;  1SR3 A;  3F1Z A;  1RTN A;  4A3B G;  1WTW A;  2BDO A;  5IOD A;  1YNN D;  2MUY A;  4P2C B;  1YK4 A;  2K7V A;  4A3J L;  2E2H L;  2FMC A;  2R7Z H;  2C9O A;  5COR A;  5IIF A;  1LAB A;  1EOV A;  1VF7 A;  3B6Y A;  4DK3 C;  3E9I A;  3TRE A;  4DR5 Q;  4DR7 L;  1UNS A;  2RFK B;  1M1K C;  1V43 A;  4IUQ A;  1IKL A;  1YI2 A;  1L0Y B;  4BY7 B;  1Z47 A;  4QY7 A;  1LKM A;  4DF7 A;  4DV2 L;  2HCI A;  2J7Z A;  2Y0S G;  3GTP L;  4K2K A;  1YJW A;  4JYA L;  4A3G G;  1SDF A;  4CDD C;  1BBX C;  4PG3 A;  1N36 L;  3PL5 A;  2OT2 A;  2AKW B;  4X62 L;  4JG2 A;  2B2T A;  1IBM Q;  1EEI D;  3PWF A;  2RCF A;  4DNT B;  2FMM A;  4DR2 Q;  1LKP A;  3ND8 A;  1UEA B;  4A3I L;  5IT9 L;  4YCV A;  2CH4 A;  5GQO A;  1KC8 C;  5M5Y B;  2JA7 B;  1L1O B;  3SK5 A;  2ZTD A;  1SMU A;  1PZK D;  4AQY L;  2F1M A;  4V19 6;  5IWA L;  3HKZ P;  1K28 A;  2G5D A;  3UE1 A;  1RKN A;  2LY7 A;  3QO2 A;  4JOI A;  4A3E G;  4DK6 C;  2UUA Q;  3TSS A;  2PCF B;  4JAD A;  5M5Y H;  4X66 Q;  2JA7 H;  5CBA E;  2B2T C;  3L0O A;  4JVZ A;  2WAQ B;  4DPG A;  4RGO S;  2JA6 L;  4K5W A;  4R4C A;  5C5L A;  4LUZ A;  3S1N L;  4CBV A;  4A75 A;  2F0S A;  1X55 A;  3A56 A;  3QOJ A;  3JC6 6;  4QB4 A;  4BBR G;  2LFN A;  1EFI D;  2M2L A;  3D4W A;  1RD9 D;  5D3D A;  3RLO A;  4IFD H;  1QOH A;  3H0G G;  2V3B B;  2NVY B;  4JI8 L;  2KEC A;  1YUX A;  3KF6 A;  1Q8I A;  2A74 C;  3FKI L;  3PO2 B;  1XMQ Q;  4Q0F A;  3PUX A;  5EKL A;  1GXD C;  2E2J L;  5IGC A;  1NXE A;  3GP7 A;  4P74 A;  4NKL A;  5M5W B;  1CKN A;  4FXG C;  5JVG 1;  2P5Z X;  1Q1E A;  2PZU A;  2R92 B;  8RXN A;  1A3V A;  4B3R Q;  1QYB A;  3CPF A;  1PFB A;  4LF5 L;  1B7Y B;  2NVY H;  2PYK A;  2QW7 A;  2RCN A;  4DNR B;  1STA A;  1YIT A;  3VDY A;  2YTX A;  3HOV G;  2I0Q A;  4DR1 Q;  1PYB A;  4JI3 L;  1Y8O B;  1EY9 A;  3M4Q A;  5M5W H;  1W6J A;  3H15 A;  1NUC A;  5FOB B;  3OTO L;  2R92 H;  3TRZ A;  5FLX L;  2RHS B;  1I6V C;  1SJH D;  1X3Q A;  5FKA C;  4DV3 Q;  5M3F L;  4WRD A;  5CYU A;  2MFI A;  2GA4 B;  3VA5 A;  3W1G A;  1B2J A;  1A3T A;  1QE6 A;  1U4R A;  5EIO C;  1D8L A;  1CSP A;  4RGT A;  1XTC D;  3WOE A;  5JVG 3;  3K0Y A;  1NY4 A;  2QKI C;  1N32 L;  4LUO A;  4XXB B;  2CFM A;  1VQ8 A;  3BVG A;  4DR6 Q;  3I73 A;  1NE3 A;  5NUC A;  2B29 A;  3MEH A;  5IYC L;  4NMZ A;  2F0D A;  5ELB A;  1D7Q A;  1QIL A;  4LF8 L;  2PMZ B;  3WWL A;  4R4Q A;  2WAQ E;  5K36 H;  5C44 L;  4DAY B;  4A3L G;  4P73 A;  3UDG A;  1XXG A;  2GVA A;  1GUT A;  2CR8 A;  1L2F A;  1LTS D;  4LFB L;  2NZO A;  5I2X A;  2C5C A;  5C3E G;  2L5T A;  1XNR L;  4JV5 L;  4BXX L;  3I4M L;  4IN3 A;  1SE2 A;  1Q3L A;  1ENA A;  1UWV A;  2WII B;  4KI0 A;  3VYS A;  5I6Y A;  5IE8 A;  4AI3 A;  1DOM A;  2OF1 A;  4U67 1;  3E6Z X;  3K6O A;  2DY7 A;  4BY1 B;  2K1B A;  3RZT A;  1PYW D;  3HOW L;  4IZ8 A;  3SK6 A;  4DUZ L;  5IYB H;  4C3I L;  2PQA B;  1IBL Q;  3M3Y B;  3EJI A;  2Z6B A;  1PH7 A;  3BVZ A;  2EJM A;  3TP5 A;  4UPA A;  2IJ0 A;  3UDX A;  3FDJ A;  4WJ3 M;  1JIC A;  4B3M Q;  3A8I E;  1CKM A;  3PUZ A;  4CKE A;  3I4O A;  3Q0A A;  4DUY Q;  4BY1 H;  4R8N A;  1IHZ A;  1ONL A;  3NFP I;  2VL6 A;  2IT1 A;  3SEB A;  5E1F A;  4DNI A;  4LF6 L;  3PZA A;  1HNZ L;  5JEA J;  3A44 A;  3M3Y H;  3HOX L;  1XJV A;  4U67 3;  1F77 A;  2B5I D;  1N34 Q;  3WWN B;  4OWT B;  1EQR A;  2TMP A;  3Q23 A;  2VQF Q;  4JI1 L;  1DVB A;  2PMZ E;  1JOR A;  4FYD A;  1TT2 A;  4YWM A;  1CFM A;  4X3S A;  5IT9 c;  3KF8 B;  2KJX A;  1QNK A;  2A6E D;  1BF4 A;  2A69 D;  1LTR D;  4RHS A;  3SK4 A;  4JI0 Q;  2BH2 A;  3RZ6 A;  4OEM B;  4AHX A;  2HCC A;  2ZIX A;  5BR8 L;  4GOP B;  3PF5 A;  7RXN A;  3C1E A;  4GLA C;  4RA8 A;  1QVG A;  1PV4 A;  2Q8T A;  3QJY A;  1Y1W G;  2WP8 J;  1IYV A;  2XJT A;  2F0J A;  2Z6K C;  3SVM A;  1PRT B;  4A3J B;  1E1O A;  4DV5 Q;  1C4Q A;  2E2H B;  1T9H A;  2H1E A;  2YU9 L;  5KIX A;  1E7Z A;  4JK1 C;  1Q82 C;  1FGB D;  3A8K E;  3RR5 A;  4KHZ A;  4OWX B;  1UUP A;  4B08 A;  4L8J A;  1SE4 A;  1GM5 A;  1BRF A;  4DR3 Q;  2E75 C;  5M5X L;  4EQN A;  1QQT A;  2RKS A;  1U4M A;  4A3J H;  2E8G A;  2V4D A;  2E2H H;  1SE3 A;  1Q81 C;  3M4P A;  4C2M 1;  1U0L A;  3GTP B;  3BS1 A;  2ZM6 Q;  1TXY A;  1WTP A;  1ILQ A;  1NBW A;  5AJ3 Q;  3EIV A;  1LTI D;  3IL8 A;  1NJI C;  2JJQ A;  4U68 A;  4E6I A;  4E6Y A;  1FD7 D;  3IFT A;  3PQI A;  4RHR A;  6RXN A;  1FR3 A;  4UP9 A;  1TWC L;  4A3I B;  3AB9 A;  4KD4 A;  5A2Q E;  3T1Y Q;  4YHH L;  3GTP H;  3U9S A;  1LT5 D;  3RZO L;  2C6A A;  5CV5 A;  2XVS A;  4FNF A;  4IPD A;  1S3O A;  4GN4 B;  4ZAI A;  5KYL A;  2KBN A;  1EY4 A;  2DUD A;  3GV3 A;  2ASB A;  4A3I H;  1ESF A;  2GMG A;  1KRS A;  1U4P A;  2F0N A;  3JC6 2;  5GAD c;  5AI3 A;  4LAA A;  2D0P A;  4AHZ A;  2Q2I A;  4RWS C;  1QVC A;  1EIF A;  1HR0 Q;  4DV1 Q;  1BVS A;  3J81 E;  2JA6 B;  1PH2 A;  4ALP A;  3K0X A;  3S1N B;  1JWS D;  1CZG A;  4KTA A;  3CC7 A;  3ERO A;  4TVA B;  2WFW A;  2JA5 G;  4ZLT F;  3K59 A;  3FKI B;  4A3B L;  1BO0 A;  1BQ8 A;  1TWH L;  4KJO A;  4KY5 A;  3QR8 A;  1I50 L;  1HNW Q;  1RWD A;  2E2J B;  2APO B;  2Q8R E;  1ET9 A;  1D1K A;  2VB3 X;  1IU6 A;  3HKZ G;  2JA6 H;  1MKH A;  1LT6 D;  2ZJP A;  2JYO A;  2UUC L;  3S1N H;  1TWA L;  1JJC B;  3QWN A;  1D2B A;  4WFN 3;  2VUM G;  2XWB B;  5CR3 A;  1PH8 A;  3A0J A;  2NTT A;  5IY0 A;  4A3M L;  2AHO B;  2B2W C;  4PMC A;  2Q2H A;  3ERQ A;  5HUR A;  1IBM L;  4HSP A;  4DR2 L;  4PV1 C;  1AN8 A;  3FDT A;  2NVQ L;  1VQ4 A;  3FKI H;  1PRT F;  4G7O C;  3I4N G;  2EJF C;  2E2J H;  4JBJ A;  4IAL A;  4GKK Q;  3RD4 A;  3B0A B;  4F87 A;  3GO5 A;  1F2Z A;  4UY8 1;  2HDL A;  3CCM A;  3J7Y 1;  2PPT A;  1STB A;  4A3G L;  1PTO F;  5IT9 E;  5M3F B;  4EVO A;  2WKC A;  4DV0 L;  2J0T D;  1GHK A;  3AFQ A;  4RKL A;  1PXU A;  2UUA L;  1L1O A;  1GO3 E;  4LW1 A;  4X66 L;  1RJT A;  2N8N A;  1EYD A;  1SYE A;  3STB D;  3KF6 B;  1J5E Q;  1CK1 A;  1YHA A;  3UI2 A;  3TN2 A;  3PIO 3;  2B2V C;  3I4L A;  1OXV A;  5M3F H;  2I46 A;  4AI0 A;  3NWS A;  3S2D L;  1CKN B;  5C0X I;  1G6P A;  2K5H A;  3KBG A;  4XT3 B;  4C3H G;  5C44 B;  3P2A A;  4A3E L;  2NUC A;  3P75 A;  2WAC A;  3S1M L;  1XMO Q;  1QJO A;  2F0O A;  1H9S B;  2A68 D;  3M9B A;  5IGE A;  1B9M A;  5IYC H;  1HZ9 A;  4HJ7 A;  4MHE A;  5D65 A;  4FF2 A;  4B3R L;  1RDV A;  1VQB A;  2B2U A;  4FF1 A;  2HR5 A;  3I4M B;  3KYV A;  4WJW A;  5C44 H;  1JC7 A;  1HNX Q;  4K5V A;  1A2U A;  2AUK A;  3J81 i;  1STY A;  3H0G L;  4DFA A;  4DV6 Q;  4DR1 L;  1EQT A;  1JYB A;  2QF7 A;  1RL2 A;  3DEP A;  2R7D A;  4LF7 L;  4FF4 A;  4YCU A;  1HTP A;  1NR4 A;  4QIW P;  2VZA A;  1H9K A;  3CC2 A;  3LWP B;  3KYH C;  4GLV B;  3CU7 A;  2ZXR A;  3HOU G;  2R7F A;  2L4N A;  3C2P A;  5GRO A;  1H9J A;  1ZKO A;  4DV3 L;  3HOW B;  4BXX H;  4DAP A;  2VW9 A;  3I4M H;  5JJL A;  3OOC A;  3GTK L;  4C3I B;  3RLN A;  2CQO A;  1TII D;  3HOV L;  4G57 A;  1Y8P B;  3I2Z A;  4ZKB B;  3A5U A;  1OTC A;  3A5Z B;  5FLX E;  4R9W A;  2I5L X;  1B3A A;  4UP8 A;  1O7L A;  4X64 L;  3HFZ B;  4DU9 A;  3HOW H;  1PFV A;  1YNX A;  2Z1C A;  3G6E A;  1R0G A;  1SXT A;  2VS1 A;  2MPM A;  2YTV A;  4NXN L;  2DSX A;  4C3I H;  1GUW A;  3S24 A;  4RMF A;  2NN6 H;  3TQY A;  3U4Z A;  2KCT A;  3HOX B;  4DXF A;  4KY6 A;  4R4O A;  2IHE A;  1VQE A;  5KNB A;  1N9W A;  1FHH A;  3PSI A;  3L2P A;  1MGS A;  2F52 A;  1K0S A;  1G2S A;  2AQ3 B;  1SN8 A;  2B2Y C;  3J7A V;  4EQ5 A;  1O7Y A;  2VY3 A;  1PYS B;  2JI1 A;  4DAY A;  3RNU A;  3HOX H;  4A3F G;  2O5J C;  4A3L L;  2V1C C;  1BE7 A;  4R4I A;  3EBE A;  5EQ0 A;  2MO0 A;  2F4V L;  2PZW A;  2RQX A;  1LYL A;  2JA9 A;  4MIU A;  4QJF A;  5C3E L;  4G7Z C;  3F2C A;  2JSO A;  5J1Z A;  1OXU A;  3TZD A;  5IOC A;  3T53 B;  3OSO A;  2OTL A;  3AFP A;  1LM0 A;  3FP9 A;  4NPS A;  1JWU D;  1L0W A;  2K6A A;  2YU9 B;  3OHX C;  1NNQ A;  5I9O A;  4B3M L;  2K05 A;  2JN4 A;  1EWH A;  4DUY L;  3IKJ A;  1MD2 D;  1VQ5 A;  3E3X A;  3GTQ L;  1UE1 A;  4K8J A;  3BZD B;  1E24 A;  5M5X B;  1NR2 A;  2EXZ A;  1I4Q A;  1W2B A;  3QVD A;  1STN A;  2XRS D;  2CKC A;  3Q24 A;  4OGQ C;  1A3U A;  1GD7 A;  4OX9 L;  2YU9 H;  1S24 A;  3HP3 A;  1RDP D;  1AE3 A;  3T4A C;  3R8B A;  3MSU A;  1HZB A;  4C1N K;  3J81 j;  2OQK A;  2RSO A;  3QQC E;  1EWI A;  3TME A;  4UHV A;  3E0E A;  1FHM A;  1ET6 A;  4Z9C B;  3CCU A;  2M9V A;  1NTG A;  5M5X H;  4C3J G;  1SNQ A;  1I94 Q;  1BQ9 A;  2V0E A;  1GVP A;  1TWC B;  3W3A A;  4IPG A;  2VQE Q;  5JJK A;  3H3V H;  1CTM A;  4JI0 L;  1CQV A;  3GQB A;  4K14 A;  4IFD I;  1VQN A;  1ZXT A;  2CKA A;  3J7A 5;  3RZO B;  1AW7 A;  1FL0 A;  1ICF B;  4YCW A;  1J9O A;  3SR1 A;  1KDA A;  3KUP A;  2XJR A;  4IUR A;  3VYU A;  3S14 L;  3UDI A;  1PH3 A;  1TWC H;  4DV5 L;  3D4R A;  1HH2 P;  4LMQ D;  1V9P A;  4ZKC B;  1WVL A;  1RYT A;  2Z3Q B;  5AN9 H;  2I07 B;  2L0Z A;  5HY6 A;  3S9W A;  4B3T L;  3RZO H;  4O42 A;  4RH6 A;  1QZH A;  5CV4 A;  4LF4 Q;  2RDV A;  3NEN A;  1KIX A;  2MP1 A;  1WJJ A;  1XX8 A;  1Q86 C;  4O1N A;  4DR3 L;  5C0X J;  3EN2 A;  1Y1W L;  3FEW X;  1YEZ A;  4A3B B;  1TWH B;  1D5X C;  1I50 B;  4AYB P;  1X56 A;  1YHQ A;  4Y7N L;  2XJU A;  4L5Q A;  2ATW A;  2L55 A;  3A7L A;  1TWA B;  2ZM6 L;  1K8A C;  1B4O A;  4HSV A;  1NXG A;  5AJ3 L;  2EXD A;  1S30 A;  2K28 A;  2LKV A;  2KCM A;  4GOP C;  1QZG A;  2UUB Q;  2KA7 A;  1PFU A;  1AEX A;  1WD0 A;  3J80 L;  2AQC A;  4RGN A;  4DK0 A;  2NVQ B;  4A3B H;  1TWH H;  1I50 H;  1PRT C;  5ISR A;  4EX5 A;  1G29 1;  5BN5 A;  1X3P A;  3HJW B;  4TSS A;  1GHJ A;  3F2U A;  3KFU A;  1TWA H;  2A19 A;  2O4X A;  2Y0S B;  1HA6 A;  2M4Y A;  4A3G B;  1SRU A;  3NQT A;  3K5N A;  2QL0 A;  2JEA I;  1IKM A;  3VPB E;  3MFG A;  2PW5 A;  4KHP L;  5EBD A;  2NVQ H;  2F3W A;  5I6W A;  3K5M A;  1GUG A;  1SYB A;  4OEL B;  2EYH A;  4XQN A;  3G4S A;  3ZYY X;  4POG A;  2JXM B;  4DV1 L;  4JI7 L;  5GAH C;  4A3G H;  1M4V A;  4AR6 A;  3RN2 A;  1GUS A;  3OMG A;  4A3M G;  1F9P A;  5AFW A;  3S2D B;  1EYG A;  3OW2 A;  5LMN Q;  4POF A;  3HOZ G;  1YIJ A;  1DD2 A;  4A3E B;  3KJO A;  1MJE A;  4XQQ A;  1EQQ A;  1PZI D;  3S1M B;  3NBH B;  4CJ2 C;  2CW0 C;  3K58 A;  1VQA A;  2PVE A;  4N8F A;  5BN4 A;  4PMW A;  2BOS A;  3PO3 G;  3S2D H;  1SNO A;  2ID0 A;  1JJG A;  4BBR B;  2R93 G;  1ICW A;  5EBC A;  2JA5 L;  1SMY D;  4A3E H;  3H0G B;  3MVV A;  1EY8 A;  2QEX A;  3S1M H;  1HZC A;  2H12 A;  3KLW A;  3I72 A;  3HOY G;  2DY8 A;  2FFK B;  4OO1 G;  2MHV A;  2B63 L;  3SHL A;  4K0K L;  2Z0S A;  2XIW A;  4NXM Q;  1YNJ C;  3HRZ C;  5FLM G;  2VUM L;  4BBR H;  3GTK B;  1QNU A;  2NWG A;  3H0G H;  2E76 C;  2Y0S E;  3HOV B;  4QCL A;  3T1H Q;  4GS7 D;  1I6H L;  1VCI A;  2QIL A;  1VQF A;  3I4N L;  1J5E L;  4CKB A;  4X65 L;  4IOC A;  2FJ2 A;  1CUK A;  3CXC A;  1MHW C;  4H13 C;  2PSM C;  1VF5 C;  4GS3 A;  5IYD G;  1T9O A;  3EQL C;  4ILW A;  1RF2 D;  5CMD A;  2CHB D;  2M6P A;  3GTK H;  4Q5V A;  3ULJ A;  3D3R A;  1AZP A;  5CV8 A;  3E0J A;  4JI6 L;  1S4Z A;  3HOV H;  5CC4 A;  1JMC A;  2E2D C;  4H02 A;  3OWE B;  3PUW A;  4BY7 G;  3DWP A;  4JOI C;  1JOK A;  5ELD A;  1JB3 A;  2FXQ A;  3GTG L;  3PUY A;  1PH5 A;  3OIP A;  5LMU Q;  5GAG c;  1DOK A;  3URY A;  2ALY B;  2RHQ B;  3KK7 A;  1BUV T;  1PH4 A;  5JPN C;  4A76 A;  4QUC A;  4KN4 C;  2HHH L;  4C3H L;  2Q2U A;  1EY6 A;  1H9S A;  3X3M A;  3JAM L;  1Q7Y C;  4JI5 Q;  1IRN A;  4KKT A;  4IFD J;  5IP7 G;  1C8C A;  4CJ1 B;  2YTY A;  3P7J A;  4ZUJ A;  2UXC Q;  4N8X 1;  3GTM L;  4WOR A;  1EIH A;  3CCS A;  4XGH A;  3RYG A;  1CM9 A;  1KRT A;  5C3E B;  2OCE A;  3HEJ A;  1S40 A;  1T5X D;  1IYU A;  1TQO A;  2H5X A;  2ES2 A;  1B2O A;  2A6H D;  3IU3 I;  2KUM A;  4A3L H;  3ZJY C;  3B08 B;  4A93 G;  3OIQ A;  2C35 B;  2Z3R B;  4DV7 Q;  3HOU L;  3GTQ B;  5C3E H;  1RDG A;  2K33 A;  2F0M A;  1SYC A;  2WB1 G;  2KHS A;  2YYZ A;  4OWW B;  3CCQ A;  4LHN A;  1C0A A;  3KYW A;  1KHI A;  1S5B D;  4OIJ A;  3P8B A;  1I4R A;  3CAM A;  3GD7 A;  4LK1 C;  3RN5 A;  2D0O A;  2MGS A;  1TR5 A;  2K32 A;  3K7U C;  4QL5 A;  3J80 c;  2OTJ A;  3GTQ H;  1BR9 A;  1X32 A;  3D8G A;  4LF9 Q;  2ERS A;  4L5R C;  2EY2 A;  2PVX A;  2CCZ A;  2MS3 A;  3V05 A;  1K8O A;  3A55 A;  2XWJ B;  2B8G A;  1EY7 A;  1CI3 M;  1XNQ Q;  3L3O C;  2HD3 A;  2M4V A;  1P7P A;  3IFD A;  3PUV A;  2BDN A;  4KY7 A;  5DNF A;  3CD6 A;  1H95 A;  3FVQ A;  1HUN A;  3S14 B;  2VB2 X;  1H9M A;  3U4V A;  3CQZ B;  1Z7T A;  2HT1 A;  5E7N A;  5M9O A;  4A3F L;  1TKW B;  1JT8 A;  2WIN B;  5H1S c;  2JEB I;  4A3K G;  4L5S A;  4IO9 A;  5FK9 C;  3LNN A;  3PF4 A;  3TS0 A;  2CQA A;  2GN5 A;  1N33 Q;  3S14 H;  1Y1W B;  3KYU A;  1Z92 B;  3CQZ H;  3I3C A;  1RTO A;  2HIV A;  2IW3 A;  4Y7N B;  5K2M E;  5MGN A;  3MXU A;  1OXX K;  3LWQ B;  1KLU D;  3T13 A;  3K8A A;  1STH A;  2EYM A;  2EDG A;  1EYA A;  2JK8 A;  3D31 A;  3MXP A;  2F0K A;  3H94 A;  1X3E A;  3ULL A;  1Y1W H;  4A3D G;  2K5V A;  4A4I A;  2JI2 A;  3A7A B;  2LSS A;  5JEA G;  2VQE L;  1X3G A;  3CRL C;  1ROD A;  2ZXP A;  3MFY A;  3Q8D A;  3NSW A;  1JB7 A;  4Y7N H;  2DNE A;  5E4W C;  5EKI A;  5ELO A;  1PDQ A;  1VZI A;  4ME3 A;  3P1H A;  1GOZ A;  1BCP B;  4XYQ A;  5FJ8 G;  1S2Z A;  1KL9 A;  1EYC A;  3MHB A;  4AYB G;  1WD1 A;  3AEV A;  2KCN A;  3CC4 A;  4C3J L;  4LFA Q;  1KNE A;  3KDF A;  4BA1 I;  1U9R A;  4GKJ L;  3H3V C;  2Z9H A;  2D5D A;  2EY6 A;  3DXJ C;  1FNU A;  4ZQ3 A;  1IL2 A;  2D9U A;  2NYZ D;  3EFX D;  3K57 A;  1C9O A;  1VQD A;  4I7Z C;  1A2T A;  1TS4 A;  4NW2 A;  2K75 A;  1CQF A;  2EIF A;  3CHB D;  4HTH A;  3X3N A;  5MF6 A;  1JR0 D;  4K5X A;  2KKD A;  3W1B A;  3CCJ A;  1S5D D;  1GKH A;  3G71 A;  4NP5 A;  2F0U A;  2JA5 B;  3JAM c;  1G91 A;  3KLS X;  2J9U B;  4JCV E;  1E8J A;  3J80 E;  4XXE A;  1EIY B;  3HKZ B;  2NN6 I;  4JI2 Q;  1IZ6 A;  1NAP A;  1RHP A;  4DXG A;  2VUM B;  2VNU D;  2QEJ C;  1PH1 A;  1SFO L;  1LUZ A;  2JA5 H;  4F88 A;  1TS3 A;  3HG9 A;  3I55 A;  2KOL A;  4YWL A;  2OEO A;  3U58 A;  1KXL A;  1I6H B;  1C7Y A;  2F4I A;  3I4N B;  4KN7 C;  3H99 A;  2MQH A;  3LWV B;  2B63 H;  2KQ3 A;  4X3U A;  1X9N A;  1EUJ A;  1VQK A;  5T1G A;  4CGY B;  4DR5 L;  2VUM H;  4S3S A;  4KD3 A;  4KJN A;  1G51 A;  4HJ8 A;  1Y8N B;  2F0P A;  1VMP A;  4KV6 A;  4JAG A;  1V8Q A;  4QGU A;  3PCO B;  1I6H H;  5H1S E;  3I4N H;  3K80 C;  4AH6 A;  2SOB A;  3L9A X;  1WOC A;  1SYF A;  2B63 G;  5JJZ A;  3GTG B;  1J6Q A;  1FGU A;  2A1A A;  5LL6 X;  5J39 A;  3F2B A;  4AI2 A;  1BCP F;  1EU4 A;  4R4T A;  4IOA A;  1DCZ A;  1K9M C;  1MSH A;  4CDC C;  1YVC A;  3NBH A;  3C3L A;  5RXN A;  1VMC A;  2O5I C;  4C3H B;  2ZJQ A;  3SK8 A;  3HOZ L;  4FDB A;  4UP7 A;  1R0F A;  3RMH A;  1HUM A;  4TQU S;  1CT1 D;  2K4K A;  3GTG H;  3GTM B;  4NXM L;  1IW7 D;  2K5D A;  3PO3 L;  4B3S Q;  4JYA Q;  4JI4 Q;  4C3H H;  2R93 L;  4EQP A;  4RGM A;  3HKZ E;  5FO8 B;  2SEB D;  2F0F A;  2MO1 A;  1SNP A;  2RDF A;  4K8I A;  5FO9 B;  3S15 L;  2UXB Q;  5G3L F;  2M00 A;  4A3C G;  3GTM H;  1SNC A;  2IX1 A;  3HOY L;  3H3V I;  1YHB A;  3KYX A;  2HVY C;  3HOU B;  1B53 A;  5M3M G;  5FLM L;  1IRO A;  4V19 0;  1QB5 D;  1PRT D;  4GZY C;  2EOT A;  5IWA Q;  1BKB A;  3HJY B;  4M1U B;  1BOS A;  1XMQ L;  3ICE A;  2JA8 G;  3S1R L;  4TKO B;  1AE2 A;  4KHV A;  5HGQ A;  1L1O C;  5T1I A;  3HOU H;  5CV9 A;  1PTO D;  2ZXO A;  5JAV A;  1B71 A;  5IYD L;  2F0I A;  1WFQ A;  1A62 A;  3JC6 3;  1F2L A;  1LTL A;  4ZN1 B;  4HJA A;  3NWT A;  3DUZ A;  3KBX A;  3MTS A;  4BBS G;  3R3O A;  3GTL L;  2K5Q A;  2K14 A;  2UXC L;  1IL8 A;  5F2D A;  4JI8 Q;  5KNC A;  4WJ4 A;  4I65 A;  4BY7 L;  1VQ9 A;  5C5M A;  4JPB W;  3JAM E;  3KJP A;  2RF4 A;  4LUV A;  3D4D A;  1E22 A;  1SSO A;  1Q90 A;  2BH8 A;  1NMF A;  4A3F B;  4CKC A;  5C3W A;  2B2U C;  1OO9 B;  3TBI B;  2L12 A;  5IP7 L;  5EPJ A;  1YJ9 A;  4DR6 L;  1LTB D;  3RUZ A;  4HN7 A;  4X6A L;  4DGZ A;  1CZW A;  3N52 A;  1VQ6 A;  5IGF A;  1IBK Q;  1CAA A;  3S17 L;  1EY5 A;  3CMA A;  4A3F H;  1EIG A;  2WV6 D;  4EGV A;  1Q8K A;  4ID6 A;  2L11 A;  2ENB A;  1V1O A;  1YNJ D;  4A93 L;  1FVI A;  2K2D A;  2XTI A;  2RSN A;  5DM7 1;  3D6W A;  3ER0 A;  4TPU A;  1B50 A;  1ZRP A;  1VQM A;  5EGT A;  2KEE A;  3R2T A;  3MEF A;  2LXK A;  2Q8I B;  3KLS A;  5CV6 A;  3MA2 B;  3OWF A;  2WB1 P;  1NMG A;  2I5H A;  1FJG Q;  3PO2 L;  1KTK A;  5C4X G;  2CWP A;  1S5F D;  2WKD A;  3RZD L;  3VR2 A;  1EWC A;  1B2T A;  2QCP X;  4C3J B;  3FPP A;  1R9T L;  1C48 A;  1D5M C;  1SJE D;  3VR4 A;  1IBL L;  4JBM A;  2Z4H A;  2N55 A;  2B39 A;  1XNR Q;  3BU2 A;  4JV5 Q;  2AQ2 B;  3M85 A;  1GUO A;  2NZ1 D;  1B8A A;  5DM7 3;  1ML0 D;  2SDF A;  2XJS A;  1N33 L;  4HJ5 A;  1VQG A;  4OON A;  2F0E A;  4PMB A;  5GAG C;  4IPC A;  2OXP A;  4C3J H;  2XSC A;  2HIX A;  3MXN B;  2K04 A;  4IQZ A;  2HQL A;  3ITP A;  5DAU A;  4DA2 A;  1WTO A;  3OW7 A;  1N34 L;  5ELE A;  4DUZ Q;  2EYP A;  4K9F A;  2O2L D;  1YK5 A;  4QF4 A;  2AYJ A;  2GVB A;  1SYD A;  2VQF L;  2HQE A;  2KED A;  4A3K L;  2B3G A;  3I7F A;  1HFN A;  1LT4 D;  1VQI A;  4RG1 A;  1PVO A;  1ZYR C;  1D5Z C;  3HKS A;  4MNO A;  1DOL A;  2UXD Q;  1F2Y A;  3CCV A;  1F9S A;  1O7Z A;  2XN9 C;  4LF6 Q;  3GTJ L;  3KDF B;  4GN5 A;  2PMZ P;  4APV A;  1ESR A;  4HCE A;  4ZRZ A;  1TWF L;  4H0L C;  1BQQ T;  1UEB A;  1SFO B;  4O0A A;  4I7A A;  4A3D L;  4LFA L;  1D1I A;  3QOL A;  2Z4I A;  2PI2 E;  1Y1V G;  4LNQ A;  3U50 C;  1JE4 A;  2CWA A;  1HPC A;  2DGY A;  3FRP B;  4HJ9 A;  1I4H A;  5ELC A;  1SE8 A;  1QCV A;  1T5E A;  5IP9 G;  5FJ8 L;  2CKZ B;  3PIO A;  3KOJ A;  2N49 A;  1SFO H;  2QGQ A;  1LTG D;  2K52 A;  4PQX A;  4P71 A;  4JC0 A;  5GAE c;  3DM1 A;  3EVQ A;  1VQC A;  1ZEQ X;  5KRU A;  3FHW A;  5DEH A;  1DGS A;  1KQS A;  5LL6 S;  5JOB A;  1OWB A;  3VR5 A;  1SYG A;  2UU9 Q;  4OXP A;  1BCP C;  1OXT A;  5C0X G;  2BCO A;  4A3M B;  4JAE A;  3U9O A;  2F0Q A;  1XPU A;  3PKI A;  3HOZ B;  1HJP A;  3V2T A;  5IGG A;  3LGJ A;  1WYD A;  3T1Y L;  2KHI A;  4JI2 L;  1TY2 A;  2IL8 A;  1HFG A;  3MPS A;  3PO3 B;  1WCM G;  1CAD A;  1HCZ A;  4A3M H;  4GN3 B;  3Q22 A;  4L6T B;  5C3X A;  2R93 B;  3M7G A;  3H9C A;  3HOZ H;  2H4O A;  3I70 A;  2PW7 A;  1EFW A;  1RIP A;  3K5L A;  3S15 B;  1E1T A;  3CP0 A;  1DXM A;  1HR0 L;  3HOY B;  1R0I A;  1SRO A;  2EJG C;  3TP8 A;  2ZT9 C;  2YV5 A;  4DR4 Q;  1BBW A;  2SNS A;  4PZ8 A;  4YHH Q;  2KN9 A;  3PO3 H;  1SND A;  2PO4 A;  4F7X A;  4PZ7 A;  1L0X B;  3ONA B;  2EPB A;  3SS2 A;  2A68 C;  2R93 H;  2EY5 A;  1AZQ A;  4IUN A;  2E5L Q;  3S1R B;  3VR3 A;  3S15 H;  1HNW L;  2F3I A;  1I5F A;  3HOY H;  1O78 A;  4OO1 H;  2IY5 B;  2JQO A;  4IJL A;  1VCX A;  4L63 B;  4NB3 A;  5FLM H;  4XDX A;  4C56 C;  1D6E C;  5A35 A;  1A6X A;  1PHJ A;  2EY4 E;  1YBY A;  2PYA A;  4HAE A;  4QIW B;  4BWG B;  1VDZ A;  3S1R H;  3GTL B;  2F0W A;  3FMC A;  4GKK L;  2XJQ A;  1F9R A;  4MTN A;  3NP8 A;  3NPP A;  2K5N A;  2R7Z G;  5IYD H;  4FVM A;  4HMJ A;  1B1Z A;  4B3S L;  4O2D A;  1YZ6 A;  2TSS A;  4JI4 L;  3EA6 A;  2UUC Q;  3T56 B;  1V1P A;  1X3F A;  5CV7 A;  3GTL H;  4RAU C;  3MC0 B;  2UXB L;  3TEH B;  5CBE E;  2F0T A;  4KMU C;  3PIP A;  4BY7 H;  1Q1B A;  1S5E D;  1TY0 A;  3VR6 A;  3NTK A;  2KCC A;  1SNM A;  4DN4 M;  3CCL A;  3MAQ A;  3S17 B;  5MLC 3;  4JAF A;  1P16 A;  4K6L A;  1VZG A;  2R6G A;  1R0J A;  4DV0 Q;  5IP7 H;  1XMO L;  1BNZ A;  1PFY A;  1LAC A;  3BDC A;  5E3F A;  3T16 A;  4BS9 A;  4A3C L;  1E3P A;  4AHW A;  3WOF A;  1DJR D;  1E2W A;  4MZ9 A;  4A93 B;  1QUQ B;  5ELN A;  4X3K A;  4X6A H;  1GUN A;  2EYO A;  1SMW A;  3BZC A;  4G7H C;  3PMF A;  4Y52 L;  1K0R A;  2HDM A;  3K7A L;  5M3M L;  3ERS X;  3I56 A;  3S17 H;  2V0F A;  1HNX L;  2AUS B;  3I90 A;  4DV6 L;  2WB1 B;  2I5M X;  4F8M A;  5I4D A;  3J7Z C;  2JA8 L;  2QDL A;  3K5O A;  4JBW A;  5GAD C;  1JJ2 A;  4ZK9 B;  4A93 H;  2JA7 G;  1HA5 A;  3RZD B;  1F2M A;  1UE5 A;  3AU7 A;  4QIW E;  1PH9 A;  2NZH A;  3CPW A;  3AMU A;  2NYD A;  4MN3 A;  1R9T B;  2E2I L;  3GDE A;  4IFD G;  4C1N I;  1XPO A;  4BBS L;  4J6H A;  3QB3 A;  4NDX A;  2A73 B;  1UE6 A;  5COY A;  3PO2 H;  1MJC A;  2M6O A;  1UE7 A;  1T9Q A;  3VA7 A;  2WAQ G;  3RZD H;  4LF7 Q;  5EPL A;  3NEM A;  4KKU A;  2D62 A;  4H7B A; 
#chains in the Genus database with same CATH homology
 2EQS A;  1R9T H;  1IBK L;  2MNA A;  3PKJ A;  3WWV A;  3PO2 G;  3ZG6 A;  1BFY A;  2ZJR A;  1HR0 W;  4X64 Q;  2R92 G;  4NXN Q;  5EIN C;  2AMC B;  1FJG L;  4AI1 A;  2LCQ A;  4A3K H;  1AH9 A;  3NEL A;  1Z9F A;  2WB1 E;  3F2D A;  1PH6 A;  1YUZ A;  2PI2 A;  3GTJ H;  3ULP A;  5K36 G;  4C2M H;  3M7N A;  2KEN A;  1ODH A;  1TWF H;  4RXN A;  4A3D H;  1VZH A;  3J81 c;  2F4V Q;  4AR3 A;  1A63 A;  1BBU A;  1VQO A;  1DX8 A;  5FJ8 H;  5JVH 1;  1Q46 A;  4LWC A;  3UDF A;  2UXD L;  1I94 L;  3A74 A;  4GNX B;  1VS0 A;  3PGZ A;  1YJN A;  5IYB G;  1W3S A;  5GAH c;  4OX9 Q;  2QA4 A;  4AHY A;  1X54 A;  3OYY A;  2Z6K A;  4BY1 G;  1WJV A;  1M90 C;  2Q2T A;  3K35 A;  2N3S A;  4XTC S;  1U5K A;  4LF4 L;  4KLK A;  3RLF A;  2OQ0 A;  4HIO A;  2O5J D;  3BZK A;  1SLJ A;  3UE0 A;  5DM6 1;  3E9H A;  2UU9 L;  4AYB E;  2UUB L;  1VQL A;  4B3T Q;  4LFC Q;  4HIM A;  1ASY A;  4DKA C;  4DAM A;  2XJV A;  4DV4 Q;  1IU5 A;  2IX0 A;  1T9P A;  1YV1 A;  4A3J G;  1Y14 B;  4YY3 Q;  4DR4 L;  1X65 A;  2BA0 A;  2ZTC A;  4AR5 A;  3LNL A;  5FLX c;  5LMN L;  2E5L L;  4WFN 1;  4KHP Q;  1C09 A;  1V1Q A;  4JI7 Q;  2OWO A;  1RYQ A;  2PNH A;  4DR7 Q;  1R0H A;  3CCE A;  1SMM A;  4A3I G;  4A3C H;  5JJI A;  4IPH A;  4L5T A;  4DV2 Q;  2BA1 A;  2AWN A;  1K8G A;  4Y52 H;  3K7A H;  5M3M H;  5MFZ A;  1QVF A;  1N36 Q;  3T1H L;  3PIO 1;  2JA8 H;  4X62 Q;  1ASZ A;  5GAE C;  1CSQ A;  2JA6 G;  4K0K Q;  2XGT A;  4AQY Q;  2E2I H;  2AWO A;  3J80 i;  4BBS H;  4QQB X;  3FKI G;  4HID A;  3LPE B;  4LHL A;  1VQP A;  5LMU L;  4X65 Q;  1B70 B;  3BJU A;  1CKO A;  4JI5 L;  3CW2 C;  3TS2 A;  1QUQ A;  4JI6 Q;  4YWK A;  1KAW A;  4B8C D;  1SMX A;  5M3F G;  1VQ7 A;  4LF5 Q;  3IRB A;  2HHH Q;  1XTD A;  2LXJ A;  2JE6 I;  4DV7 L;  4JI3 Q;  5DLQ E;  5EAY A;  3AYH B;  5J3B A;  5IYC G;  3OTO Q;  1VQH A;  5C44 G;  1K73 C;  2NVT H;  4R1J A;  2N78 A;  5C4X H;  2C6B A;  3S2H H;  4LF9 L;  1B13 A;  2KHJ A;  2ERJ A;  4HIK A;  1N32 Q;  4BXX G;  3M4O H;  3I4M G;  1XNQ L;  4LF8 Q;  5LMN W;  1LKO A;  1KD1 C;  3PIP 1;  3CF5 A;  4OO1 I;  1K3R A;  4LFB Q;  3HOW G;  1IXR A;  3J7Z 1;  5AI2 A;  2NN6 G;  3F8T A;  1A8V A;  2ZTE A;  1MIU A;  1X6O A;  1VQJ A;  2XJP A;  4P75 A;  4GLX A;  1N8R C;  4P72 A;  4BA2 I;  3HOX G;  4AR4 A;  3JAM i;  1O7I A;  4G6B A;  1K83 H;  2K50 A;  1A0I A;  3CME A;  1Q12 A;  3S1Q H;  1H7V A;  2PQA A;  3L7Z C;  1Y1V H;  3K81 C;  1HNZ Q;  3DM3 A;  4GNX A;  3SGI A;  5IP9 H;  5MFP A;  4JI1 Q;  1S72 A;  1OXS C;  1IYJ B;  4AIM A;  1I3Q H;  5BR8 Q;  5C4J H;  2IHF A;  4GNX C;  3PV0 A;  1P8L A;  4PZ6 A;  4GKJ Q;  1WI5 A;  4GOP A;  4IJH A;  2NVX H;  1WCM H;  1PA6 A;  2L15 A;  3S16 H;  4LFC L;  3KYY A;  2JI3 A;  4ZN3 B;  3W5O A;  4JBK A;  4DV4 L;  3CCR A;  2A8V A;  3DLL A;  4UY8 C;  3D0F A;  3AQQ A;  1XPR A;  3STB C;  3G48 A;  4YY3 L;  4J15 A;  1OWC A;  1PFS A;  4XIG S;  4TVM A;  1RB9 A;  1JE5 A;  2BE5 D;  1TWG H;  1HZA A;  3GTO H;  1SR3 A;  3F1Z A;  4A3B G;  1YK4 A;  2R7Z H;  1EOV A;  3B6Y A;  4DK3 C;  3E9I A;  3TRE A;  4DR5 Q;  4DR7 L;  1M1K C;  1V43 A;  1YI2 A;  1Z47 A;  4QY7 A;  1LKM A;  4DV2 L;  2Y0S G;  1YJW A;  4JYA L;  4A3G G;  4PG3 A;  1N36 L;  2AKW B;  4X62 L;  4JG2 A;  1IBM Q;  3PWF A;  4DR2 Q;  1LKP A;  4YCV A;  5GQO A;  1KC8 C;  1L1O B;  2ZTD A;  1SMU A;  4AQY L;  4V19 6;  5IWA L;  3UE1 A;  4JOI A;  4A3E G;  4DK6 C;  2UUA Q;  4JAD A;  5M5Y H;  4X66 Q;  2JA7 H;  3L0O A;  4DPG A;  4R4C A;  4LUZ A;  4A75 A;  1X55 A;  3JC6 6;  4BBR G;  3RLO A;  3H0G G;  2V3B B;  4JI8 L;  1YUX A;  3KF6 A;  1XMQ Q;  3PUX A;  1NXE A;  4P74 A;  1CKN A;  5JVG 1;  1Q1E A;  8RXN A;  4B3R Q;  1QYB A;  3CPF A;  4LF5 L;  1B7Y B;  2NVY H;  2RCN A;  1YIT A;  3VDY A;  2YTX A;  3HOV G;  2I0Q A;  4DR1 Q;  1PYB A;  4JI3 L;  3M4Q A;  5M5W H;  3H15 A;  3OTO L;  2R92 H;  3TRZ A;  2RHS B;  4DV3 Q;  2MFI A;  3W1G A;  1B2J A;  5EIO C;  1D8L A;  1CSP A;  1NY4 A;  1N32 L;  4LUO A;  4XXB B;  2CFM A;  1VQ8 A;  4DR6 Q;  1NE3 A;  2B29 A;  1D7Q A;  4LF8 L;  3WWL A;  4R4Q A;  2WAQ E;  4DAY B;  4A3L G;  4P73 A;  3UDG A;  2GVA A;  2CR8 A;  1L2F A;  4LFB L;  2NZO A;  5C3E G;  1XNR L;  4JV5 L;  1UWV A;  4KI0 A;  5IE8 A;  4AI3 A;  4U67 1;  3RZT A;  4DUZ L;  5IYB H;  2PQA B;  1IBL Q;  1PH7 A;  4UPA A;  3UDX A;  4WJ3 M;  4B3M Q;  4BY1 H;  1CKM A;  3PUZ A;  3I4O A;  4DUY Q;  3NFP I;  2VL6 A;  2IT1 A;  4DNI A;  4LF6 L;  3PZA A;  1HNZ L;  5JEA J;  3A44 A;  3M3Y H;  1XJV A;  2B5I D;  1N34 Q;  3WWN B;  4OWT B;  1EQR A;  2VQF Q;  4JI1 L;  1DVB A;  2PMZ E;  4YWM A;  5IT9 c;  3KF8 B;  2A6E D;  2A69 D;  4JI0 Q;  2BH2 A;  3RZ6 A;  4AHX A;  2ZIX A;  5BR8 L;  4GOP B;  3PF5 A;  7RXN A;  4GLA C;  1QVG A;  1PV4 A;  1Y1W G;  2WP8 J;  2XJT A;  2Z6K C;  1E1O A;  4DV5 Q;  1T9H A;  1E7Z A;  1Q82 C;  3RR5 A;  4KHZ A;  4OWX B;  1GM5 A;  1BRF A;  4DR3 Q;  4A3J H;  2E8G A;  2E2H H;  1Q81 C;  3M4P A;  1U0L A;  2ZM6 Q;  1TXY A;  5AJ3 Q;  1NBW A;  3EIV A;  1NJI C;  2JJQ A;  4E6Y A;  6RXN A;  4UP9 A;  3T1Y Q;  4YHH L;  3GTP H;  2C6A A;  4IPD A;  1S3O A;  4GN4 B;  2KBN A;  2DUD A;  2ASB A;  4A3I H;  1KRS A;  2GMG A;  3JC6 2;  5GAD c;  5AI3 A;  2D0P A;  4AHZ A;  2Q2I A;  1QVC A;  1EIF A;  1HR0 Q;  4DV1 Q;  1BVS A;  1PH2 A;  4ALP A;  3K0X A;  3CC7 A;  4TVA B;  2WFW A;  2JA5 G;  1BQ8 A;  1HNW Q;  1RWD A;  1IU6 A;  3HKZ G;  2JA6 H;  1MKH A;  2ZJP A;  3S1N H;  2UUC L;  1JJC B;  2VUM G;  1PH8 A;  3A0J A;  5IY0 A;  2AHO B;  1IBM L;  2Q2H A;  4DR2 L;  1VQ4 A;  3FKI H;  3I4N G;  2E2J H;  4JBJ A;  4GKK Q;  3B0A B;  3GO5 A;  4UY8 1;  3CCM A;  3J7Y 1;  2PPT A;  4DV0 L;  3AFQ A;  2UUA L;  1L1O A;  1GO3 E;  4LW1 A;  4X66 L;  2N8N A;  3STB D;  3KF6 B;  1J5E Q;  1YHA A;  1OXV A;  5M3F H;  4AI0 A;  5C0X I;  1G6P A;  1CKN B;  2K5H A;  3P2A A;  1XMO Q;  2A68 D;  3M9B A;  5IYC H;  1HZ9 A;  4HJ7 A;  4B3R L;  1RDV A;  1VQB A;  2HR5 A;  3KYV A;  5C44 H;  1HNX Q;  3J81 i;  4DV6 Q;  4DR1 L;  1JYB A;  1RL2 A;  2R7D A;  4LF7 L;  4YCU A;  2VZA A;  3CC2 A;  3KYH C;  4GLV B;  3HOU G;  2R7F A;  5GRO A;  4DV3 L;  4BXX H;  2VW9 A;  3I4M H;  5JJL A;  3RLN A;  2CQO A;  3A5U A;  3I2Z A;  1OTC A;  3A5Z B;  2I5L X;  4UP8 A;  4X64 L;  3HFZ B;  3HOW H;  1YNX A;  3G6E A;  1R0G A;  2VS1 A;  2YTV A;  4NXN L;  2DSX A;  4C3I H;  3S24 A;  4RMF A;  3TQY A;  3U4Z A;  2KCT A;  4R4O A;  2IHE A;  1VQE A;  1N9W A;  1FHH A;  3PSI A;  3L2P A;  2F52 A;  1SN8 A;  4EQ5 A;  2VY3 A;  1PYS B;  2JI1 A;  3RNU A;  3HOX H;  4A3F G;  2V1C C;  1BE7 A;  4R4I A;  3EBE A;  2MO0 A;  2F4V L;  1LYL A;  2JA9 A;  4QJF A;  3F2C A;  1OXU A;  2OTL A;  3AFP A;  1LM0 A;  3FP9 A;  4NPS A;  1L0W A;  1NNQ A;  4B3M L;  4DUY L;  1VQ5 A;  1UE1 A;  1E24 A;  1W2B A;  3QVD A;  2CKC A;  1GD7 A;  4OX9 L;  2YU9 H;  1S24 A;  1AE3 A;  3J81 j;  3MSU A;  1HZB A;  2OQK A;  3QQC E;  1EWI A;  3E0E A;  1FHM A;  3CCU A;  1NTG A;  5M5X H;  1I94 Q;  1BQ9 A;  2V0E A;  1GVP A;  4IPG A;  5JJK A;  2VQE Q;  3H3V H;  4JI0 L;  4IFD I;  1VQN A;  2CKA A;  3J7A 5;  1FL0 A;  4YCW A;  2XJR A;  3UDI A;  1PH3 A;  1TWC H;  4DV5 L;  1HH2 P;  1V9P A;  1RYT A;  2Z3Q B;  5AN9 H;  5HY6 A;  2L0Z A;  4B3T L;  3RZO H;  1QZH A;  4LF4 Q;  2RDV A;  3NEN A;  1KIX A;  1WJJ A;  1Q86 C;  4DR3 L;  5C0X J;  3EN2 A;  1YEZ A;  1X56 A;  1YHQ A;  2XJU A;  4L5Q A;  2ATW A;  2ZM6 L;  1K8A C;  5AJ3 L;  1NXG A;  2EXD A;  1S30 A;  2KCM A;  4GOP C;  1QZG A;  2UUB Q;  4A3B H;  1TWH H;  1I50 H;  4EX5 A;  1G29 1;  3KFU A;  1TWA H;  2A19 A;  2M4Y A;  1SRU A;  2QL0 A;  2JEA I;  3VPB E;  4KHP L;  2NVQ H;  3G4S A;  4POG A;  4DV1 L;  4JI7 L;  5GAH C;  4A3G H;  4AR6 A;  3RN2 A;  4A3M G;  1EYG A;  3OW2 A;  5LMN Q;  4POF A;  3HOZ G;  1YIJ A;  3KJO A;  1MJE A;  1EQQ A;  3NBH B;  1VQA A;  2PVE A;  4PMW A;  3PO3 G;  3S2D H;  2ID0 A;  1JJG A;  2R93 G;  4A3E H;  2QEX A;  3S1M H;  1HZC A;  2H12 A;  3KLW A;  3HOY G;  4OO1 G;  4K0K L;  2Z0S A;  4NXM Q;  5FLM G;  4BBR H;  3H0G H;  2Y0S E;  3T1H Q;  4GS7 D;  1VCI A;  1VQF A;  1J5E L;  4IOC A;  4X65 L;  3CXC A;  1CUK A;  2PSM C;  4GS3 A;  5IYD G;  1T9O A;  2M6P A;  3GTK H;  3ULJ A;  4JI6 L;  3HOV H;  1JMC A;  4H02 A;  3PUW A;  4BY7 G;  4JOI C;  2FXQ A;  3PUY A;  1PH5 A;  5LMU Q;  5GAG c;  2ALY B;  2RHQ B;  1PH4 A;  4A76 A;  2HHH L;  2Q2U A;  1Q7Y C;  4JI5 Q;  1IRN A;  4IFD J;  5IP7 G;  2YTY A;  2UXC Q;  3CCS A;  4XGH A;  3RYG A;  1KRT A;  2OCE A;  1S40 A;  2H5X A;  2ES2 A;  1B2O A;  2A6H D;  3IU3 I;  4A3L H;  3ZJY C;  3B08 B;  4A93 G;  2C35 B;  2Z3R B;  4DV7 Q;  5C3E H;  1RDG A;  2WB1 G;  2YYZ A;  4OWW B;  3CCQ A;  4LHN A;  1C0A A;  3KYW A;  1KHI A;  3P8B A;  3CAM A;  3GD7 A;  3RN5 A;  2D0O A;  3J80 c;  3K7U C;  4QL5 A;  2OTJ A;  3GTQ H;  4LF9 Q;  2ERS A;  4L5R C;  2PVX A;  2CCZ A;  2MS3 A;  1XNQ Q;  2M4V A;  3PUV A;  3CD6 A;  1H95 A;  3U4V A;  2HT1 A;  5E7N A;  1JT8 A;  5H1S c;  2JEB I;  4A3K G;  4L5S A;  4IO9 A;  3PF4 A;  3TS0 A;  1N33 Q;  2GN5 A;  3S14 H;  3KYU A;  1Z92 B;  3CQZ H;  2HIV A;  5K2M E;  5MGN A;  1OXX K;  3K8A A;  2JK8 A;  3D31 A;  1X3E A;  3ULL A;  1Y1W H;  4A3D G;  2K5V A;  4A4I A;  2JI2 A;  2LSS A;  5JEA G;  2VQE L;  1X3G A;  3Q8D A;  1JB7 A;  4Y7N H;  5ELO A;  1VZI A;  4ME3 A;  5FJ8 G;  1S2Z A;  1KL9 A;  4AYB G;  3AEV A;  3CC4 A;  4LFA Q;  3KDF A;  4BA1 I;  4GKJ L;  1IL2 A;  1C9O A;  1VQD A;  2K75 A;  2EIF A;  5MF6 A;  2KKD A;  3W1B A;  3CCJ A;  1GKH A;  3G71 A;  3JAM c;  2J9U B;  4JCV E;  1E8J A;  1EIY B;  2NN6 I;  4JI2 Q;  1IZ6 A;  2VNU D;  1PH1 A;  2JA5 H;  1LUZ A;  3I55 A;  4YWL A;  3U58 A;  1KXL A;  1C7Y A;  2MQH A;  2B63 H;  1X9N A;  1EUJ A;  1VQK A;  4DR5 L;  2VUM H;  1G51 A;  4HJ8 A;  4JAG A;  4QGU A;  3PCO B;  1I6H H;  5H1S E;  3I4N H;  3K80 C;  4AH6 A;  1WOC A;  2B63 G;  1J6Q A;  1FGU A;  2A1A A;  3F2B A;  4AI2 A;  4R4T A;  4IOA A;  1K9M C;  1YVC A;  5RXN A;  2ZJQ A;  4FDB A;  4UP7 A;  1R0F A;  4TQU S;  2K4K A;  3GTG H;  4NXM L;  1IW7 D;  4B3S Q;  4JYA Q;  4JI4 Q;  4C3H H;  3HKZ E;  2MO1 A;  2UXB Q;  4A3C G;  3GTM H;  2IX1 A;  3H3V I;  1YHB A;  3KYX A;  5M3M G;  1IRO A;  5IWA Q;  1BKB A;  1XMQ L;  3ICE A;  2JA8 G;  1AE2 A;  5HGQ A;  1L1O C;  3HOU H;  1B71 A;  1WFQ A;  1A62 A;  3JC6 3;  1LTL A;  4ZN1 B;  4HJA A;  4BBS G;  2K14 A;  2UXC L;  4JI8 Q;  4WJ4 A;  1VQ9 A;  3KJP A;  2RF4 A;  4LUV A;  1E22 A;  2BH8 A;  1NMF A;  1YJ9 A;  4DR6 L;  1VQ6 A;  1IBK Q;  1CAA A;  3CMA A;  4A3F H;  1Q8K A;  1FVI A;  2K2D A;  2XTI A;  5DM7 1;  3ER0 A;  4TPU A;  1ZRP A;  1VQM A;  3MEF A;  2LXK A;  1NMG A;  2I5H A;  1FJG Q;  5C4X G;  2CWP A;  1IBL L;  4JBM A;  1XNR Q;  4JV5 Q;  3BU2 A;  3M85 A;  1B8A A;  2XJS A;  1N33 L;  4HJ5 A;  1VQG A;  4OON A;  5GAG C;  4IPC A;  4C3J H;  2HIX A;  3MXN B;  2HQL A;  1N34 L;  4DUZ Q;  4K9F A;  1YK5 A;  2AYJ A;  2GVB A;  2VQF L;  2B3G A;  3I7F A;  1VQI A;  4RG1 A;  1PVO A;  4MNO A;  3HKS A;  2UXD Q;  3CCV A;  4LF6 Q;  3KDF B;  4GN5 A;  4APV A;  1UEB A;  4O0A A;  4LFA L;  2PI2 E;  1Y1V G;  4LNQ A;  3U50 C;  2CWA A;  2DGY A;  4HJ9 A;  1SE8 A;  1QCV A;  5IP9 G;  3PIO A;  2CKZ B;  3KOJ A;  2N49 A;  1SFO H;  2QGQ A;  2K52 A;  4P71 A;  4JC0 A;  5GAE c;  1VQC A;  3FHW A;  1DGS A;  1KQS A;  1OWB A;  2UU9 Q;  4OXP A;  1OXT A;  5C0X G;  4JAE A;  1XPU A;  3PKI A;  1HJP A;  3LGJ A;  1WYD A;  3T1Y L;  2KHI A;  4JI2 L;  3MPS A;  1WCM G;  1CAD A;  4A3M H;  4GN3 B;  3HOZ H;  1EFW A;  1RIP A;  1E1T A;  3CP0 A;  1HR0 L;  1R0I A;  1SRO A;  2YV5 A;  4DR4 Q;  1BBW A;  4PZ8 A;  4YHH Q;  2KN9 A;  3PO3 H;  4PZ7 A;  3SS2 A;  2R93 H;  2E5L Q;  3S15 H;  1HNW L;  2F3I A;  1I5F A;  3HOY H;  2IY5 B;  2JQO A;  4IJL A;  1VCX A;  4NB3 A;  5FLM H;  1PHJ A;  1YBY A;  2PYA A;  3S1R H;  4GKK L;  2XJQ A;  4MTN A;  2K5N A;  2R7Z G;  5IYD H;  4B3S L;  4O2D A;  1YZ6 A;  4JI4 L;  2UUC Q;  1X3F A;  3GTL H;  2UXB L;  3TEH B;  3PIP A;  4BY7 H;  1Q1B A;  3CCL A;  5MLC 3;  4JAF A;  1P16 A;  1VZG A;  2R6G A;  1R0J A;  4DV0 Q;  5IP7 H;  1XMO L;  1E3P A;  4AHW A;  4MZ9 A;  1QUQ B;  5ELN A;  4X6A H;  3BZC A;  1SMW A;  1K0R A;  3ERS X;  3I56 A;  3S17 H;  2V0F A;  1HNX L;  4DV6 L;  2I5M X;  3J7Z C;  4JBW A;  5GAD C;  1JJ2 A;  4A93 H;  2JA7 G;  1UE5 A;  4QIW E;  1PH9 A;  2NZH A;  3CPW A;  2NYD A;  3GDE A;  4IFD G;  1XPO A;  1UE6 A;  3PO2 H;  1MJC A;  2M6O A;  1UE7 A;  1T9Q A;  2WAQ G;  3RZD H;  4LF7 Q;  3NEM A;  2D62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...