4POFA

Pfmcm n-terminal domain without dna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
255
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
publication title A conserved MCM single-stranded DNA binding element is essential for replication initiation.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication, dna binding protein
total genus 60
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4pofA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4pofA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4pofA01
3H3VH 1QVCA 4POFA 4JI0Q 3IRBA 3BU2A 1PH3A 4L5RC 2K5VA 3Q8DA 2CWPA 2JJQA 2F4VQ 4BBSG 4J15A 1EYGA 3CCLA 1TWGH 3KYUA 3AQQA 1XJVA 4GLAC 3AYHB 5FLXc 3HOWH 4H02A 3HOUG 2QA4A 3OYYA 2LSSA 4GLVB 4IOCA 3VDYA 1N34Q 4JI2L 2EIFA 1K8AC 1BE7A 4PZ6A 2YU9H 3KFUA 1Y1WG 1N36Q 3NENA 4LNQA 4GKJL 4XTCS 2HHHQ 1MJCA 4TVAB 2VNUD 4A76A 1UE6A 4UPAA 5IP9H 1QZHA 4DR4L 5C4XG 5HGQA 5IT9c 3GTQH 1VQBA 3RLOA 2L15A 5C4JH 1JB7A 2E2IH 5FJ8H 1IXRA 4JOIA 1V43A 3PZAA 2BH8A 3M4QA 3TQYA 5M5WH 2ES2A 3HOYH 1LUZA 3CC7A 2CWAA 4A3IG 4JI4L 3S1NH 5GAHC 2CQOA 5M3MH 1LKOA 3S16H 5IYBH 2YYZA 4DR1Q 2F52A 1YJWA 3RZOH 2NVYH 5GAEC 4LF7L 3CQZH 4KLKA 3I4NH 1R0GA 4NXMQ 5JJIA 3CCEA 2JA5H 1E24A 3KF6B 3S2HH 1HNWL 3GTKH 1KC8C 2Z6KC 1PYBA 4P74A 4JI2Q 2BA1A 4GKJQ 4A3JG 1FVIA 2HR5A 1EWIA 5EAYA 1WOCA 2NVXH 3GTMH 4L5SA 3PO2H 1WCMG 4QQBX 1JJCB 4YY3L 5LMUQ 2LXKA 3H0GH 2AWNA 2PQAA 1VQ7A 3MPSA 1B2OA 2CKZB 1OXSC 2JK8A 3CAMA 3W1BA 4LF9Q 2N78A 2IX1A 4GOPA 3F1ZA 2XTIA 2ALYB 5LMNW 2MFIA 3F8TA 4L5TA 4LF7Q 2OTJA 4K0KL 5K36G 1R0HA 3J81i 1VCXA 1XMOQ 4B3TL 2JA7G 3GTGH 1HNWQ 2R7FA 4A3LH 3HOWG 3UDFA 4DPGA 2VQFQ 3T1YQ 4LFBL 2MO0A 4MNOA 3PCOB 4OX9L 1LKMA 2QEXA 4JI3L 4DV6L 2H5XA 4LF6L 1FGUA 1XPRA 1S24A 3CPWA 4L5QA 3A5ZB 2WB1E 2WB1G 4YY3Q 3UDGA 1NJIC 1IBKL 1KXLA 2UXDQ 4POGA 3CP0A 4LF5L 2ASBA 2PVXA 2KHJA 3M9BA 4JI7Q 3CC2A 1Q81C 2YV5A 1C0AA 4DV1L 2ZM6L 1QVGA 3JAMc 4LFCQ 3HOXG 3ICEA 1U5KA 1XNQL 4X65Q 4K0KQ 1T9OA 3RR5A 4YWKA 4B3TQ 4R4QA 4DKAC 1W3SA 4LFBQ 4BBSH 5ELNA 3W5OA 2K14A 3EN2A 3PUZA 5IP9G 4DV3Q 1HR0L 1EFWA 4JI3Q 4LF6Q 1L2FA 2I5HA 5FJ8G 4YCVA 2JA5G 4IJLA 1G51A 1IBKQ 4NXNL 4HJ5A 4P72A 1Y1WH 1IBML 1D8LA 3MXNB 3STBC 1YNXA 2IHEA 4OO1I 1YI2A 1G6PA 1J6QA 2NN6G 3PF5A 1UE7A 1VQAA 4IPHA 3KDFA 3U50C 2ZM6Q 4DV1Q 4WJ4A 1VQLA 1RYTA 2JEBI 1C9OA 1UWVA 3STBD 4A3IH 4AYBE 4KHPQ 3SS2A 2JQOA 1YHBA 4OWXB 4A3KG 1TXYA 3RZTA 1VQEA 3A0JA 4P71A 1XPOA 4IO9A 1XNRL 2WFWA 2UUBQ 4BA2I 3J80c 3PO3H 2ID0A 4DAMA 3AFQA 4P73A 5C0XI 4AQYL 1PH7A 2HQLA 4GS3A 2UXBQ 1E7ZA 4KHZA 1YITA 4DR5Q 4MZ9A 5JEAJ 4DV0Q 3CF5A 4JV5Q 2UUCQ 1AH9A 4RXNA 1NMGA 4JG2A 4X62L 1QVFA 2IHFA 4DV7Q 1VQIA 4UP8A 4IFDJ 3HKSA 1WCMH 3CCSA 1IL2A 2VZAA 1RDVA 3B6YA 3KYHC 4GN3B 1I94L 3ULLA 1OTCA 4LF4L 4GNXC 4IFDG 4X64L 4GLXA 1L0WA 1WJJA 2OQ0A 3GDEA 5C3EG 1PH4A 2K4KA 1PH1A 1EIYB 4ME3A 3MEFA 5JJKA 1CKNB 4Y52H 2JA7H 4UY8C 4A3FG 1N36L 1UE1A 2WP8J 3KYYA 2HHHL 3H3VI 5IE8A 2JA6H 2RCNA 1SMXA 4HJ9A 4X62Q 1LM0A 3FKIG 4JYAQ 3JC66 1RB9A 3LGJA 4ALPA 1OXTA 1X3EA 3JC63 5HY6A 3J7ZC 4DUYL 1DVBA 1CSPA 1GD7A 1GM5A 1GO3E 1KAWA 3KF6A 3W1GA 1X54A 1TWCH 4IJHA 4Y7NH 1ASYA 3KJOA 2RHSB 1I94Q 4C3JH 2K5NA 4DR1L 1SR3A 4LF4Q 2F3IA 3S1QH 1H7VA 1FL0A 2AMCB 3K7UC 4X64Q 3CXCA 4NXML 2R7ZH 4DNIA 4AH6A 1ZRPA 3HOXH 4LF8Q 2VW9A 3I4OA 3HFZB 3D31A 2D0OA 1D7QA 1VQCA 3OTOL 4R4IA 2ATWA 2NVTH 3I4MG 2V1CC 4DV4Q 4A3MG 1JYBA 4HIOA 4K9FA 1E8JA 2MO1A 4DUYQ 1BFYA 2B63H 3M3YH 1VQDA 5LMUL 4UP7A 1HNZQ 1UEBA 1B8AA 3CMAA 2DGYA 4LF9L 3K7AH 4AR5A 2JEAI 1A62A 4R1JA 3J81c 1LTLA 4JI5L 1Q82C 3F2DA 1VCIA 3PO3G 4HIKA 2N3SA 5M3FG 2D62A 3RN5A 1XMOL 1Z9FA 1KQSA 2HIVA 1RIPA 3KYXA 4JI1Q 2VQFL 1KL9A 1YEZA 4A4IA 4AIMA 2YTVA 4TPUA 3DM3A 3OW2A 3T1YL 4A3KH 1R0FA 2MNAA 1M1KC 3OTOQ 1T9PA 3PF4A 2QGQA 3RN2A 3UDXA 4O0AA 2LXJA 1BRFA 1HZBA 2UXDL 1VQHA 1Y14B 4LW1A 4JI7L 1HR0W 1SMUA 4IOAA 2MQHA 3KOJA 5M5YH 3QVDA 3NBHB 2A1AA 1SMMA 4JI5Q 5C0XJ 4LFCL 3U4VA 3UDIA 1FJGQ 1SE8A 1RWDA 1SRUA 3GTJH 1Q46A 4X65L 1VQ6A 1H95A 3CCQA 2NVQH 1VS0A 2I0QA 1EIFA 1KRTA 2GMGA 4DV2L 2JA6G 5ELOA 1B13A 1YK4A 2N8NA 3E0EA 3L7ZC 3BZKA 5H1SE 4DV3L 1FHMA 1MIUA 1Q12A 1KIXA 1VQGA 5IWAL 5C3EH 3GTPH 2BA0A 1K83H 4GNXB 4YHHL 4DK3C 4A3FH 2Q2UA 5IYCH 4PZ7A 1QCVA 3TS2A 3JC62 1A63A 2UXBL 4JV5L 1AE3A 3FKIH 4KI0A 3PUVA 7RXNA 3ER0A 1BQ9A 1NE3A 4QJFA 1MKHA 4DK6C 2N49A 4EX5A 3PUWA 3I55A 2E5LQ 3M4OH 5RXNA 3K0XA 4JI8Q 5GAGC 2R7ZG 4YWLA 1L1OC 4A3GG 1TWAH 1PVOA 1X9NA 1IZ6A 4EQ5A 1BVSA 2AHOB 4KHPL 2V3BB 1PH2A 3F2BA 1Z47A 1T9HA 4OONA 2RDVA 1CKOA 4DV2Q 2UUBL 1VQ9A 5FLMG 1GVPA 1TWFH 2Z6KA 4B3RL 1PHJA 1RDGA 1K3RA 1FHHA 5IWAQ 5E7NA 3RYGA 4DR5L 4R4TA 3CMEA 4DV0L 2B63G 2UXCL 2E2HH 4YHHQ 2UUCL 2PVEA 1XPUA 4LFAQ 3I56A 1S40A 2AWOA 1KHIA 2VS1A 4C3IH 2UUAQ 2A8VA 2HT1A 3GTLH 3I4MH 4DV7L 4A3MH 1WI5A 4PMWA 4JBKA 1AE2A 3RLNA 1YHAA 2ZJRA 1K8GA 1VQ4A 1VQKA 1K0RA 3GO5A 1VQJA 1CKNA 3GTOH 2JA8G 4A93H 1YJNA 1SMWA 1Y1VG 4AYBG 1ASZA 4A3BH 6RXNA 3K8AA 4GKKL 4HJAA 2D0PA 1R0IA 2PYAA 2PI2E 1PV4A 3PIOA 3L2PA 4B3RQ 1Q8KA 4LUZA 1C09A 3K81C 3PIPA 5M3FH 1PH6A 2GN5A 2OQKA 1KRSA 1S2ZA 2VL6A 2K5HA 2UXCQ 3KYVA 3RNUA 4DR7Q 1R0JA 1N8RC 1Q1BA 4JYAL 2KCTA 3CCMA 2RHQB 4NB3A 3AFPA 4BA1I 3CCVA 1QUQB 2WAQE 2XGTA 3U4ZA 3HOZH 4B3MQ 3PO2G 5JEAG 1B70B 3KJPA 1JT8A 2GVAA 2M4YA 1HJPA 3HKZE 3HKZG 3A44A 3CCJA 4O2DA 5M5XH 1V9PA 2JE6I 3HOVG 4GKKQ 2Q2IA 2CCZA 3D0FA 4OXPA 3S14H 4LF8L 2HIXA 1LYLA 2Y0SE 2Y0SG 1VQMA 1P16A 4B3SQ 1HNXQ 2KENA 5IYCG 4DUZL 4QIWE 4DR2L 2OCEA 4UP9A 1NY4A 5LMNQ 4DV4L 1S30A 3KYWA 4JOIC 2KBNA 1LKPA 2VY3A 4JC0A 1I5FA 2KN9A 4APVA 4JI6Q 4JBJA 4HJ8A 1N33Q 1HNZL 2Q2TA 1V1QA 1E3PA 3J81j 3GD7A 4A3EG 4LUOA 2E8GA 2CFMA 4LUVA 4YCUA 3A5UA 2ZJPA 4P75A 4BY7H 2PMZE 1JMCA 4A3GH 1VQOA 2K52A 4GN5A 3NELA 1YHQA 5IYDG 1EOVA 4JI1L 4OWWB 1GKHA 1L1OB 4HIMA 1IBLL 4DUZQ 3A74A 3J80i 5FLMH 5GADC 4DR2Q 4IPCA 4AR4A 1SN8A 3EIVA 1M90C 2MS3A 1WYDA 3RLFA 1YUXA 1PYSB 2NN6I 3E9HA 1YZ6A 4BBRG 3CD6A 4A3DG 4A93G 4R4OA 4A3BG 3G4SA 4QL5A 4GOPC 4DV5Q 3T1HL 2ZJQA 3PWFA 4IPGA 4A3CG 5JJLA 2LCQA 4IPDA 1FJGL 1N32Q 3PUXA 4GNXA 2IT1A 5J3BA 1EUJA 2JA8H 1S3OA 4OWTB 1Y1VH 3CCUA 2IX0A 1G291 4NPSA 2NZHA 1CKMA 2PNHA 1IBLQ 3U58A 1P8LA 4BXXG 2IY5B 2QL0A 1N9WA 3M4PA 3HOZG 1I50H 1QYBA 1X3FA 1PH5A 1NNQA 4X6AH 4RG1A 3RZ6A 5IP7H 4AR6A 5BR8L 4OO1G 2R6GA 2B3GA 3T1HQ 2E5LL 3J7A5 4JI8L 2K2DA 1Q1EA 2BH2A 3TREA 3TS0A 4IFDI 2VUMH 2C35B 4DAYB 1SROA 3I7FA 4HIDA 3HOVH 4C3HH 1PH8A 5C0XG 1CAAA 2R92G 1X56A 1E1OA 3FHWA 1X3GA 1EQRA 4DR4Q 3S15H 1I6HH 5GQOA 3AEVA 1X6OA 1X65A 3UE0A 4LFAL 1DGSA 1IU6A 2UUAL 1JE5A 3G71A 4JI4Q 5BR8Q 3L0OA 1O7IA 4TQUS 3SGIA 3F2CA 1YK5A 2ZTDA 5C44G 4BY7G 5AI3A 1Q86C 1HZCA 4FDBA 2R93G 2UU9L 4A75A 2KKDA 3I2ZA 2ZTCA 4A3EH 1K9MC 1XMQL 1HH2P 1JJGA 4X66L 2VQEL 1W2BA 1YUZA 2I5MX 1A8VA 1QUQA 1VQFA 1NMFA 1HZAA 1OXXK 3CCRA 1YIJA 1T9QA 3PV0A 3ERSX 4LWCA 4PZ8A 4HJ7A 3CC4A 2KHIA 5IYDH 4DR7L 3WWVA 1VQ8A 1TWHH 4BY1H 1BBWA 2R7DA 1B7YB 1OXVA 1SLJA 2K75A 5AJ3L 1B71A 3E9IA 2B29A 3PSIA 4PG3A 4R4CA 4B3ML 2EXDA 2NZOA 1IU5A 3G6EA 1IYJB 4A3DH 2Z0SA 3KLWA 4BBRH 1K73C 4JCVE 2UU9Q 1X55A 3ULPA 3BJUA 3DLLA 1XMQQ 3TRZA 2PQAB 3CW2C 3FP9A 4X66Q 4A3CH 2VQEQ 1VQ5A 1A0IA 1DX8A 1PH9A 4GOPB 3CPFA 4DV6Q 4B3SL 1IRNA 1HNXL 1RL2A 3HOUH 5AI2A 3UE1A 1CUKA 2A19A 3HOYG 4QY7A 1B2JA 5IP7G 1CADA 1E22A 5LMNL 3S24A 3M85A 5AJ3Q 4BXXH 5M3MG 1VQPA 4LF5Q 4XIGS 1YVCA 2DUDA 5IYBG 2AKWB 1J5EL 4JI6L 4JBMA 2WAQG 1N33L 2Q2HA 2VUMG 3I4NG 2GVBA 1IROA 1L1OA 5GROA 4C2MH 1JJ2A 1C7YA 2RF4A 1S72A 1EQQA 2DSXA 1XNQQ 1PA6A 1YJ9A 4WJ3M 3KF8B 5DLQE 1NBWA 3JAMi 4DR3L 1I3QH 1R9TH 4AR3A 1YBYA 1XTDA 4OX9Q 1HR0Q 3S1MH 2I5LX 2ZTEA 1CSQA 3H0GG 8RXNA 1BKBA 1UE5A 2YTXA 4A3JH 1SFOH 3G48A 4MTNA 1IBMQ 4NXNQ 1YV1A 1VQNA 1BQ8A 2R92H 4DR6L 2KCMA 1PFSA 3PUYA 1J5EQ 3ULJA 4YCWA 1WFQA 1OXUA 1BBUA 1U0LA 3NEMA 4GN4B 3PGZA 4RMFA 2EQSA 4QGUA 3S2DH 3H15A 4JI0L 2OWOA 2K50A 3BZCA 4DV5L 2JA9A 1HZ9A 4A3LG 1KD1C 3ZJYC 2F4VL 5C44H 1XNRQ 1N32L 2R93H 4JBWA 2PI2A 3K80C 4YWMA 5IY0A 1E1TA 4DR3Q 3M7NA 4AQYQ 3S17H 3KDFB 1N34L 1MJEA 2OTLA 1QZGA 4BY1G 5C4XH 3RZDH 2E2JH 3S1RH 1NTGA 3TEHB 1Q7YC 4DR6Q 2FXQA 3EBEA 2YTYA
chains in the Genus database with same CATH superfamily
3BYYB 1GJXA 1ENCA 2DJFC 3BU2A 4ME5A 5BN3A 3VR2A 1NXEA 2JJQA 4DA2A 2F4VQ 2EY4E 2F03A 4X6AH 1TWGH 1FGBD 1HFNA 2QA4A 3OYYA 4HSVA 2EIFA 3KFUA 1BE7A 1TR5A 2B8GA 5E4WC 3VYUA 1N36Q 2VNUD 2ENBA 5IP9H 3OIPA 3LWPB 2J9UB 3BYTB 5HGQA 3RLOA 5C4JH 4CHTB 1D2BA 5KNDA 1V43A 4EGVA 3PIO1 1R4QB 5IYBH 1NSNS 1PTOH 5KEEA 4DR1Q 5C3EL 3GTPL 3RZOH 2L1BA 4DF7A 1HA6A 5IYCL 3CCEA 1VMCA 2L55A 1I4GA 2Z6KC 2O4XA 4P74A 1KC8C 2VUMB 1AW7A 4CBVA 4EQPA 4A3JG 1KLGD 1FVIA 2WINB 4GKJQ 2NVQB 1F2ZA 3HKZB 3KLSX 1WOCA 2NVXH 4L5SA 3I8ZA 4QIWP 5LMUQ 3H0GH 2AWNA 2X6LA 3MPSA 1B2OA 4QF4A 2JK8A 2K33A 1TWFL 1PFBA 5J22A 2N78A 4CJ2C 2XVSA 4LF9Q 5KYIA 2XTIA 4AHXA 4QIWB 3NE5B 3O13A 4L5TA 1VCXA 2Q8RE 5HGTA 4B3TL 4A3LH 5C4XG 1SXTA 3T1YQ 5EIOC 2H5XA 1S24A 4L5QA 3A5ZB 3UDGA 4LF5L 3HG9A 3M9BA 2ASBA 2NYZD 4KY6A 1WD0A 4PNYA 5C3XA 5M3FL 4DV1L 5JVG1 1JQYD 3JAMc 3HOXG 1U5KA 1XNQL 2P5ZX 4X65Q 4K0KQ 3RR5A 1I6VC 1W3SA 4BBSH 3MXUA 5ELNA 3W5OA 4DV3Q 4JI3Q 4LF6Q 4CKBA 1LTSD 2FHTA 3H3VM 4YCVA 2SNMA 5FJ8G 5MFPA 4IJLA 2JA5G 1IBKQ 1Y1WH 4P72A 2XJUA 3STBC 2IHEA 1S4ZA 1G6PA 2NN6G 1UE7A 1VQAA 4IPHA 3MSUA 2ZXPA 5H1Sc 1K8MA 2JEBI 5EINC 2JA6L 1YHBA 4OWXB 4L8JA 4Y52H 1XNRL 4DK0A 4B9WA 3J7Z1 3PO3H 5EKKA 5C0XI 1BCPF 3GV3A 3J80L 2EJMA 1I3QB 3IFTA 4X62L 1E2ZA 2CH4A 1G91A 5EBCA 2IHFA 5IGBA 2A74C 4DV7Q 1WCMH 1KDCA 1A15A 1IL2A 1RDVA 2PZTA 2DY7A 1L0YB 4LF4L 3RD4A 2LS01 3WOFA 4GNXC 4M1UB 1L0WA 2B63L 1SYBA 3D4RA 2OQ0A 3TP8A 1PH4A 4ME3A 2EY1A 1CKNB 1SNOA 4A3FG 3HOWH 2F3WA 2HHHL 3I72A 3TMEA 1CT1D 2RCNA 5IE8A 4HJ9A 3FKIG 4O42A 1DVBA 4KJNA 1GM5A 3S1RB 4IJHA 1JWSD 1X3QA 1RTNA 4J8QA 5C6AA 4K5XA 4C3JH 2K5NA 2CR8A 2F3IA 1GUNA 1H7VA 4X64Q 3CXCA 3I90A 3K7UC 2QDBA 4DNIA 1EU4A 3FPUB 5FLXL 2VXWA 1WTWA 3K5NA 4KY7A 3OTOL 4R4IA 2AQCA 1KNEA 2NVTH 3I4MG 4DV4Q 5KYLA 4FXDA 2YU9B 3M3YH 2NVQL 2F0GA 1O7LA 1VQDA 1YNND 4TSSA 5IT9L 1HNZQ 1UEBA 2B2WA 1ENFA 4N8FA 2DGYA 4AR5A 2TMPA 3GTQB 3Q22A 4R1JA 3EVQA 2L5TA 3F2DA 1VCIA 5IODA 5M3MB 3H94A 3RN5A 4QMGA 2RCFA 4RFBA 2VQFL 5EPKA 4Z9CB 2F0KA 3DM3A 3IKJA 1R0FA 2F0NA 4CDFC 3PF4A 5JVH3 3RN2A 4KKTA 1HZBA 1EY5A 5EPLA 1Y14B 3JR7A 2XJVA 3GTMB 1SMUA 1FNVA 4WORA 3U4VA 1AZQA 1SE2A 1Q46A 1EIFA 2F0EA 4ZLTF 1YK4A 2N8NA 1WVLA 3ICEA 3BZKA 1EQVA 1Q12A 5C3EH 3VYSA 3GTPH 2BA0A 4DK3C 5NUCA 5IYCH 1V1PA 3J80E 3TS2A 3MAQA 4OGQC 4KI0A 3VR4A 2OT2A 1MKHA 4BY1B 3NSWA 3TN2A 4EX5A 3K0XA 4JI8Q 5GAGC 5D65A 4B08A 1X9NA 4KHPL 1LT3D 4OONA 2RDVA 1KAAA 4DV2Q 3HS0C 3SVMA 1TWFH 1RCVD 1Y8PB 1HHVA 1MD2D 4NP5A 4PMBA 4XYQA 2UUCL 3ITPA 1S40A 4C3IH 3HOUB 4JV5Q 4PMWA 1AE2A 2JYOA 3C1EA 3GO5A 2ZXOA 4AHWA 4IUUA 6RXNA 1PV4A 2PYAA 1SJHD 4DGZA 4A3IB 4WRDA 1C09A 5M3FH 3LWEA 3NWSA 2RBMA 3P1HA 1KRSA 2C6BA 1R0JA 1Q1BA 5FLXE 2PYKA 4NB3A 3EQLC 4B3MQ 4RAUC 3Q0AA 1JT8A 4FF3A 2M4YA 2SEBD 3A54A 5JPMC 3HKZE 5IT9E 3S1RL 3U9OA 3HOVG 4DNTB 2XWJB 1OWBA 2K03A 5CR3A 4TKOB 4IUTA 1P16A 4ILWA 4B3SQ 3A56A 4ABNA 2CW0C 2KENA 4RHRA 4DUZL 4QIWE 3E0JA 2DN8A 4ZYSA 5KGUA 5LMNQ 2JA7B 2AUSB 2F0VA 3J7YW 2KBNA 1LKPA 2WB1P 4APVA 1I5FA 2R61A 3NBIA 4KJOA 4HJ8A 1IKMA 3G6JB 1IHZA 2YU9L 2A73B 3J81j 2Z1CA 4LUOA 2E8GA 2CFMA 5AFWA 4LUVA 1XXGA 3A5UA 2ZJPA 2WB1B 2PMZE 3GTQL 1AEXA 1YHQA 5IYDG 1EOVA 4JI1L 1ZKOA 1GKHA 3DWPA 2R7ZB 5M3ML 3NBHA 1SN8A 4WFN1 3E9HA 4IUVA 3CD6A 4A93G 2A69D 4A3BG 3LWOB 4QL5A 1I4PA 1MSGA 1CFMA 3QB3A 4IPGA 1Q3LA 1FJGL 3J81L 3PUXA 3QO2A 2M6OA 2H1EA 2AQ3B 4HEDA 4NPSA 3Q23A 1CKMA 2EYJA 2IY5B 3DM1A 4A3KB 1QYBA 1H9KA 1NNQA 5A35A 4K5VA 4AR6A 5IGEA 2E5LL 2K2DA 3TS0A 2VUMH 5KIXA 4BY1L 4DAYB 3H9BA 3I7FA 1STAA 5M5YB 2RDFA 4X3TA 3PO2B 1PTOF 1PH8A 1IYUA 5C0XG 1CAAA 2Y0SP 1EQRA 1SYDA 2WIIB 3L9AX 4KD3A 3UE0A 1HQMC 3MZ5A 1JE5A 3G71A 1O7IA 1F4LA 1JB3A 1YK5A 1T5XD 3HOUL 3TDQA 2K1BA 2ZTCA 3I2ZA 4X66L 1W2BA 2EYOA 2I5MX 1HUMA 3CCRA 4A3IL 2R7DA 1SLJA 1B71A 4PG3A 2E2HB 4R4CA 3WWLA 1PFWA 1AFPA 3GP7A 1STNA 3KLWA 3GTLB 2ZT9C 3ULPA 2AQ1B 3LWRB 2RFKB 1WTRA 3URYA 1XMQQ 1BOSA 3TRZA 4GZYC 3NQIA 1PFNA 1PH9A 2FMCA 2Z3QB 1IL8A 1RL2A 1PFVA 2SOBA 2K7VA 3PO3B 3QJYA 4QY7A 3R93A 1CADA 1TKWB 4KKSA 1VQPA 4LF5Q 5IYBG 4G57A 2DY8A 2WAQG 3AMUA 2JA7L 4I7AA 5GROA 2B2VC 1C7YA 2RF4A 1P7PA 5ELFA 1XNQQ 4OO1H 1RJTA 2WACA 5DM61 3KF8B 4V196 1I3QH 4AR3A 2K32A 3J81E 2I5LX 3H0GG 8RXNA 1YV1A 1EY4A 1BQ8A 1VQNA 4ZKCB 2EJGC 1OXUA 1BQQT 1BBUA 2B2WC 3KBXA 2EQSA 4QUFA 2OWOA 4DV5L 4A3LG 5CV8A 1XNRQ 2K5DA 1E1TA 1SNMA 1ZXTA 1N34L 2OTLA 2NUCA 1QZGA 3MFGA 5D3DA 4A3GB 1EZ6A 3S1RH 1Q7YC 1NR2A 3DMUA 5EKIA 4FF4A 3H3VH 5CV4A 1EFID 4LHLA 1I4RA 2Z9HA 3W3AA 4A3KL 3IRBA 5AN9H 3MXPA 1PH3A 1JOOA 2Z8LA 3B08B 4JVZA 3Q8DA 1F9RA 4BBSG 1LT6D 3BVZA 3CCLA 3AQQA 5FLXc 3AYHB 2FJ2A 3VDYA 4H0LC 4IOCA 4JI2L 2YU9H 1Y1WG 1TS2A 3NENA 2JA8B 2HHHQ 5M5YL 2EYLA 1U4MA 3SK4A 1QZHA 1FYCA 4DR4L 3R2TA 5IT9c 2LFNA 3GTQH 1VQBA 1IXRA 4JOIA 1LUZA 5GAHC 2CQOA 5M3MH 1YJWA 2FMMA 3BZDB 4LF7L 3T56B 2XSCA 1PYBA 1D5ZC 1PRTD 1EWIA 3GV6A 3GTMH 4QQBX 1DOKA 1ENAA 1WCMG 4C3HB 1Q8IA 4NDXA 2PQAA 1VQ7A 3W1BA 1OXSC 3CAMA 4FXKC 1H9SA 4GOPA 4EQNA 4EQOA 1LTBD 2ALYB 3TP6A 5LMNW 2E2HL 3C3LA 3I3CA 1HNWQ 1RHPA 2R7FA 5E4XA 3HOWG 2VQFQ 4DPGA 4LFBL 4MNOA 4OX9L 3PKIA 3D4WA 4A3EB 1O7YA 2LKVA 3CPWA 2WB1E 1NJIC 4YY3Q 1C8CA 1KXLA 3CP0A 2AUJD 1KTKA 3PO3L 1Q81C 3NXWA 1SNDA 1C0AA 3H9CA 2ZM6L 4C3IB 1QVGA 2E2DC 1EEID 3J7Y1 4YWKA 1OO9B 3OW7A 2OXPA 4A3DB 4KY5A 3J7AF 2K14A 5DAUA 1H9RA 2C5CA 5JOBA 1G51A 4NXNL 5FOBB 5GAEc 1KDAA 1G6ZA 1D8LA 3LWUA 1YNXA 4OO1I 1DOLA 3KDFA 1O78A 1TS5A 2L9HA 4UY81 4A3IH 4KHPQ 2JQOA 2D9UA 1TXYA 1XPOA 4IO9A 4BA2I 1HPCA 4GS3A 1I4QA 4KHZA 1YITA 1R9TB 4C3JL 2UUCQ 2L0ZA 4RXNA 1NMGA 4JG2A 3S1MB 2BDNA 4A3GL 2F0MA 3HKSA 5CBEE 3OSOA 4A3JB 2ERJA 2R92B 2HVYC 5JVH1 3B6YA 1KDBA 1F2LA 5FLML 1A3UA 3ULLA 2A6EC 3R3OA 1I94L 1OTCA 3K59A 4H7BA 4GLXA 2X69A 1DXMA 1IYVA 1RYQA 3GDEA 5C3EG 5I4DA 5K36H 4C2M1 3V96A 2JA7H 3H3VI 3NPPA 1SMXA 1EYDA 1LM0A 4KD4A 3JC66 2F0QA 3JC63 1B2TA 1LT5D 5HY6A 4DUYL 2CW0D 5C4XB 2JA8L 3TSSA 2E2JB 3KF6A 4B9XA 2J0TD 3ZYYX 4CDCC 1ASYA 2MHVA 1SR3A 2NWGA 1FL0A 2AMCB 2R7ZH 1STYA 1EIHA 1UAPA 1CA5A 5IP7L 3A55A 2F0SA 2V4DA 3D31A 2ATWA 4ZN3B 2V1CC 3P2AA 2MO1A 4IUNA 4Q0FA 1B8AA 1PXUA 4C3HL 3PIP1 3J81c 2JA5B 1LTLA 1QE6A 2CVRA 1Q82C 1LTID 2CHBD 5M3FG 3S16B 1XMOL 1KQSA 1RIPA 4JPBW 5ELCA 4JI1Q 1KL9A 4A4IA 4A3KH 3I4NB 4HAEA 3S2HB 3GTKB 4AI2A 2PW5A 1RKNA 4O0AA 1BDOA 3W2DA 4DAVA 4A3EL 1BRFA 1UEAB 3LNLA 5BN4A 1B50A 4NMZA 3KOJA 5M5YH 3PO2H 1SMMA 4JI5Q 4LFCL 5JEAH 1FJGQ 2PW7A 4XQJA 2I0QA 4K8IA 2H12A 4C3IL 3MXNA 1F2MA 2JA6G 3SK5A 2HQEA 1O7ZA 3E0EA 1KIXA 1MIUA 1VQGA 4A3DL 3A8IE 3T4AC 4GNXB 4YHHL 2Q2UA 1EY6A 4PZ7A 3V05A 1U4PA 2UXBL 1AE3A 1PFYA 3PUVA 4DK6C 1NE3A 1H95A 2N49A 5LL6S 2E5LQ 1KNAA 3EA6A 2CQAA 1VDZA 3EJIA 4H44C 4EQ5A 3NUCA 1Z47A 4BXXL 4U673 2EY2A 1CKOA 1LTTD 4NW2A 4B3RL 2EY6A 2PPBC 5IWAQ 2B63G 4HR7B 4R4TA 2UXCL 2E2HH 1VZHA 2KA7A 2PVEA 2AWOA 2PQEA 3GTLH 1R9TL 3M4YA 1K8GA 1XTCD 1JWMD 1VQ4A 3S1ML 2HUGA 1VQJA 5G3LD 1SMWA 4AYBG 2C9OA 4HJAA 2PI2E 2R92L 1R0IA 1YNJC 1W6JA 4KK7A 3PIOA 2HCCA 4XDXA 1Q8KA 3L2PA 3PIPA 2VL6A 1EIGA 3FMCA 3N52A 3S9WA 2EYPA 2RHQB 1PRTB 3AFPA 4QB4A 2F0PA 2HDLA 1HTLD 3NQTA 3HKZG 2E2JL 3ND9A 3A44A 1EL0A 3CCJA 4O2DA 4GKKQ 3FDTA 2Q2IA 1SNPA 3D0FA 2HD3A 1MHWC 2HIXA 3PL5A 5DM73 1VQMA 1II3A 2OCEA 2KJXA 3SE0A 1C48A 1ET9A 1PRTF 3KYWA 4JOIC 5MFZA 2KN9A 4K8JA 2QKIC 1V1QA 1E3PA 1K3BC 4X3KA 3HJWB 1CK1A 2B2VA 4YCUA 1TWCB 4P75A 4Y7NB 4RGOS 4G7HC 1JMCA 4A3GH 5FJ8L 2XJPA 2JA5L 3NELA 1NCVA 3R2IA 4HIMA 1LACA 1IBLL 2KEDA 3A74A 5FLMH 4DR2Q 4IPCA 4AR4A 2VUML 3I4NL 1WYDA 4U68A 1YZ6A 3GTKL 1K8OA 1MGSA 4ZK9B 1BCPC 4FF2A 4GOPC 4DV5Q 3T1HL 3A7AB 5JJLA 2D2CC 2DNEA 2QILA 2V0FA 3K7AB 1HFGA 1PFUA 1EUJA 5J3BA 2JA8H 2EYHA 3A7LA 4EVOA 2IX0A 3CCUA 5FO8B 1ZEQX 1G291 1DZ1A 3D8GA 3U58A 2QL0A 2J7ZA 1N9WA 3ERQA 3M4PA 3HOZG 1I50H 5FO7B 1PH5A 1AZPA 1F77A 1UNSA 5IP7H 3T16A 4LAAA 4OO1G 3J7A5 2RSNA 1ESRA 2L0CA 2BH2A 3BDOA 1HQRD 2F3VA 4RCOA 4C3HH 3GTJB 4UHVA 1K0SA 1X56A 2IX3A 4DR4Q 2PSMC 4F88A 1GOZA 1AN8A 1X65A 3K5MA 2QCPX 1Y69U 1WTOA 4LFAL 1STGA 1IU6A 2UUAL 4IALA 4R8NA 4BWGB 1K83B 5BR8Q 3L0OA 1Y8OB 1TS4A 4TQUS 4BY7G 2XJTA 3MXGA 4G7OC 2IWHA 2O2LD 2JN4A 3M4OB 2K28A 4A3EH 1K9MC 1A3VA 1TWAB 2VQEL 1QUQA 4TRDA 3TP7A 1HZAA 1J9OA 1JE4A 3PV0A 2QW7A 2ICEC 4DR7L 1VQ8A 2E74C 1UUPA 4KN7C 5AJ3L 3T53B 1I3QL 2B29A 3PSIA 3U9SA 4HMJA 5FKAC 2I46A 4OIJA 2NZOA 4IN3A 1IU5A 3G6EA 2WV6D 1IYJB 4A3DH 2LMCB 2UU9Q 2K05A 4JCVE 3P20A 4A3MB 4E6YA 1BXTA 3DLLA 1Q90A 3FP9A 1VQ5A 4A93B 1A0IA 4A3BB 1RF2D 1S5CD 3CPFA 1BNZA 1IRNA 1HNXL 5AI2A 1CUKA 2A19A 1PZKD 2F0UA 5E1FA 4BXXH 3M85A 5I9PA 5M3MG 2DUDA 2AKWB 2V0EA 1N33L 3LNNA 1C4QA 3OIQA 1L1OA 1JJ2A 1EQQA 1S72A 1PA6A 1T5EA 1ODHA 4DXGA 1NBWA 2KCNA 3JAMi 4DR3L 1R9TH 1YBYA 3VYTA 2QDLA 2HDMA 4MHEA 5M5XB 1VF7A 3S1MH 1TWCL 1CZWA 2L4NA 2ZTEA 4H13C 3S14B 1UE5A 1O80A 2YTXA 4A3JH 3G48A 4NXNQ 2R92H 1LV9A 2KCMA 1PFSA 3PUYA 1J5EQ 2G9DA 4YCWA 1WFQA 3E3XA 1GUGA 5C4HA 2WKCA 4XT3B 2F4VL 4JBWA 2PI2A 2IW3A 2A6ED 3EROA 1MJEA 4BY1G 3K7AL 5C4XH 1V1OA 3SK6A 2E2JH 3MVVA 4XXBB 3B0AB 1ICWA 1NTGA 4DR6Q 2FXQA 5LL6X 2YTYA 1QVCA 3K6OA 3PKJA 2EVBA 3IU3I 2RKSA 4POFA 3QWNA 4JI0Q 1SYEA 3Q24A 3GTML 2OEOA 3KYUA 4AHZA 4H02A 3HOUG 1L0XB 1K8AC 3ONAB 4GKJL 2FINB 2G9HD 4TVAB 1Y1VB 4UPAA 3GTJL 2L15A 4CKEA 1JB7A 5FJ8H 2JA5H 2A68C 3PZAA 2BH8A 3C1FA 3NK9A 3TQYA 2ES2A 1QNKA 4A3IG 3P8BA 2WAQP 3S16H 1PMRA 2F52A 2PZUA 1JOQA 3P75A 3I4NH 1K83L 4KLKA 1R0GA 1JC7A 3R8BA 4RA8A 3QIAA 1E24A 5G3LF 5IIFA 3S2HH 2WAQB 3GTKH 1DONA 4XXEA 3M4OL 2L11A 5C3WA 2HR5A 1BO0A 1MI2A 1WTVA 1DD2A 1S5BD 1EY8A 4RWSC 2Z4HA 4B8CD 2X6GA 2LXKA 1F2YA 2CKAA 2CKZB 4V0BA 2Y0SB 3S15B 1NXGA 2IX1A 1Y8NB 3F1ZA 3FDJA 2F0LA 3AB9A 3PMFA 2MFIA 3F8TA 1SNQA 4K0KL 5K36G 1R0HA 2H4OA 2XJRA 1XMOQ 2JA7G 4A3ML 2MO0A 4RH6A 3PCOB 1LKMA 3BDLA 4JI3L 4LF6L 3PQIA 4A3BL 1IBKL 3HJYB 2WB1G 4POGA 2KHJA 3CC2A 1TWHB 4HN7A 5T1GA 4LFCQ 5L37A 4G7ZC 4XT1B 2B8FA 3EFXD 3TZDA 1T9OA 3I91A 1GUTA 4B3TQ 4DKAC 4BS9A 4BBRB 5IP9G 3EN2A 4JAFA 1HR0L 2QEJC 3VR5A 1RTOA 2I5HA 2XWBB 4RGMA 1SJED 2A6HC 4HJ5A 3NTKA 2I07B 5KRUA 3S14L 1PTOC 1YI2A 3BG3A 1JR0D 1J6QA 3PF5A 4WJ4A 4DV1Q 3STBD 2WKDA 1C9OA 3DEPA 3SS2A 4ZRZA 2E75C 4F87A 1V1PB 4A3KG 3RZTA 4P71A 1H9MA 5TSSA 3J80c 2ID0A 3AFQA 1PH7A 4JW0A 4MZ9A 5JEAJ 3CF5A 1S5DD 1AH9A 4ZAIA 1QVFA 1GUSA 2R7ZL 4UP8A 4ZUIA 1SFOB 1WD1A 2KOLA 3G7LA 4JK1C 3S2DB 5MF6A 4X64L 1TY2A 1WJJA 2DJGC 1QOHA 1GXDC 5JJKA 1EIYB 5FO9B 5C44B 2R93B 3KYYA 1S5FD 1DM0B 1LLRD 1PYWD 4X62Q 1RB9A 4ALPA 1X3EA 5F2DA 3J7ZC 1CSPA 1GD7A 3QQCE 3RZDB 1IW7C 1Y1VL 3W1GA 1X54A 1TWCH 4Y7NH 3OPOA 4LF4Q 2IPKD 4DAPA 1RODA 4NXML 4AH6A 4DNRB 1BBXC 3I4OA 1SMYC 1TU2B 2D0OA 3LPEB 3D6WA 5LHY1 4DU9A 3PO2L 1GHKA 1JCKB 4HIOA 1BFYA 4F7XA 4UAIA 4UP7A 4I65A 1I50B 2IL8A 3DHQA 3K7AH 1A62A 2JEAI 2E2IB 5IGFA 4KTAA 4YIJA 5K5PA 3CRLC 5M5WB 3HOYB 3S15L 1BF4A 3PO3G 3S1NB 1BCPD 2TSSA 4HIKA 2N3SA 2M6PA 2D62A 2EOTA 4PMCA 2HIVA 4RKBA 4CGYB 3KYXA 1YEZA 2NVYB 1K28A 3OW2A 3CQZB 1M1KC 5EGTA 3OTOQ 5MLC3 1U9RA 2R3ZA 2SNSA 2LXJA 1Z92B 2UXDL 4AI0A 1VQHA 4JI7L 5I2YA 3C2PA 4G4KA 3KUPA 4IOAA 3NBHB 2O5JC 2A1AA 3P7JA 3UDIA 5E3FA 1RD9D 1TWHL 1SRUA 3GTJH 1VQ6A 1KRTA 3GTLL 4DV2L 4ULLA 4IFDH 1VF5C 1B13A 4N9TA 5H1SE 3GTGB 4BBRL 1U4LA 1K83H 1JWUD 3DWAA 3CHBD 3E5SA 4HMIA 1R4PB 5DM71 4A3CL 4JV5L 2JI3A 3ER0A 4C3JG 3I55A 3M4OH 3PUWA 5RXNA 4J1MA 5CYUA 1PVOA 4YWLA 1L1OC 2QF7A 1TWAH 4A3GG 1IZ6A 1LTRD 1BVSA 2AHOB 2V3BB 1PH2A 3FVQA 2UUBL 4K5WA 1CA6A 5D14A 1GVPA 4IURA 5FLMG 1VQ9A 4ZUJA 1PHJA 1K3RA 3IFDA 3RYGA 4DR5L 4DV0L 4UDUC 1XPUA 4TVMA 1V8QA 3K57A 1OWCA 4LFAQ 3I56A 2A8VA 2UUAQ 2HT1A 4A3MH 1WI5A 4JBKA 1EEFD 1JOKA 3RLNA 1YHAA 2EYMA 2XN9C 1K0RA 4IUPA 1CKNA 2JA8G 4A93H 2EE1A 1ASZA 4A3BH 1SFOL 2PZWA 2D0PA 1EU3A 1D5MC 1BR9A 4LUZA 3M7GA 2K5HA 4C1NI 4K6LA 5CV9A 4DR7Q 3RNUA 2M2LA 2ICIA 4JYAL 2F0DA 3CCMA 1PDQA 5C44L 4BA1I 2R93L 3MHBA 3CCVA 2WAQE 2XGTA 3U4ZA 2M4VA 1B70B 2MUYA 3KJPA 5CGKA 4L63B 1HJPA 5EQ0A 1SBBB 5M5XH 1QB5D 1V9PA 4C3HG 1PZXA 2CCZA 4MTKA 5M9OA 3S14H 4LF8L 4FXGC 1LYLA 2Y0SE 2BCOA 1HNXQ 3MC0B 3SXHA 5IYCG 4XQQA 4UP9A 1NY4A 5C0XH 2KEEA 1D1IA 2VY3A 4JC0A 4K2KA 1N33Q 1H9JA 3WDNA 2Q2TA 3ND8A 3KLSA 3GD7A 4A3EG 4KN4C 3H99A 1I50L 2E2IL 4GN5A 3VR3A 3HOYL 2XJQA 5M5WL 2JXMB 3KK7A 5IGCA 3S1NL 3S1QB 3HP3A 4DUZQ 3J80i 3QR8A 3HOXB 4GS7D 2AUKA 2NZ1D 4C3IG 2A69C 3EIVA 3CQZL 1YUXA 1RDPD 1PYSB 4A3DG 1EYCA 5CC4A 3QOJA 2B63B 1CZGA 2ZJQA 1B3QA 1A2UA 3K58A 3DXJC 2LCQA 4IPDA 4AYBP 3OOCA 4R8IA 1HUNA 1S3OA 4OWTB 1CM9A 1Y1VH 4WJWA 5BN5A 2AYJA 2PNHA 2RVLA 4BXXG 1P8LA 4AYBB 4FNFA 5DM63 3GTGL 5COYA 3TP5A 1LT4D 1B9MA 2R6GA 3RMHA 2K5WA 1Q1EA 2A68D 3WOEA 4IFDI 2C35B 1F9QA 3HKZP 3IL8A 2KQ3A 1WTHA 5EPJA 1STBA 2F0JA 4HCSA 2R92G 1E1OA 2F0FA 4RHSA 3S15H 1LO5D 5GQOA 3AEVA 1X6OA 1ILPA 2GA4B 4F8MA 3V2TA 2VB2X 4FVMA 2O5IC 1WTPA 4X3UA 1U4RA 4A3FB 2NBFA 3SGIA 2ZTDA 5AI3A 1Q86C 3HEJA 2B2UA 2F0HA 3FKIB 2KKDA 4A75A 3UI2A 2L12A 3MQKB 2F0TA 1JJGA 1SYFA 5CV7A 1XMQL 2PMZP 1A8VA 2EXZA 1NMFA 1YIJA 1T9QA 4LHNA 4DFAA 1D7QA 1NR4A 2BOSA 3F2UA 4RCNA 1CI3M 1TQOA 1TWHH 4ODGA 2PMZB 1W6KA 1OXVA 3MFYA 1M8AA 1ML0D 3E9IA 4QUCA 1SEBD 2B2YA 3D6CA 2M9VA 4BBRH 1ZYRC 3VA7A 3I4MB 3K35A 4OHJA 4A3JL 2PQAB 3CW2C 3NWTA 4X66Q 3GTOB 4A3CH 1I4XA 1BCPB 1H9SB 4GOPB 1WTQA 1SSOA 1E22A 3S24A 1CHPD 3I4LA 1YVCA 4KV6A 4JI6L 4JBMA 2A6HD 5I2XA 4LMQD 5MGNA 5ELEA 2VUMG 3I4NG 1TIID 2GVBA 1IROA 5C4XL 5CBAE 3VPBE 1PTOD 4DK1A 3HOZB 1Z7TA 2EDGA 1YJ9A 1QG7A 3BS1A 4WJ3M 5DLQE 3SDZA 1XTDA 1HR0Q 1NNXA 4FF1A 4CKCA 2F4IA 1F9SA 1EZ8A 4KMUC 1SFOH 3OMGA 3S1QL 5T1IA 2EPBA 1LABA 3ULJA 3HOXL 3NEMA 3S2DH 3PGZA 4RMFA 4QGUA 2K50A 3BZCA 2A5HA 4XQNA 4DXFA 2JA9A 1HZ9A 1KD1C 5JAVA 5C44H 1N32L 2R93H 4XGHA 4YWMA 2Z3RB 1IKLA 3K80C 1MBYA 3X3MA 1EWCA 3KDFB 4N9PA 3QG1A 4CJ1B 4BY7B 3S16L 3RZDH 2NTSA 5C5LA 1E2VA 4OEMB 1B4OA 3TEHB 1HA5A 1G2TA 5DNFA 2B2TA 3EBEA 4DAYA 5I9OA 3S2HL 4LJZC 5J1ZA 2F0WA 2E76C 4L5RC 2K5VA 1IW7D 2ERSA 2CWPA 1VMPA 2SDFA 4J15A 1EYGA 1XJVA 1B44D 4GLAC 3HGBA 2Z6BA 4GLVB 1LTAD 2LSSA 1N34Q 4PZ6A 1QCBD 3MWYW 4LNQA 4XTCS 5IOCA 1MJCA 4A76A 2IJ0A 1UE6A 1SMYD 1SE3A 1EY7A 2E2IH 2B39A 3M4QA 3HOYH 5M5WH 4K2LA 3CC7A 2CWAA 4JI4L 3S1NH 1LKOA 2N55A 2YYZA 2MPMA 2NVYH 5GAEC 3KBGA 1ESFA 3CQZH 5JJIA 4NXMQ 4A3FL 1PRTC 1SDFA 2MP1A 3KF6B 1HNWL 3FKIL 4JI2Q 2BA1A 2FFKB 4HSPA 1CTMA 5EAYA 1NUCA 3HOVB 2G5DA 1JJCB 4YY3L 3RUZA 1XX8A 3SR1A 3NFPI 2K01A 1I6HB 3WWNB 5GADc 4LF7Q 2BDOA 2OTJA 3J81i 1B9NA 3GTGH 2O5JD 2J4XA 4V190 3I4ML 3UDFA 2KCCA 1E0BA 3KLRA 4KHVA 2QEXA 4DV6L 1FGUA 1XPRA 3GTOL 3H3VC 2RA4A 1DJRD 1B3AA 2UXDQ 1QILA 2Q8TA 3KF8A 2PVXA 4JI7Q 5HURA 2YV5A 1ET6A 4R4QA 2BE5C 3BVGA 4LFBQ 3MTSA 3HOZL 2KVMA 5FK9C 1EFWA 4OX9Q 3PUZA 3PIO3 5EJWA 5GAHc 1L2FA 3PIP3 1D1KA 1IBML 1PFMA 3MXNB 5C4ZA 3U50C 2ZM6Q 1VQLA 1RYTA 1UWVA 4AYBE 2AQ2B 4KKUA 2M00A 1DYQA 1VQEA 3A0JA 2JI1A 1FD7D 2WFWA 1TS3A 3BVMA 2UUBQ 4C2MB 1A6XA 4DAMA 4P73A 4AQYL 4J6HA 2HQLA 4Y7NL 1E7ZA 4AI3A 4ZKBB 5JPNC 5J39A 5A2QL 4DR5Q 4DV0Q 4BY7L 1B53A 1VQIA 4IFDJ 3CCSA 2VZAA 3KYHC 4GN3B 4IQZA 4C56C 1VZGA 4IFDG 2F0IA 5K2ME 2K4KA 1PH1A 3MEFA 3NHHA 4UY8C 1N36L 1UE1A 2WP8J 4FO2A 4MN3A 2JA6H 5JVG3 2JP1A 4JYAQ 3S17B 1STEA 3LGJA 1OXTA 1A2TA 2B5ID 1GO3E 1KAWA 5KNBA 1QQTA 3KJOA 1B1ZA 2RHSB 1I94Q 4XYOA 4DR1L 5D3IB 3TBIB 4C1NK 4ZCKA 3NTHA 4FP5D 3S1QH 4S3SA 1VZIA 3HOXH 1ZRPA 4LF8Q 4CJ0B 1X3PA 3CU7A 2VW9A 3HFZB 1TWGB 2LY7A 1VQCA 3DEOA 4A3MG 1JYBA 1M4VA 5IGDA 4K9FA 1E8JA 1G2SA 4DUYQ 2B63H 3H6MA 5LMUL 4IZ8A 5CV5A 3HOVL 3CMAA 2XRQD 4LF9L 5CMDA 3DUZA 5C4JB 2B2UC 4JI5L 2NN6H 3K5LA 1I6HL 1ICFB 1KABA 3X3NA 1Z9FA 1PTOB 3RZOB 3T1YL 4AIMA 3VYRA 2YTVA 4TPUA 4DN4M 2MNAA 1T9PA 2QGQA 1TWAL 1G8ZD 3UDXA 1SYCA 3A8KE 4LW1A 2B2YC 1HR0W 2NVXB 2MJ8A 2MQHA 1ONLA 3QVDA 2KECA 3H0GB 5C0XJ 5IYDL 1SE8A 1RWDA 4X65L 3CCQA 2NVQH 2RDHA 1VS0A 2GMGA 1TY0A 5ELOA 4MIUA 3L7ZC 4DV3L 4K6DA 1FHMA 1ILQA 4RGNA 5IWAL 2PPTA 4A93L 2D5DA 2K04A 2OF1A 5ELBA 1HTPA 4A3FH 5A2QE 1QCVA 1FR3A 3JC62 1A63A 3FKIH 7RXNA 2NYDA 1BQ9A 3K5OA 4QJFA 2R7ZG 3MA2B 2XJSA 5CORA 5KNCA 3F2BA 3JAML 1T9HA 3CRKC 2Z6KA 2JI2A 1RDGA 1FHHA 5E7NA 4N8X1 1JORA 3CMEA 4BBSB 4YHHQ 5M5XL 1NAPA 1WJVA 1KHIA 2VS1A 4JADA 2UXBQ 3I4MH 2CH4W 4DV7L 1J8IA 2KHSA 2ZJRA 1Y1WB 3TZUA 3D4DA 1VQKA 1STHA 3GTOH 1EOTA 1YJNA 3T51B 2CKCA 3HAXC 1Y1VG 3BDCA 3VR6A 3K8AA 4GKKL 4CDDC 1SE4A 1ZYRD 4B3RQ 1HCZA 3K81C 1PH6A 2GN5A 2OQKA 1TT2A 1S2ZA 5JJZA 1YNJD 2UXCQ 3KYVA 5EKLA 2JSOA 4ZQ3A 1N8RC 5DEHA 2KCTA 2B2TC 4HCEA 1QNUA 1QUQB 3HOZH 3PO2G 3S17L 5JEAG 4O1NA 2PCFB 2GVAA 1D5XC 1CHQD 1WCMB 2F1MA 2JE6I 4OELB 3E6ZX 4OXPA 4AHYA 2Y0SG 1SNCA 4QCLA 1Z6HA 1LTGD 4PV1C 3SEBA 4L6TB 3I73A 4DR2L 4R9WA 4P2CB 4DV4L 4FYDA 2XIWA 4X6AL 2VB3X 1TWGL 1S30A 4JI6Q 3HOWB 5I6YA 3AU7A 4JBJA 1HNZL 1MSHA 3FPPA 1EY9A 5IP9L 1TVXA 3H91A 4PQXA 3IAYA 1EY0A 4BY7H 5C4JL 5CV6A 1VQOA 2K52A 4C3JB 4OWWB 2Z4IA 1L1OB 1YNNC 5IYBL 2RQXA 5GADC 2K5QA 4G6BA 4U671 3RZOL 1M90C 2MS3A 3RLFA 5ISRA 2NN6I 2NVTB 4BBRG 3H97A 3D3RA 1F9PA 4ID6A 4R4OA 3G4SA 3M3YB 3PWFA 4A3CG 4OL7A 2NVXL 2XRSD 1N32Q 3A8JE 4GNXA 2IT1A 3HZXA 3H0GL 3MEHA 3Q6SA 2NZHA 4AI1A 3JAME 1IBLQ 3OHXC 1X3FA 4RG1A 3RZ6A 4A3LL 4Q5VA 1QJOA 3J7AV 5BR8L 3T1HQ 2B3GA 4JI8L 2MGSA 2NB0A 3TREA 3HRZC 4LK1C 1BUVT 1XWEA 1SROA 1GUWA 3LWVB 4HIDA 3HOVH 1HRJA 1I4HA 1EYAA 3FHWA 1X3GA 1DOMA 1I6HH 3QOLA 4NKLA 4JAGA 4ZN1B 2NTTA 2XNAC 1DGSA 3I70A 5C3EB 3GTPB 2Q8IB 4JI4Q 4BBSL 4OIKA 2K6AA 3CKIB 1GHJA 3F2CA 5C44G 2R93G 1HZCA 2RSOA 4FDBA 2UU9L 1EQTA 1Y1WL 1KLUD 1PZID 1HH2P 4WFN3 1YUZA 1VQFA 1OXXK 1X32A 1XYIA 4LWCA 4HJ7A 3ERSX 4PZ8A 3CC4A 2PO4A 2KHIA 5IYDH 2APOB 2F0OA 1FNUA 1TWFB 2ZXRA 3WWVA 4BY1H 1BBWA 1FNWA 1B7YB 4Y52L 2K75A 2EYFA 4B3ML 2EXDA 3SHLA 1DCZA 1S5ED 2Z0SA 1K73C 1X55A 1GUOA 3BJUA 3N6RA 2ZIXA 2VQEQ 4JAEA 3GQBA 1DX8A 1WCML 5ELDA 4CDEC 3S2DL 4DV6Q 4B3SL 3HOUH 2BE5D 3UE1A 3HOYG 3NTIA 1B2JA 5IP7G 5EBDA 5M3FB 3FEWX 5LMNL 5AJ3Q 4XIGS 1J5EL 1SYGA 2Q2HA 2PNRC 3DWQA 3HOWL 4X3SA 3RZDL 4C2MH 3C46A 1AP0A 2EZVA 2DSXA 4I7ZC 2N88A 5I6WA 1WTXA 1D6EC 3OWEB 3H09A 4E6IA 3FRPB 3NP8A 4K14A 4IUQA 1CSQA 5GAGc 1BKBA 1HXYD 3L3OC 4MTNA 1IBMQ 5IGGA 2EY5A 4DR6L 2DNCA 1JICA 2RDGA 2JA6B 1U0LA 3ZG6A 4HTHA 3LWQB 4GN4B 3H15A 4JI0L 1A3TA 2NVTL 4M8AA 3K0YA 1EWHA 3ZJYC 3OMCA 1PZJD 2C6AA 1CQVA 3VA5A 3SK8A 4DR3Q 3M3YL 5IY0A 1PLFA 1SAPA 3M7NA 2EJFC 4AQYQ 5C5MA 3S17H 1E2WA 3OWFA 4RKLA 4RGTA 3LX0A 2HCIA 2KUMA 3T13A 2NVYL 1CQFA 1QWYA
chains in the Genus database with same CATH topology
3BU2A 1NXEA 2JJQA 2F4VQ 4X6AH 1TWGH 2QA4A 3OYYA 2EIFA 3KFUA 1BE7A 1N36Q 2VNUD 5IP9H 2J9UB 5HGQA 3RLOA 5C4JH 1V43A 3PIO1 5IYBH 4DR1Q 3RZOH 3CCEA 1KC8C 2Z6KC 4P74A 4GKJQ 4A3JG 1FVIA 1WOCA 2NVXH 4L5SA 5LMUQ 3H0GH 2AWNA 3MPSA 1B2OA 2JK8A 4LF9Q 2N78A 2XTIA 4AHXA 4L5TA 1VCXA 4B3TL 4A3LH 5C4XG 3T1YQ 5EIOC 2H5XA 1S24A 4L5QA 3A5ZB 3UDGA 4LF5L 2ASBA 3M9BA 4DV1L 5JVG1 3JAMc 3HOXG 1U5KA 1XNQL 4X65Q 4K0KQ 3RR5A 1W3SA 4BBSH 5ELNA 3W5OA 4DV3Q 4JI3Q 4LF6Q 5FJ8G 4YCVA 2JA5G 5MFPA 4IJLA 1IBKQ 1Y1WH 4P72A 2XJUA 3STBC 2IHEA 1G6PA 2NN6G 1UE7A 1VQAA 4IPHA 3MSUA 5H1Sc 2JEBI 5EINC 1YHBA 4OWXB 4Y52H 1XNRL 3J7Z1 3PO3H 5C0XI 4X62L 2IHFA 4DV7Q 1WCMH 1IL2A 1RDVA 4LF4L 4GNXC 1L0WA 2OQ0A 1PH4A 4ME3A 1CKNB 4A3FG 3HOWH 2HHHL 5IE8A 2RCNA 4HJ9A 3FKIG 1DVBA 1GM5A 4IJHA 4C3JH 2K5NA 2CR8A 2F3IA 1H7VA 4X64Q 3CXCA 3K7UC 4DNIA 3OTOL 4R4IA 2NVTH 3I4MG 4DV4Q 3M3YH 1VQDA 1HNZQ 1UEBA 2DGYA 4AR5A 4R1JA 3F2DA 1VCIA 3RN5A 2VQFL 3DM3A 1R0FA 3PF4A 3RN2A 1HZBA 1Y14B 2XJVA 1SMUA 3U4VA 1Q46A 1EIFA 1YK4A 2N8NA 3ICEA 3BZKA 1Q12A 5C3EH 3GTPH 2BA0A 4DK3C 5IYCH 3TS2A 4KI0A 1MKHA 4EX5A 3K0XA 4JI8Q 5GAGC 1X9NA 4KHPL 4OONA 2RDVA 4DV2Q 1TWFH 2UUCL 1S40A 4C3IH 4JV5Q 4PMWA 1AE2A 3GO5A 4AHWA 6RXNA 1PV4A 2PYAA 1C09A 5M3FH 1KRSA 2C6BA 1R0JA 1Q1BA 4NB3A 4B3MQ 1JT8A 2M4YA 3HKZE 3HOVG 1OWBA 1P16A 4B3SQ 2KENA 4DUZL 4QIWE 5LMNQ 2KBNA 1LKPA 4APVA 1I5FA 4HJ8A 3J81j 4LUOA 2E8GA 2CFMA 4LUVA 3A5UA 2ZJPA 2PMZE 1YHQA 5IYDG 1EOVA 4JI1L 1GKHA 1SN8A 4WFN1 3E9HA 3CD6A 4A93G 2A69D 4A3BG 4QL5A 4IPGA 1FJGL 3PUXA 2M6OA 4NPSA 1CKMA 2IY5B 1QYBA 1NNQA 4AR6A 2E5LL 2K2DA 3TS0A 2VUMH 4DAYB 3I7FA 1PH8A 5C0XG 1CAAA 1EQRA 3UE0A 1JE5A 3G71A 1O7IA 1YK5A 3I2ZA 2ZTCA 4X66L 1W2BA 2I5MX 3CCRA 2R7DA 1SLJA 1B71A 4PG3A 4R4CA 3WWLA 3KLWA 3ULPA 1XMQQ 3TRZA 1PH9A 2Z3QB 1RL2A 4QY7A 1CADA 1VQPA 4LF5Q 5IYBG 2WAQG 5GROA 1C7YA 2RF4A 1XNQQ 5DM61 3KF8B 4V196 1I3QH 4AR3A 2I5LX 3H0GG 8RXNA 1YV1A 1VQNA 1BQ8A 1OXUA 1BBUA 2EQSA 2OWOA 4DV5L 4A3LG 1XNRQ 1E1TA 1N34L 2OTLA 1QZGA 3S1RH 1Q7YC 3H3VH 4LHLA 3IRBA 5AN9H 1PH3A 3B08B 3Q8DA 4BBSG 3CCLA 3AQQA 5FLXc 3AYHB 3VDYA 4IOCA 4JI2L 2YU9H 1Y1WG 3NENA 2HHHQ 1QZHA 4DR4L 5IT9c 3GTQH 1VQBA 1IXRA 4JOIA 1LUZA 5GAHC 2CQOA 5M3MH 1YJWA 4LF7L 1PYBA 1EWIA 3GTMH 4QQBX 1WCMG 2PQAA 1VQ7A 3W1BA 1OXSC 3CAMA 4GOPA 2ALYB 5LMNW 1HNWQ 2R7FA 3HOWG 2VQFQ 4DPGA 4LFBL 4MNOA 4OX9L 3PKIA 3CPWA 2WB1E 1NJIC 4YY3Q 1KXLA 3CP0A 1Q81C 1C0AA 2ZM6L 1QVGA 3J7Y1 4YWKA 2K14A 1G51A 4NXNL 5GAEc 1D8LA 1YNXA 4OO1I 3KDFA 4UY81 4A3IH 4KHPQ 2JQOA 1TXYA 1XPOA 4IO9A 4BA2I 4GS3A 4KHZA 1YITA 2UUCQ 2L0ZA 4RXNA 1NMGA 4JG2A 3HKSA 2ERJA 5JVH1 3B6YA 1I94L 3ULLA 1OTCA 4GLXA 1RYQA 3GDEA 5C3EG 2JA7H 3H3VI 1SMXA 1LM0A 3JC66 3JC63 5HY6A 4DUYL 3KF6A 1ASYA 1SR3A 1FL0A 2AMCB 2R7ZH 3D31A 2ATWA 4ZN3B 2V1CC 3P2AA 2MO1A 1B8AA 3PIP1 3J81c 1LTLA 1Q82C 5M3FG 1XMOL 1KQSA 1RIPA 4JI1Q 1KL9A 4A4IA 4A3KH 4AI2A 4O0AA 1BRFA 3LNLA 3KOJA 5M5YH 3PO2H 1SMMA 4JI5Q 4LFCL 1FJGQ 2I0QA 2H12A 2JA6G 3E0EA 1KIXA 1MIUA 1VQGA 4GNXB 4YHHL 2Q2UA 4PZ7A 2UXBL 1AE3A 3PUVA 4DK6C 1NE3A 1H95A 2N49A 2E5LQ 4EQ5A 1Z47A 1CKOA 4B3RL 5IWAQ 2B63G 4R4TA 2UXCL 2E2HH 1VZHA 2PVEA 2AWOA 3GTLH 1K8GA 1VQ4A 1VQJA 1SMWA 4AYBG 4HJAA 2PI2E 1R0IA 3PIOA 3L2PA 1Q8KA 3PIPA 2VL6A 2RHQB 3AFPA 3HKZG 3A44A 3CCJA 4O2DA 4GKKQ 2Q2IA 3D0FA 2HIXA 1VQMA 2OCEA 3KYWA 4JOIC 5MFZA 2KN9A 1V1QA 1E3PA 4YCUA 4P75A 1JMCA 4A3GH 2XJPA 3NELA 4HIMA 1IBLL 3A74A 5FLMH 4DR2Q 4IPCA 4AR4A 1WYDA 1YZ6A 4GOPC 4DV5Q 3T1HL 5JJLA 2V0FA 5J3BA 1EUJA 2JA8H 3CCUA 2IX0A 1G291 3U58A 2QL0A 1N9WA 3M4PA 3HOZG 1I50H 1PH5A 5IP7H 4OO1G 3J7A5 2BH2A 4C3HH 1X56A 4DR4Q 2PSMC 1X65A 4LFAL 1IU6A 2UUAL 5BR8Q 3L0OA 4TQUS 4BY7G 2XJTA 4A3EH 1K9MC 2VQEL 1QUQA 1HZAA 3PV0A 4DR7L 1VQ8A 5AJ3L 2B29A 3PSIA 2NZOA 1IU5A 3G6EA 1IYJB 4A3DH 2UU9Q 4JCVE 4E6YA 3DLLA 3FP9A 1VQ5A 1A0IA 3CPFA 1IRNA 1HNXL 5AI2A 1CUKA 2A19A 4BXXH 3M85A 5M3MG 2DUDA 2AKWB 2V0EA 1N33L 1L1OA 1JJ2A 1EQQA 1S72A 1PA6A 1ODHA 1NBWA 3JAMi 4DR3L 1R9TH 1YBYA 3S1MH 2ZTEA 1UE5A 2YTXA 4A3JH 4NXNQ 3G48A 2R92H 2KCMA 1PFSA 3PUYA 1J5EQ 4YCWA 1WFQA 2F4VL 4JBWA 2PI2A 2A6ED 1MJEA 4BY1G 5C4XH 2E2JH 4XXBB 3B0AB 1NTGA 4DR6Q 2FXQA 2YTYA 1QVCA 3PKJA 3IU3I 4POFA 4JI0Q 3KYUA 4AHZA 4H02A 3HOUG 1K8AC 4GKJL 4TVAB 4UPAA 2L15A 1JB7A 5FJ8H 2JA5H 3PZAA 2BH8A 3TQYA 2ES2A 4A3IG 3P8BA 3S16H 2F52A 3I4NH 4KLKA 1R0GA 1E24A 3S2HH 3GTKH 2HR5A 4B8CD 2LXKA 2CKAA 2CKZB 1NXGA 2IX1A 3F1ZA 2MFIA 3F8TA 4K0KL 5K36G 1R0HA 2XJRA 1XMOQ 2JA7G 2MO0A 3PCOB 1LKMA 4JI3L 4LF6L 1IBKL 2WB1G 4POGA 2KHJA 3CC2A 4LFCQ 1T9OA 4B3TQ 4DKAC 5IP9G 3EN2A 4JAFA 1HR0L 2I5HA 4HJ5A 1YI2A 1J6QA 3PF5A 4WJ4A 4DV1Q 3STBD 1C9OA 3SS2A 4A3KG 3RZTA 4P71A 3J80c 2ID0A 3AFQA 1PH7A 4MZ9A 5JEAJ 3CF5A 1AH9A 1QVFA 4UP8A 5MF6A 4X64L 1WJJA 5JJKA 1EIYB 3KYYA 4X62Q 1RB9A 4ALPA 1X3EA 3J7ZC 1CSPA 1GD7A 3QQCE 3W1GA 1X54A 1TWCH 4Y7NH 4LF4Q 4NXML 4AH6A 3I4OA 2D0OA 3LPEB 4HIOA 1BFYA 4UP7A 3K7AH 2JEAI 1A62A 3PO3G 4HIKA 2N3SA 2M6PA 2D62A 2HIVA 3KYXA 1YEZA 3OW2A 1M1KC 3OTOQ 5MLC3 2LXJA 1Z92B 2UXDL 4AI0A 1VQHA 4JI7L 4IOAA 3NBHB 2A1AA 3UDIA 1SRUA 3GTJH 1VQ6A 1KRTA 4DV2L 1B13A 5H1SE 1K83H 5DM71 4JV5L 2JI3A 3ER0A 3I55A 3M4OH 3PUWA 5RXNA 1PVOA 4YWLA 1L1OC 4A3GG 1TWAH 1IZ6A 1BVSA 2AHOB 2V3BB 1PH2A 2UUBL 1VQ9A 5FLMG 1GVPA 1PHJA 1K3RA 3RYGA 4DR5L 4DV0L 1XPUA 4TVMA 1OWCA 4LFAQ 2A8VA 3I56A 2UUAQ 2HT1A 4A3MH 1WI5A 4JBKA 3RLNA 1YHAA 1K0RA 1CKNA 2JA8G 4A93H 1ASZA 4A3BH 2D0PA 4LUZA 2K5HA 4DR7Q 3RNUA 4JYAL 3CCMA 4BA1I 3CCVA 2WAQE 2XGTA 3U4ZA 2M4VA 1B70B 3KJPA 1HJPA 5M5XH 1V9PA 2CCZA 3S14H 4LF8L 1LYLA 2Y0SE 1HNXQ 5IYCG 4UP9A 1NY4A 2VY3A 4JC0A 1N33Q 2Q2TA 3GD7A 4A3EG 4GN5A 2XJQA 4DUZQ 3J80i 4GS7D 3EIVA 1YUXA 1PYSB 4A3DG 2ZJQA 2LCQA 4IPDA 1S3OA 4OWTB 1Y1VH 2AYJA 2PNHA 4BXXG 1P8LA 2R6GA 1Q1EA 2A68D 4IFDI 2C35B 2R92G 1E1OA 3S15H 5GQOA 3AEVA 1X6OA 3SGIA 2ZTDA 5AI3A 1Q86C 4A75A 2KKDA 1JJGA 1XMQL 1A8VA 1NMFA 1YIJA 1T9QA 4LHNA 1D7QA 1TWHH 1OXVA 3E9IA 4BBRH 3K35A 2PQAB 3CW2C 4X66Q 4A3CH 4GOPB 1E22A 3S24A 1YVCA 4JI6L 4JBMA 2A6HD 5MGNA 2VUMG 3I4NG 2GVBA 1IROA 3VPBE 1YJ9A 4WJ3M 5DLQE 1XTDA 1HR0Q 1SFOH 3ULJA 3NEMA 3S2DH 3PGZA 4RMFA 4QGUA 2K50A 3BZCA 2JA9A 1HZ9A 1KD1C 5C44H 1N32L 2R93H 4XGHA 4YWMA 2Z3RB 3K80C 3KDFB 3RZDH 3TEHB 3EBEA 4L5RC 2K5VA 1IW7D 2ERSA 2CWPA 4J15A 1EYGA 1XJVA 4GLAC 4GLVB 2LSSA 1N34Q 4PZ6A 4LNQA 4XTCS 1MJCA 4A76A 1UE6A 2E2IH 3M4QA 3HOYH 5M5WH 3CC7A 2CWAA 4JI4L 3S1NH 1LKOA 2YYZA 2NVYH 5GAEC 3CQZH 5JJIA 4NXMQ 3KF6B 1HNWL 4JI2Q 2BA1A 5EAYA 1JJCB 4YY3L 3NFPI 3WWNB 5GADc 4LF7Q 2OTJA 3J81i 3GTGH 2O5JD 3UDFA 2QEXA 4DV6L 1FGUA 1XPRA 2UXDQ 2PVXA 4JI7Q 2YV5A 4R4QA 4LFBQ 1EFWA 4OX9Q 3PUZA 5GAHc 1L2FA 1IBML 3MXNB 3U50C 2ZM6Q 1VQLA 1RYTA 1UWVA 4AYBE 1VQEA 3A0JA 2JI1A 2WFWA 2UUBQ 4DAMA 4P73A 4AQYL 2HQLA 1E7ZA 4AI3A 4DR5Q 4DV0Q 1VQIA 4IFDJ 3CCSA 2VZAA 3KYHC 4GN3B 1VZGA 4IFDG 5K2ME 2K4KA 1PH1A 3MEFA 4UY8C 1N36L 1UE1A 2WP8J 2JA6H 4JYAQ 3LGJA 1OXTA 2B5ID 1GO3E 1KAWA 3KJOA 2RHSB 1I94Q 4DR1L 3S1QH 1VZIA 3HOXH 1ZRPA 4LF8Q 2VW9A 3HFZB 1VQCA 4A3MG 1JYBA 4K9FA 1E8JA 4DUYQ 2B63H 5LMUL 3CMAA 4LF9L 4JI5L 1Z9FA 3T1YL 4AIMA 2YTVA 4TPUA 2MNAA 1T9PA 2QGQA 3UDXA 4LW1A 1HR0W 2MQHA 3QVDA 5C0XJ 1SE8A 1RWDA 4X65L 3CCQA 2NVQH 1VS0A 2GMGA 5ELOA 3L7ZC 4DV3L 1FHMA 5IWAL 2PPTA 4A3FH 1QCVA 3JC62 1A63A 3FKIH 7RXNA 2NYDA 1BQ9A 4QJFA 2R7ZG 2XJSA 3F2BA 1T9HA 2Z6KA 2JI2A 1RDGA 1FHHA 5E7NA 3CMEA 4YHHQ 1WJVA 1KHIA 2VS1A 4JADA 2UXBQ 3I4MH 4DV7L 2ZJRA 1VQKA 3GTOH 1YJNA 2CKCA 1Y1VG 3K8AA 4GKKL 4B3RQ 3K81C 1PH6A 2GN5A 2OQKA 1S2ZA 2UXCQ 3KYVA 1N8RC 2KCTA 1QUQB 3HOZH 3PO2G 5JEAG 2GVAA 2JE6I 4OXPA 4AHYA 2Y0SG 4DR2L 4DV4L 1S30A 4JI6Q 4JBJA 1HNZL 4BY7H 1VQOA 2K52A 4OWWB 1L1OB 5GADC 4G6BA 4U671 1M90C 2MS3A 3RLFA 2NN6I 4BBRG 4R4OA 3G4SA 3PWFA 4A3CG 1N32Q 4GNXA 2IT1A 2NZHA 4AI1A 1IBLQ 1X3FA 4RG1A 3RZ6A 5BR8L 3T1HQ 2B3GA 4JI8L 3TREA 1SROA 4HIDA 3HOVH 3FHWA 1X3GA 1I6HH 4JAGA 4ZN1B 1DGSA 4JI4Q 3F2CA 5C44G 2R93G 1HZCA 4FDBA 2UU9L 1HH2P 1YUZA 1VQFA 1OXXK 4LWCA 4HJ7A 3ERSX 4PZ8A 3CC4A 2KHIA 5IYDH 3WWVA 4BY1H 1BBWA 1B7YB 2K75A 4B3ML 2EXDA 2Z0SA 1K73C 1X55A 3BJUA 2ZIXA 2VQEQ 4JAEA 1DX8A 4DV6Q 4B3SL 3HOUH 2BE5D 3UE1A 3HOYG 1B2JA 5IP7G 5LMNL 5AJ3Q 4XIGS 1J5EL 2Q2HA 4C2MH 2DSXA 1CSQA 5GAGc 1BKBA 4MTNA 1IBMQ 4DR6L 1U0LA 3ZG6A 4GN4B 3H15A 4JI0L 3ZJYC 2C6AA 4DR3Q 5IY0A 3M7NA 4AQYQ 3S17H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3V H;  1QVC A;  4POF A;  4JI0 Q;  3IRB A;  3BU2 A;  1PH3 A;  4L5R C;  2K5V A;  3Q8D A;  2CWP A;  2JJQ A;  2F4V Q;  4BBS G;  4J15 A;  1EYG A;  3CCL A;  1TWG H;  3KYU A;  3AQQ A;  1XJV A;  4GLA C;  3AYH B;  5FLX c;  3HOW H;  4H02 A;  3HOU G;  2QA4 A;  3OYY A;  2LSS A;  4GLV B;  4IOC A;  3VDY A;  1N34 Q;  4JI2 L;  2EIF A;  1K8A C;  1BE7 A;  4PZ6 A;  2YU9 H;  3KFU A;  1Y1W G;  1N36 Q;  3NEN A;  4LNQ A;  4GKJ L;  4XTC S;  2HHH Q;  1MJC A;  4TVA B;  2VNU D;  4A76 A;  1UE6 A;  4UPA A;  5IP9 H;  1QZH A;  4DR4 L;  5C4X G;  5HGQ A;  5IT9 c;  3GTQ H;  1VQB A;  3RLO A;  2L15 A;  5C4J H;  1JB7 A;  2E2I H;  5FJ8 H;  1IXR A;  4JOI A;  1V43 A;  3PZA A;  2BH8 A;  3M4Q A;  3TQY A;  5M5W H;  2ES2 A;  3HOY H;  1LUZ A;  3CC7 A;  2CWA A;  4A3I G;  4JI4 L;  3S1N H;  5GAH C;  2CQO A;  5M3M H;  1LKO A;  3S16 H;  5IYB H;  2YYZ A;  4DR1 Q;  2F52 A;  1YJW A;  3RZO H;  2NVY H;  5GAE C;  4LF7 L;  3CQZ H;  4KLK A;  3I4N H;  1R0G A;  4NXM Q;  5JJI A;  3CCE A;  2JA5 H;  1E24 A;  3KF6 B;  3S2H H;  1HNW L;  3GTK H;  1KC8 C;  2Z6K C;  1PYB A;  4P74 A;  4JI2 Q;  2BA1 A;  4GKJ Q;  4A3J G;  1FVI A;  2HR5 A;  1EWI A;  5EAY A;  1WOC A;  2NVX H;  3GTM H;  4L5S A;  3PO2 H;  1WCM G;  4QQB X;  1JJC B;  4YY3 L;  5LMU Q;  2LXK A;  3H0G H;  2AWN A;  2PQA A;  1VQ7 A;  3MPS A;  1B2O A;  2CKZ B;  1OXS C;  2JK8 A;  3CAM A;  3W1B A;  4LF9 Q;  2N78 A;  2IX1 A;  4GOP A;  3F1Z A;  2XTI A;  2ALY B;  5LMN W;  2MFI A;  3F8T A;  4L5T A;  4LF7 Q;  2OTJ A;  4K0K L;  5K36 G;  1R0H A;  3J81 i;  1VCX A;  1XMO Q;  4B3T L;  2JA7 G;  3GTG H;  1HNW Q;  2R7F A;  4A3L H;  3HOW G;  3UDF A;  4DPG A;  2VQF Q;  3T1Y Q;  4LFB L;  2MO0 A;  4MNO A;  3PCO B;  4OX9 L;  1LKM A;  2QEX A;  4JI3 L;  4DV6 L;  2H5X A;  4LF6 L;  1FGU A;  1XPR A;  1S24 A;  3CPW A;  4L5Q A;  3A5Z B;  2WB1 E;  2WB1 G;  4YY3 Q;  3UDG A;  1NJI C;  1IBK L;  1KXL A;  2UXD Q;  4POG A;  3CP0 A;  4LF5 L;  2ASB A;  2PVX A;  2KHJ A;  3M9B A;  4JI7 Q;  3CC2 A;  1Q81 C;  2YV5 A;  1C0A A;  4DV1 L;  2ZM6 L;  1QVG A;  3JAM c;  4LFC Q;  3HOX G;  3ICE A;  1U5K A;  1XNQ L;  4X65 Q;  4K0K Q;  1T9O A;  3RR5 A;  4YWK A;  4B3T Q;  4R4Q A;  4DKA C;  1W3S A;  4LFB Q;  4BBS H;  5ELN A;  3W5O A;  2K14 A;  3EN2 A;  3PUZ A;  5IP9 G;  4DV3 Q;  1HR0 L;  1EFW A;  4JI3 Q;  4LF6 Q;  1L2F A;  2I5H A;  5FJ8 G;  4YCV A;  2JA5 G;  4IJL A;  1G51 A;  1IBK Q;  4NXN L;  4HJ5 A;  4P72 A;  1Y1W H;  1IBM L;  1D8L A;  3MXN B;  3STB C;  1YNX A;  2IHE A;  4OO1 I;  1YI2 A;  1G6P A;  1J6Q A;  2NN6 G;  3PF5 A;  1UE7 A;  1VQA A;  4IPH A;  3KDF A;  3U50 C;  2ZM6 Q;  4DV1 Q;  4WJ4 A;  1VQL A;  1RYT A;  2JEB I;  1C9O A;  1UWV A;  3STB D;  4A3I H;  4AYB E;  4KHP Q;  3SS2 A;  2JQO A;  1YHB A;  4OWX B;  4A3K G;  1TXY A;  3RZT A;  1VQE A;  3A0J A;  4P71 A;  1XPO A;  4IO9 A;  1XNR L;  2WFW A;  2UUB Q;  4BA2 I;  3J80 c;  3PO3 H;  2ID0 A;  4DAM A;  3AFQ A;  4P73 A;  5C0X I;  4AQY L;  1PH7 A;  2HQL A;  4GS3 A;  2UXB Q;  1E7Z A;  4KHZ A;  1YIT A;  4DR5 Q;  4MZ9 A;  5JEA J;  4DV0 Q;  3CF5 A;  4JV5 Q;  2UUC Q;  1AH9 A;  4RXN A;  1NMG A;  4JG2 A;  4X62 L;  1QVF A;  2IHF A;  4DV7 Q;  1VQI A;  4UP8 A;  4IFD J;  3HKS A;  1WCM H;  3CCS A;  1IL2 A;  2VZA A;  1RDV A;  3B6Y A;  3KYH C;  4GN3 B;  1I94 L;  3ULL A;  1OTC A;  4LF4 L;  4GNX C;  4IFD G;  4X64 L;  4GLX A;  1L0W A;  1WJJ A;  2OQ0 A;  3GDE A;  5C3E G;  1PH4 A;  2K4K A;  1PH1 A;  1EIY B;  4ME3 A;  3MEF A;  5JJK A;  1CKN B;  4Y52 H;  2JA7 H;  4UY8 C;  4A3F G;  1N36 L;  1UE1 A;  2WP8 J;  3KYY A;  2HHH L;  3H3V I;  5IE8 A;  2JA6 H;  2RCN A;  1SMX A;  4HJ9 A;  4X62 Q;  1LM0 A;  3FKI G;  4JYA Q;  3JC6 6;  1RB9 A;  3LGJ A;  4ALP A;  1OXT A;  1X3E A;  3JC6 3;  5HY6 A;  3J7Z C;  4DUY L;  1DVB A;  1CSP A;  1GD7 A;  1GM5 A;  1GO3 E;  1KAW A;  3KF6 A;  3W1G A;  1X54 A;  1TWC H;  4IJH A;  4Y7N H;  1ASY A;  3KJO A;  2RHS B;  1I94 Q;  4C3J H;  2K5N A;  4DR1 L;  1SR3 A;  4LF4 Q;  2F3I A;  3S1Q H;  1H7V A;  1FL0 A;  2AMC B;  3K7U C;  4X64 Q;  3CXC A;  4NXM L;  2R7Z H;  4DNI A;  4AH6 A;  1ZRP A;  3HOX H;  4LF8 Q;  2VW9 A;  3I4O A;  3HFZ B;  3D31 A;  2D0O A;  1D7Q A;  1VQC A;  3OTO L;  4R4I A;  2ATW A;  2NVT H;  3I4M G;  2V1C C;  4DV4 Q;  4A3M G;  1JYB A;  4HIO A;  4K9F A;  1E8J A;  2MO1 A;  4DUY Q;  1BFY A;  2B63 H;  3M3Y H;  1VQD A;  5LMU L;  4UP7 A;  1HNZ Q;  1UEB A;  1B8A A;  3CMA A;  2DGY A;  4LF9 L;  3K7A H;  4AR5 A;  2JEA I;  1A62 A;  4R1J A;  3J81 c;  1LTL A;  4JI5 L;  1Q82 C;  3F2D A;  1VCI A;  3PO3 G;  4HIK A;  2N3S A;  5M3F G;  2D62 A;  3RN5 A;  1XMO L;  1Z9F A;  1KQS A;  2HIV A;  1RIP A;  3KYX A;  4JI1 Q;  2VQF L;  1KL9 A;  1YEZ A;  4A4I A;  4AIM A;  2YTV A;  4TPU A;  3DM3 A;  3OW2 A;  3T1Y L;  4A3K H;  1R0F A;  2MNA A;  1M1K C;  3OTO Q;  1T9P A;  3PF4 A;  2QGQ A;  3RN2 A;  3UDX A;  4O0A A;  2LXJ A;  1BRF A;  1HZB A;  2UXD L;  1VQH A;  1Y14 B;  4LW1 A;  4JI7 L;  1HR0 W;  1SMU A;  4IOA A;  2MQH A;  3KOJ A;  5M5Y H;  3QVD A;  3NBH B;  2A1A A;  1SMM A;  4JI5 Q;  5C0X J;  4LFC L;  3U4V A;  3UDI A;  1FJG Q;  1SE8 A;  1RWD A;  1SRU A;  3GTJ H;  1Q46 A;  4X65 L;  1VQ6 A;  1H95 A;  3CCQ A;  2NVQ H;  1VS0 A;  2I0Q A;  1EIF A;  1KRT A;  2GMG A;  4DV2 L;  2JA6 G;  5ELO A;  1B13 A;  1YK4 A;  2N8N A;  3E0E A;  3L7Z C;  3BZK A;  5H1S E;  4DV3 L;  1FHM A;  1MIU A;  1Q12 A;  1KIX A;  1VQG A;  5IWA L;  5C3E H;  3GTP H;  2BA0 A;  1K83 H;  4GNX B;  4YHH L;  4DK3 C;  4A3F H;  2Q2U A;  5IYC H;  4PZ7 A;  1QCV A;  3TS2 A;  3JC6 2;  1A63 A;  2UXB L;  4JV5 L;  1AE3 A;  3FKI H;  4KI0 A;  3PUV A;  7RXN A;  3ER0 A;  1BQ9 A;  1NE3 A;  4QJF A;  1MKH A;  4DK6 C;  2N49 A;  4EX5 A;  3PUW A;  3I55 A;  2E5L Q;  3M4O H;  5RXN A;  3K0X A;  4JI8 Q;  5GAG C;  2R7Z G;  4YWL A;  1L1O C;  4A3G G;  1TWA H;  1PVO A;  1X9N A;  1IZ6 A;  4EQ5 A;  1BVS A;  2AHO B;  4KHP L;  2V3B B;  1PH2 A;  3F2B A;  1Z47 A;  1T9H A;  4OON A;  2RDV A;  1CKO A;  4DV2 Q;  2UUB L;  1VQ9 A;  5FLM G;  1GVP A;  1TWF H;  2Z6K A;  4B3R L;  1PHJ A;  1RDG A;  1K3R A;  1FHH A;  5IWA Q;  5E7N A;  3RYG A;  4DR5 L;  4R4T A;  3CME A;  4DV0 L;  2B63 G;  2UXC L;  2E2H H;  4YHH Q;  2UUC L;  2PVE A;  1XPU A;  4LFA Q;  3I56 A;  1S40 A;  2AWO A;  1KHI A;  2VS1 A;  4C3I H;  2UUA Q;  2A8V A;  2HT1 A;  3GTL H;  3I4M H;  4DV7 L;  4A3M H;  1WI5 A;  4PMW A;  4JBK A;  1AE2 A;  3RLN A;  1YHA A;  2ZJR A;  1K8G A;  1VQ4 A;  1VQK A;  1K0R A;  3GO5 A;  1VQJ A;  1CKN A;  3GTO H;  2JA8 G;  4A93 H;  1YJN A;  1SMW A;  1Y1V G;  4AYB G;  1ASZ A;  4A3B H;  6RXN A;  3K8A A;  4GKK L;  4HJA A;  2D0P A;  1R0I A;  2PYA A;  2PI2 E;  1PV4 A;  3PIO A;  3L2P A;  4B3R Q;  1Q8K A;  4LUZ A;  1C09 A;  3K81 C;  3PIP A;  5M3F H;  1PH6 A;  2GN5 A;  2OQK A;  1KRS A;  1S2Z A;  2VL6 A;  2K5H A;  2UXC Q;  3KYV A;  3RNU A;  4DR7 Q;  1R0J A;  1N8R C;  1Q1B A;  4JYA L;  2KCT A;  3CCM A;  2RHQ B;  4NB3 A;  3AFP A;  4BA1 I;  3CCV A;  1QUQ B;  2WAQ E;  2XGT A;  3U4Z A;  3HOZ H;  4B3M Q;  3PO2 G;  5JEA G;  1B70 B;  3KJP A;  1JT8 A;  2GVA A;  2M4Y A;  1HJP A;  3HKZ E;  3HKZ G;  3A44 A;  3CCJ A;  4O2D A;  5M5X H;  1V9P A;  2JE6 I;  3HOV G;  4GKK Q;  2Q2I A;  2CCZ A;  3D0F A;  4OXP A;  3S14 H;  4LF8 L;  2HIX A;  1LYL A;  2Y0S E;  2Y0S G;  1VQM A;  1P16 A;  4B3S Q;  1HNX Q;  2KEN A;  5IYC G;  4DUZ L;  4QIW E;  4DR2 L;  2OCE A;  4UP9 A;  1NY4 A;  5LMN Q;  4DV4 L;  1S30 A;  3KYW A;  4JOI C;  2KBN A;  1LKP A;  2VY3 A;  4JC0 A;  1I5F A;  2KN9 A;  4APV A;  4JI6 Q;  4JBJ A;  4HJ8 A;  1N33 Q;  1HNZ L;  2Q2T A;  1V1Q A;  1E3P A;  3J81 j;  3GD7 A;  4A3E G;  4LUO A;  2E8G A;  2CFM A;  4LUV A;  4YCU A;  3A5U A;  2ZJP A;  4P75 A;  4BY7 H;  2PMZ E;  1JMC A;  4A3G H;  1VQO A;  2K52 A;  4GN5 A;  3NEL A;  1YHQ A;  5IYD G;  1EOV A;  4JI1 L;  4OWW B;  1GKH A;  1L1O B;  4HIM A;  1IBL L;  4DUZ Q;  3A74 A;  3J80 i;  5FLM H;  5GAD C;  4DR2 Q;  4IPC A;  4AR4 A;  1SN8 A;  3EIV A;  1M90 C;  2MS3 A;  1WYD A;  3RLF A;  1YUX A;  1PYS B;  2NN6 I;  3E9H A;  1YZ6 A;  4BBR G;  3CD6 A;  4A3D G;  4A93 G;  4R4O A;  4A3B G;  3G4S A;  4QL5 A;  4GOP C;  4DV5 Q;  3T1H L;  2ZJQ A;  3PWF A;  4IPG A;  4A3C G;  5JJL A;  2LCQ A;  4IPD A;  1FJG L;  1N32 Q;  3PUX A;  4GNX A;  2IT1 A;  5J3B A;  1EUJ A;  2JA8 H;  1S3O A;  4OWT B;  1Y1V H;  3CCU A;  2IX0 A;  1G29 1;  4NPS A;  2NZH A;  1CKM A;  2PNH A;  1IBL Q;  3U58 A;  1P8L A;  4BXX G;  2IY5 B;  2QL0 A;  1N9W A;  3M4P A;  3HOZ G;  1I50 H;  1QYB A;  1X3F A;  1PH5 A;  1NNQ A;  4X6A H;  4RG1 A;  3RZ6 A;  5IP7 H;  4AR6 A;  5BR8 L;  4OO1 G;  2R6G A;  2B3G A;  3T1H Q;  2E5L L;  3J7A 5;  4JI8 L;  2K2D A;  1Q1E A;  2BH2 A;  3TRE A;  3TS0 A;  4IFD I;  2VUM H;  2C35 B;  4DAY B;  1SRO A;  3I7F A;  4HID A;  3HOV H;  4C3H H;  1PH8 A;  5C0X G;  1CAA A;  2R92 G;  1X56 A;  1E1O A;  3FHW A;  1X3G A;  1EQR A;  4DR4 Q;  3S15 H;  1I6H H;  5GQO A;  3AEV A;  1X6O A;  1X65 A;  3UE0 A;  4LFA L;  1DGS A;  1IU6 A;  2UUA L;  1JE5 A;  3G71 A;  4JI4 Q;  5BR8 Q;  3L0O A;  1O7I A;  4TQU S;  3SGI A;  3F2C A;  1YK5 A;  2ZTD A;  5C44 G;  4BY7 G;  5AI3 A;  1Q86 C;  1HZC A;  4FDB A;  2R93 G;  2UU9 L;  4A75 A;  2KKD A;  3I2Z A;  2ZTC A;  4A3E H;  1K9M C;  1XMQ L;  1HH2 P;  1JJG A;  4X66 L;  2VQE L;  1W2B A;  1YUZ A;  2I5M X;  1A8V A;  1QUQ A;  1VQF A;  1NMF A;  1HZA A;  1OXX K;  3CCR A;  1YIJ A;  1T9Q A;  3PV0 A;  3ERS X;  4LWC A;  4PZ8 A;  4HJ7 A;  3CC4 A;  2KHI A;  5IYD H;  4DR7 L;  3WWV A;  1VQ8 A;  1TWH H;  4BY1 H;  1BBW A;  2R7D A;  1B7Y B;  1OXV A;  1SLJ A;  2K75 A;  5AJ3 L;  1B71 A;  3E9I A;  2B29 A;  3PSI A;  4PG3 A;  4R4C A;  4B3M L;  2EXD A;  2NZO A;  1IU5 A;  3G6E A;  1IYJ B;  4A3D H;  2Z0S A;  3KLW A;  4BBR H;  1K73 C;  4JCV E;  2UU9 Q;  1X55 A;  3ULP A;  3BJU A;  3DLL A;  1XMQ Q;  3TRZ A;  2PQA B;  3CW2 C;  3FP9 A;  4X66 Q;  4A3C H;  2VQE Q;  1VQ5 A;  1A0I A;  1DX8 A;  1PH9 A;  4GOP B;  3CPF A;  4DV6 Q;  4B3S L;  1IRN A;  1HNX L;  1RL2 A;  3HOU H;  5AI2 A;  3UE1 A;  1CUK A;  2A19 A;  3HOY G;  4QY7 A;  1B2J A;  5IP7 G;  1CAD A;  1E22 A;  5LMN L;  3S24 A;  3M85 A;  5AJ3 Q;  4BXX H;  5M3M G;  1VQP A;  4LF5 Q;  4XIG S;  1YVC A;  2DUD A;  5IYB G;  2AKW B;  1J5E L;  4JI6 L;  4JBM A;  2WAQ G;  1N33 L;  2Q2H A;  2VUM G;  3I4N G;  2GVB A;  1IRO A;  1L1O A;  5GRO A;  4C2M H;  1JJ2 A;  1C7Y A;  2RF4 A;  1S72 A;  1EQQ A;  2DSX A;  1XNQ Q;  1PA6 A;  1YJ9 A;  4WJ3 M;  3KF8 B;  5DLQ E;  1NBW A;  3JAM i;  4DR3 L;  1I3Q H;  1R9T H;  4AR3 A;  1YBY A;  1XTD A;  4OX9 Q;  1HR0 Q;  3S1M H;  2I5L X;  2ZTE A;  1CSQ A;  3H0G G;  8RXN A;  1BKB A;  1UE5 A;  2YTX A;  4A3J H;  1SFO H;  3G48 A;  4MTN A;  1IBM Q;  4NXN Q;  1YV1 A;  1VQN A;  1BQ8 A;  2R92 H;  4DR6 L;  2KCM A;  1PFS A;  3PUY A;  1J5E Q;  3ULJ A;  4YCW A;  1WFQ A;  1OXU A;  1BBU A;  1U0L A;  3NEM A;  4GN4 B;  3PGZ A;  4RMF A;  2EQS A;  4QGU A;  3S2D H;  3H15 A;  4JI0 L;  2OWO A;  2K50 A;  3BZC A;  4DV5 L;  2JA9 A;  1HZ9 A;  4A3L G;  1KD1 C;  3ZJY C;  2F4V L;  5C44 H;  1XNR Q;  1N32 L;  2R93 H;  4JBW A;  2PI2 A;  3K80 C;  4YWM A;  5IY0 A;  1E1T A;  4DR3 Q;  3M7N A;  4AQY Q;  3S17 H;  3KDF B;  1N34 L;  1MJE A;  2OTL A;  1QZG A;  4BY1 G;  5C4X H;  3RZD H;  2E2J H;  3S1R H;  1NTG A;  3TEH B;  1Q7Y C;  4DR6 Q;  2FXQ A;  3EBE A;  2YTY A; 
#chains in the Genus database with same CATH topology
 3BYY B;  1GJX A;  1ENC A;  2DJF C;  3BU2 A;  4ME5 A;  5BN3 A;  3VR2 A;  1NXE A;  2JJQ A;  4DA2 A;  2F4V Q;  2EY4 E;  2F03 A;  4X6A H;  1TWG H;  1FGB D;  1HFN A;  2QA4 A;  3OYY A;  4HSV A;  2EIF A;  3KFU A;  1BE7 A;  1TR5 A;  2B8G A;  5E4W C;  3VYU A;  1N36 Q;  2VNU D;  2ENB A;  5IP9 H;  3OIP A;  3LWP B;  2J9U B;  3BYT B;  5HGQ A;  3RLO A;  5C4J H;  4CHT B;  1D2B A;  5KND A;  1V43 A;  4EGV A;  3PIO 1;  1R4Q B;  5IYB H;  1NSN S;  1PTO H;  5KEE A;  4DR1 Q;  5C3E L;  3GTP L;  3RZO H;  2L1B A;  4DF7 A;  1HA6 A;  5IYC L;  3CCE A;  1VMC A;  2L55 A;  1I4G A;  2Z6K C;  2O4X A;  4P74 A;  1KC8 C;  2VUM B;  1AW7 A;  4CBV A;  4EQP A;  4A3J G;  1KLG D;  1FVI A;  2WIN B;  4GKJ Q;  2NVQ B;  1F2Z A;  3HKZ B;  3KLS X;  1WOC A;  2NVX H;  4L5S A;  3I8Z A;  4QIW P;  5LMU Q;  3H0G H;  2AWN A;  2X6L A;  3MPS A;  1B2O A;  4QF4 A;  2JK8 A;  2K33 A;  1TWF L;  1PFB A;  5J22 A;  2N78 A;  4CJ2 C;  2XVS A;  4LF9 Q;  5KYI A;  2XTI A;  4AHX A;  4QIW B;  3NE5 B;  3O13 A;  4L5T A;  1VCX A;  2Q8R E;  5HGT A;  4B3T L;  4A3L H;  5C4X G;  1SXT A;  3T1Y Q;  5EIO C;  2H5X A;  1S24 A;  4L5Q A;  3A5Z B;  3UDG A;  4LF5 L;  3HG9 A;  3M9B A;  2ASB A;  2NYZ D;  4KY6 A;  1WD0 A;  4PNY A;  5C3X A;  5M3F L;  4DV1 L;  5JVG 1;  1JQY D;  3JAM c;  3HOX G;  1U5K A;  1XNQ L;  2P5Z X;  4X65 Q;  4K0K Q;  3RR5 A;  1I6V C;  1W3S A;  4BBS H;  3MXU A;  5ELN A;  3W5O A;  4DV3 Q;  4JI3 Q;  4LF6 Q;  4CKB A;  1LTS D;  2FHT A;  3H3V M;  4YCV A;  2SNM A;  5FJ8 G;  5MFP A;  4IJL A;  2JA5 G;  1IBK Q;  1Y1W H;  4P72 A;  2XJU A;  3STB C;  2IHE A;  1S4Z A;  1G6P A;  2NN6 G;  1UE7 A;  1VQA A;  4IPH A;  3MSU A;  2ZXP A;  5H1S c;  1K8M A;  2JEB I;  5EIN C;  2JA6 L;  1YHB A;  4OWX B;  4L8J A;  4Y52 H;  1XNR L;  4DK0 A;  4B9W A;  3J7Z 1;  3PO3 H;  5EKK A;  5C0X I;  1BCP F;  3GV3 A;  3J80 L;  2EJM A;  1I3Q B;  3IFT A;  4X62 L;  1E2Z A;  2CH4 A;  1G91 A;  5EBC A;  2IHF A;  5IGB A;  2A74 C;  4DV7 Q;  1WCM H;  1KDC A;  1A15 A;  1IL2 A;  1RDV A;  2PZT A;  2DY7 A;  1L0Y B;  4LF4 L;  3RD4 A;  2LS0 1;  3WOF A;  4GNX C;  4M1U B;  1L0W A;  2B63 L;  1SYB A;  3D4R A;  2OQ0 A;  3TP8 A;  1PH4 A;  4ME3 A;  2EY1 A;  1CKN B;  1SNO A;  4A3F G;  3HOW H;  2F3W A;  2HHH L;  3I72 A;  3TME A;  1CT1 D;  2RCN A;  5IE8 A;  4HJ9 A;  3FKI G;  4O42 A;  1DVB A;  4KJN A;  1GM5 A;  3S1R B;  4IJH A;  1JWS D;  1X3Q A;  1RTN A;  4J8Q A;  5C6A A;  4K5X A;  4C3J H;  2K5N A;  2CR8 A;  2F3I A;  1GUN A;  1H7V A;  4X64 Q;  3CXC A;  3I90 A;  3K7U C;  2QDB A;  4DNI A;  1EU4 A;  3FPU B;  5FLX L;  2VXW A;  1WTW A;  3K5N A;  4KY7 A;  3OTO L;  4R4I A;  2AQC A;  1KNE A;  2NVT H;  3I4M G;  4DV4 Q;  5KYL A;  4FXD A;  2YU9 B;  3M3Y H;  2NVQ L;  2F0G A;  1O7L A;  1VQD A;  1YNN D;  4TSS A;  5IT9 L;  1HNZ Q;  1UEB A;  2B2W A;  1ENF A;  4N8F A;  2DGY A;  4AR5 A;  2TMP A;  3GTQ B;  3Q22 A;  4R1J A;  3EVQ A;  2L5T A;  3F2D A;  1VCI A;  5IOD A;  5M3M B;  3H94 A;  3RN5 A;  4QMG A;  2RCF A;  4RFB A;  2VQF L;  5EPK A;  4Z9C B;  2F0K A;  3DM3 A;  3IKJ A;  1R0F A;  2F0N A;  4CDF C;  3PF4 A;  5JVH 3;  3RN2 A;  4KKT A;  1HZB A;  1EY5 A;  5EPL A;  1Y14 B;  3JR7 A;  2XJV A;  3GTM B;  1SMU A;  1FNV A;  4WOR A;  3U4V A;  1AZQ A;  1SE2 A;  1Q46 A;  1EIF A;  2F0E A;  4ZLT F;  1YK4 A;  2N8N A;  1WVL A;  3ICE A;  3BZK A;  1EQV A;  1Q12 A;  5C3E H;  3VYS A;  3GTP H;  2BA0 A;  4DK3 C;  5NUC A;  5IYC H;  1V1P A;  3J80 E;  3TS2 A;  3MAQ A;  4OGQ C;  4KI0 A;  3VR4 A;  2OT2 A;  1MKH A;  4BY1 B;  3NSW A;  3TN2 A;  4EX5 A;  3K0X A;  4JI8 Q;  5GAG C;  5D65 A;  4B08 A;  1X9N A;  4KHP L;  1LT3 D;  4OON A;  2RDV A;  1KAA A;  4DV2 Q;  3HS0 C;  3SVM A;  1TWF H;  1RCV D;  1Y8P B;  1HHV A;  1MD2 D;  4NP5 A;  4PMB A;  4XYQ A;  2UUC L;  3ITP A;  1S40 A;  4C3I H;  3HOU B;  4JV5 Q;  4PMW A;  1AE2 A;  2JYO A;  3C1E A;  3GO5 A;  2ZXO A;  4AHW A;  4IUU A;  6RXN A;  1PV4 A;  2PYA A;  1SJH D;  4DGZ A;  4A3I B;  4WRD A;  1C09 A;  5M3F H;  3LWE A;  3NWS A;  2RBM A;  3P1H A;  1KRS A;  2C6B A;  1R0J A;  1Q1B A;  5FLX E;  2PYK A;  4NB3 A;  3EQL C;  4B3M Q;  4RAU C;  3Q0A A;  1JT8 A;  4FF3 A;  2M4Y A;  2SEB D;  3A54 A;  5JPM C;  3HKZ E;  5IT9 E;  3S1R L;  3U9O A;  3HOV G;  4DNT B;  2XWJ B;  1OWB A;  2K03 A;  5CR3 A;  4TKO B;  4IUT A;  1P16 A;  4ILW A;  4B3S Q;  3A56 A;  4ABN A;  2CW0 C;  2KEN A;  4RHR A;  4DUZ L;  4QIW E;  3E0J A;  2DN8 A;  4ZYS A;  5KGU A;  5LMN Q;  2JA7 B;  2AUS B;  2F0V A;  3J7Y W;  2KBN A;  1LKP A;  2WB1 P;  4APV A;  1I5F A;  2R61 A;  3NBI A;  4KJO A;  4HJ8 A;  1IKM A;  3G6J B;  1IHZ A;  2YU9 L;  2A73 B;  3J81 j;  2Z1C A;  4LUO A;  2E8G A;  2CFM A;  5AFW A;  4LUV A;  1XXG A;  3A5U A;  2ZJP A;  2WB1 B;  2PMZ E;  3GTQ L;  1AEX A;  1YHQ A;  5IYD G;  1EOV A;  4JI1 L;  1ZKO A;  1GKH A;  3DWP A;  2R7Z B;  5M3M L;  3NBH A;  1SN8 A;  4WFN 1;  3E9H A;  4IUV A;  3CD6 A;  4A93 G;  2A69 D;  4A3B G;  3LWO B;  4QL5 A;  1I4P A;  1MSG A;  1CFM A;  3QB3 A;  4IPG A;  1Q3L A;  1FJG L;  3J81 L;  3PUX A;  3QO2 A;  2M6O A;  2H1E A;  2AQ3 B;  4HED A;  4NPS A;  3Q23 A;  1CKM A;  2EYJ A;  2IY5 B;  3DM1 A;  4A3K B;  1QYB A;  1H9K A;  1NNQ A;  5A35 A;  4K5V A;  4AR6 A;  5IGE A;  2E5L L;  2K2D A;  3TS0 A;  2VUM H;  5KIX A;  4BY1 L;  4DAY B;  3H9B A;  3I7F A;  1STA A;  5M5Y B;  2RDF A;  4X3T A;  3PO2 B;  1PTO F;  1PH8 A;  1IYU A;  5C0X G;  1CAA A;  2Y0S P;  1EQR A;  1SYD A;  2WII B;  3L9A X;  4KD3 A;  3UE0 A;  1HQM C;  3MZ5 A;  1JE5 A;  3G71 A;  1O7I A;  1F4L A;  1JB3 A;  1YK5 A;  1T5X D;  3HOU L;  3TDQ A;  2K1B A;  2ZTC A;  3I2Z A;  4X66 L;  1W2B A;  2EYO A;  2I5M X;  1HUM A;  3CCR A;  4A3I L;  2R7D A;  1SLJ A;  1B71 A;  4PG3 A;  2E2H B;  4R4C A;  3WWL A;  1PFW A;  1AFP A;  3GP7 A;  1STN A;  3KLW A;  3GTL B;  2ZT9 C;  3ULP A;  2AQ1 B;  3LWR B;  2RFK B;  1WTR A;  3URY A;  1XMQ Q;  1BOS A;  3TRZ A;  4GZY C;  3NQI A;  1PFN A;  1PH9 A;  2FMC A;  2Z3Q B;  1IL8 A;  1RL2 A;  1PFV A;  2SOB A;  2K7V A;  3PO3 B;  3QJY A;  4QY7 A;  3R93 A;  1CAD A;  1TKW B;  4KKS A;  1VQP A;  4LF5 Q;  5IYB G;  4G57 A;  2DY8 A;  2WAQ G;  3AMU A;  2JA7 L;  4I7A A;  5GRO A;  2B2V C;  1C7Y A;  2RF4 A;  1P7P A;  5ELF A;  1XNQ Q;  4OO1 H;  1RJT A;  2WAC A;  5DM6 1;  3KF8 B;  4V19 6;  1I3Q H;  4AR3 A;  2K32 A;  3J81 E;  2I5L X;  3H0G G;  8RXN A;  1YV1 A;  1EY4 A;  1BQ8 A;  1VQN A;  4ZKC B;  2EJG C;  1OXU A;  1BQQ T;  1BBU A;  2B2W C;  3KBX A;  2EQS A;  4QUF A;  2OWO A;  4DV5 L;  4A3L G;  5CV8 A;  1XNR Q;  2K5D A;  1E1T A;  1SNM A;  1ZXT A;  1N34 L;  2OTL A;  2NUC A;  1QZG A;  3MFG A;  5D3D A;  4A3G B;  1EZ6 A;  3S1R H;  1Q7Y C;  1NR2 A;  3DMU A;  5EKI A;  4FF4 A;  3H3V H;  5CV4 A;  1EFI D;  4LHL A;  1I4R A;  2Z9H A;  3W3A A;  4A3K L;  3IRB A;  5AN9 H;  3MXP A;  1PH3 A;  1JOO A;  2Z8L A;  3B08 B;  4JVZ A;  3Q8D A;  1F9R A;  4BBS G;  1LT6 D;  3BVZ A;  3CCL A;  3AQQ A;  5FLX c;  3AYH B;  2FJ2 A;  3VDY A;  4H0L C;  4IOC A;  4JI2 L;  2YU9 H;  1Y1W G;  1TS2 A;  3NEN A;  2JA8 B;  2HHH Q;  5M5Y L;  2EYL A;  1U4M A;  3SK4 A;  1QZH A;  1FYC A;  4DR4 L;  3R2T A;  5IT9 c;  2LFN A;  3GTQ H;  1VQB A;  1IXR A;  4JOI A;  1LUZ A;  5GAH C;  2CQO A;  5M3M H;  1YJW A;  2FMM A;  3BZD B;  4LF7 L;  3T56 B;  2XSC A;  1PYB A;  1D5Z C;  1PRT D;  1EWI A;  3GV6 A;  3GTM H;  4QQB X;  1DOK A;  1ENA A;  1WCM G;  4C3H B;  1Q8I A;  4NDX A;  2PQA A;  1VQ7 A;  3W1B A;  1OXS C;  3CAM A;  4FXK C;  1H9S A;  4GOP A;  4EQN A;  4EQO A;  1LTB D;  2ALY B;  3TP6 A;  5LMN W;  2E2H L;  3C3L A;  3I3C A;  1HNW Q;  1RHP A;  2R7F A;  5E4X A;  3HOW G;  2VQF Q;  4DPG A;  4LFB L;  4MNO A;  4OX9 L;  3PKI A;  3D4W A;  4A3E B;  1O7Y A;  2LKV A;  3CPW A;  2WB1 E;  1NJI C;  4YY3 Q;  1C8C A;  1KXL A;  3CP0 A;  2AUJ D;  1KTK A;  3PO3 L;  1Q81 C;  3NXW A;  1SND A;  1C0A A;  3H9C A;  2ZM6 L;  4C3I B;  1QVG A;  2E2D C;  1EEI D;  3J7Y 1;  4YWK A;  1OO9 B;  3OW7 A;  2OXP A;  4A3D B;  4KY5 A;  3J7A F;  2K14 A;  5DAU A;  1H9R A;  2C5C A;  5JOB A;  1G51 A;  4NXN L;  5FOB B;  5GAE c;  1KDA A;  1G6Z A;  1D8L A;  3LWU A;  1YNX A;  4OO1 I;  1DOL A;  3KDF A;  1O78 A;  1TS5 A;  2L9H A;  4UY8 1;  4A3I H;  4KHP Q;  2JQO A;  2D9U A;  1TXY A;  1XPO A;  4IO9 A;  4BA2 I;  1HPC A;  4GS3 A;  1I4Q A;  4KHZ A;  1YIT A;  1R9T B;  4C3J L;  2UUC Q;  2L0Z A;  4RXN A;  1NMG A;  4JG2 A;  3S1M B;  2BDN A;  4A3G L;  2F0M A;  3HKS A;  5CBE E;  3OSO A;  4A3J B;  2ERJ A;  2R92 B;  2HVY C;  5JVH 1;  3B6Y A;  1KDB A;  1F2L A;  5FLM L;  1A3U A;  3ULL A;  2A6E C;  3R3O A;  1I94 L;  1OTC A;  3K59 A;  4H7B A;  4GLX A;  2X69 A;  1DXM A;  1IYV A;  1RYQ A;  3GDE A;  5C3E G;  5I4D A;  5K36 H;  4C2M 1;  3V96 A;  2JA7 H;  3H3V I;  3NPP A;  1SMX A;  1EYD A;  1LM0 A;  4KD4 A;  3JC6 6;  2F0Q A;  3JC6 3;  1B2T A;  1LT5 D;  5HY6 A;  4DUY L;  2CW0 D;  5C4X B;  2JA8 L;  3TSS A;  2E2J B;  3KF6 A;  4B9X A;  2J0T D;  3ZYY X;  4CDC C;  1ASY A;  2MHV A;  1SR3 A;  2NWG A;  1FL0 A;  2AMC B;  2R7Z H;  1STY A;  1EIH A;  1UAP A;  1CA5 A;  5IP7 L;  3A55 A;  2F0S A;  2V4D A;  3D31 A;  2ATW A;  4ZN3 B;  2V1C C;  3P2A A;  2MO1 A;  4IUN A;  4Q0F A;  1B8A A;  1PXU A;  4C3H L;  3PIP 1;  3J81 c;  2JA5 B;  1LTL A;  1QE6 A;  2CVR A;  1Q82 C;  1LTI D;  2CHB D;  5M3F G;  3S16 B;  1XMO L;  1KQS A;  1RIP A;  4JPB W;  5ELC A;  4JI1 Q;  1KL9 A;  4A4I A;  4A3K H;  3I4N B;  4HAE A;  3S2H B;  3GTK B;  4AI2 A;  2PW5 A;  1RKN A;  4O0A A;  1BDO A;  3W2D A;  4DAV A;  4A3E L;  1BRF A;  1UEA B;  3LNL A;  5BN4 A;  1B50 A;  4NMZ A;  3KOJ A;  5M5Y H;  3PO2 H;  1SMM A;  4JI5 Q;  4LFC L;  5JEA H;  1FJG Q;  2PW7 A;  4XQJ A;  2I0Q A;  4K8I A;  2H12 A;  4C3I L;  3MXN A;  1F2M A;  2JA6 G;  3SK5 A;  2HQE A;  1O7Z A;  3E0E A;  1KIX A;  1MIU A;  1VQG A;  4A3D L;  3A8I E;  3T4A C;  4GNX B;  4YHH L;  2Q2U A;  1EY6 A;  4PZ7 A;  3V05 A;  1U4P A;  2UXB L;  1AE3 A;  1PFY A;  3PUV A;  4DK6 C;  1NE3 A;  1H95 A;  2N49 A;  5LL6 S;  2E5L Q;  1KNA A;  3EA6 A;  2CQA A;  1VDZ A;  3EJI A;  4H44 C;  4EQ5 A;  3NUC A;  1Z47 A;  4BXX L;  4U67 3;  2EY2 A;  1CKO A;  1LTT D;  4NW2 A;  4B3R L;  2EY6 A;  2PPB C;  5IWA Q;  2B63 G;  4HR7 B;  4R4T A;  2UXC L;  2E2H H;  1VZH A;  2KA7 A;  2PVE A;  2AWO A;  2PQE A;  3GTL H;  1R9T L;  3M4Y A;  1K8G A;  1XTC D;  1JWM D;  1VQ4 A;  3S1M L;  2HUG A;  1VQJ A;  5G3L D;  1SMW A;  4AYB G;  2C9O A;  4HJA A;  2PI2 E;  2R92 L;  1R0I A;  1YNJ C;  1W6J A;  4KK7 A;  3PIO A;  2HCC A;  4XDX A;  1Q8K A;  3L2P A;  3PIP A;  2VL6 A;  1EIG A;  3FMC A;  3N52 A;  3S9W A;  2EYP A;  2RHQ B;  1PRT B;  3AFP A;  4QB4 A;  2F0P A;  2HDL A;  1HTL D;  3NQT A;  3HKZ G;  2E2J L;  3ND9 A;  3A44 A;  1EL0 A;  3CCJ A;  4O2D A;  4GKK Q;  3FDT A;  2Q2I A;  1SNP A;  3D0F A;  2HD3 A;  1MHW C;  2HIX A;  3PL5 A;  5DM7 3;  1VQM A;  1II3 A;  2OCE A;  2KJX A;  3SE0 A;  1C48 A;  1ET9 A;  1PRT F;  3KYW A;  4JOI C;  5MFZ A;  2KN9 A;  4K8J A;  2QKI C;  1V1Q A;  1E3P A;  1K3B C;  4X3K A;  3HJW B;  1CK1 A;  2B2V A;  4YCU A;  1TWC B;  4P75 A;  4Y7N B;  4RGO S;  4G7H C;  1JMC A;  4A3G H;  5FJ8 L;  2XJP A;  2JA5 L;  3NEL A;  1NCV A;  3R2I A;  4HIM A;  1LAC A;  1IBL L;  2KED A;  3A74 A;  5FLM H;  4DR2 Q;  4IPC A;  4AR4 A;  2VUM L;  3I4N L;  1WYD A;  4U68 A;  1YZ6 A;  3GTK L;  1K8O A;  1MGS A;  4ZK9 B;  1BCP C;  4FF2 A;  4GOP C;  4DV5 Q;  3T1H L;  3A7A B;  5JJL A;  2D2C C;  2DNE A;  2QIL A;  2V0F A;  3K7A B;  1HFG A;  1PFU A;  1EUJ A;  5J3B A;  2JA8 H;  2EYH A;  3A7L A;  4EVO A;  2IX0 A;  3CCU A;  5FO8 B;  1ZEQ X;  1G29 1;  1DZ1 A;  3D8G A;  3U58 A;  2QL0 A;  2J7Z A;  1N9W A;  3ERQ A;  3M4P A;  3HOZ G;  1I50 H;  5FO7 B;  1PH5 A;  1AZP A;  1F77 A;  1UNS A;  5IP7 H;  3T16 A;  4LAA A;  4OO1 G;  3J7A 5;  2RSN A;  1ESR A;  2L0C A;  2BH2 A;  3BDO A;  1HQR D;  2F3V A;  4RCO A;  4C3H H;  3GTJ B;  4UHV A;  1K0S A;  1X56 A;  2IX3 A;  4DR4 Q;  2PSM C;  4F88 A;  1GOZ A;  1AN8 A;  1X65 A;  3K5M A;  2QCP X;  1Y69 U;  1WTO A;  4LFA L;  1STG A;  1IU6 A;  2UUA L;  4IAL A;  4R8N A;  4BWG B;  1K83 B;  5BR8 Q;  3L0O A;  1Y8O B;  1TS4 A;  4TQU S;  4BY7 G;  2XJT A;  3MXG A;  4G7O C;  2IWH A;  2O2L D;  2JN4 A;  3M4O B;  2K28 A;  4A3E H;  1K9M C;  1A3V A;  1TWA B;  2VQE L;  1QUQ A;  4TRD A;  3TP7 A;  1HZA A;  1J9O A;  1JE4 A;  3PV0 A;  2QW7 A;  2ICE C;  4DR7 L;  1VQ8 A;  2E74 C;  1UUP A;  4KN7 C;  5AJ3 L;  3T53 B;  1I3Q L;  2B29 A;  3PSI A;  3U9S A;  4HMJ A;  5FKA C;  2I46 A;  4OIJ A;  2NZO A;  4IN3 A;  1IU5 A;  3G6E A;  2WV6 D;  1IYJ B;  4A3D H;  2LMC B;  2UU9 Q;  2K05 A;  4JCV E;  3P20 A;  4A3M B;  4E6Y A;  1BXT A;  3DLL A;  1Q90 A;  3FP9 A;  1VQ5 A;  4A93 B;  1A0I A;  4A3B B;  1RF2 D;  1S5C D;  3CPF A;  1BNZ A;  1IRN A;  1HNX L;  5AI2 A;  1CUK A;  2A19 A;  1PZK D;  2F0U A;  5E1F A;  4BXX H;  3M85 A;  5I9P A;  5M3M G;  2DUD A;  2AKW B;  2V0E A;  1N33 L;  3LNN A;  1C4Q A;  3OIQ A;  1L1O A;  1JJ2 A;  1EQQ A;  1S72 A;  1PA6 A;  1T5E A;  1ODH A;  4DXG A;  1NBW A;  2KCN A;  3JAM i;  4DR3 L;  1R9T H;  1YBY A;  3VYT A;  2QDL A;  2HDM A;  4MHE A;  5M5X B;  1VF7 A;  3S1M H;  1TWC L;  1CZW A;  2L4N A;  2ZTE A;  4H13 C;  3S14 B;  1UE5 A;  1O80 A;  2YTX A;  4A3J H;  3G48 A;  4NXN Q;  2R92 H;  1LV9 A;  2KCM A;  1PFS A;  3PUY A;  1J5E Q;  2G9D A;  4YCW A;  1WFQ A;  3E3X A;  1GUG A;  5C4H A;  2WKC A;  4XT3 B;  2F4V L;  4JBW A;  2PI2 A;  2IW3 A;  2A6E D;  3ERO A;  1MJE A;  4BY1 G;  3K7A L;  5C4X H;  1V1O A;  3SK6 A;  2E2J H;  3MVV A;  4XXB B;  3B0A B;  1ICW A;  1NTG A;  4DR6 Q;  2FXQ A;  5LL6 X;  2YTY A;  1QVC A;  3K6O A;  3PKJ A;  2EVB A;  3IU3 I;  2RKS A;  4POF A;  3QWN A;  4JI0 Q;  1SYE A;  3Q24 A;  3GTM L;  2OEO A;  3KYU A;  4AHZ A;  4H02 A;  3HOU G;  1L0X B;  1K8A C;  3ONA B;  4GKJ L;  2FIN B;  2G9H D;  4TVA B;  1Y1V B;  4UPA A;  3GTJ L;  2L15 A;  4CKE A;  1JB7 A;  5FJ8 H;  2JA5 H;  2A68 C;  3PZA A;  2BH8 A;  3C1F A;  3NK9 A;  3TQY A;  2ES2 A;  1QNK A;  4A3I G;  3P8B A;  2WAQ P;  3S16 H;  1PMR A;  2F52 A;  2PZU A;  1JOQ A;  3P75 A;  3I4N H;  1K83 L;  4KLK A;  1R0G A;  1JC7 A;  3R8B A;  4RA8 A;  3QIA A;  1E24 A;  5G3L F;  5IIF A;  3S2H H;  2WAQ B;  3GTK H;  1DON A;  4XXE A;  3M4O L;  2L11 A;  5C3W A;  2HR5 A;  1BO0 A;  1MI2 A;  1WTV A;  1DD2 A;  1S5B D;  1EY8 A;  4RWS C;  2Z4H A;  4B8C D;  2X6G A;  2LXK A;  1F2Y A;  2CKA A;  2CKZ B;  4V0B A;  2Y0S B;  3S15 B;  1NXG A;  2IX1 A;  1Y8N B;  3F1Z A;  3FDJ A;  2F0L A;  3AB9 A;  3PMF A;  2MFI A;  3F8T A;  1SNQ A;  4K0K L;  5K36 G;  1R0H A;  2H4O A;  2XJR A;  1XMO Q;  2JA7 G;  4A3M L;  2MO0 A;  4RH6 A;  3PCO B;  1LKM A;  3BDL A;  4JI3 L;  4LF6 L;  3PQI A;  4A3B L;  1IBK L;  3HJY B;  2WB1 G;  4POG A;  2KHJ A;  3CC2 A;  1TWH B;  4HN7 A;  5T1G A;  4LFC Q;  5L37 A;  4G7Z C;  4XT1 B;  2B8F A;  3EFX D;  3TZD A;  1T9O A;  3I91 A;  1GUT A;  4B3T Q;  4DKA C;  4BS9 A;  4BBR B;  5IP9 G;  3EN2 A;  4JAF A;  1HR0 L;  2QEJ C;  3VR5 A;  1RTO A;  2I5H A;  2XWB B;  4RGM A;  1SJE D;  2A6H C;  4HJ5 A;  3NTK A;  2I07 B;  5KRU A;  3S14 L;  1PTO C;  1YI2 A;  3BG3 A;  1JR0 D;  1J6Q A;  3PF5 A;  4WJ4 A;  4DV1 Q;  3STB D;  2WKD A;  1C9O A;  3DEP A;  3SS2 A;  4ZRZ A;  2E75 C;  4F87 A;  1V1P B;  4A3K G;  3RZT A;  4P71 A;  1H9M A;  5TSS A;  3J80 c;  2ID0 A;  3AFQ A;  1PH7 A;  4JW0 A;  4MZ9 A;  5JEA J;  3CF5 A;  1S5D D;  1AH9 A;  4ZAI A;  1QVF A;  1GUS A;  2R7Z L;  4UP8 A;  4ZUI A;  1SFO B;  1WD1 A;  2KOL A;  3G7L A;  4JK1 C;  3S2D B;  5MF6 A;  4X64 L;  1TY2 A;  1WJJ A;  2DJG C;  1QOH A;  1GXD C;  5JJK A;  1EIY B;  5FO9 B;  5C44 B;  2R93 B;  3KYY A;  1S5F D;  1DM0 B;  1LLR D;  1PYW D;  4X62 Q;  1RB9 A;  4ALP A;  1X3E A;  5F2D A;  3J7Z C;  1CSP A;  1GD7 A;  3QQC E;  3RZD B;  1IW7 C;  1Y1V L;  3W1G A;  1X54 A;  1TWC H;  4Y7N H;  3OPO A;  4LF4 Q;  2IPK D;  4DAP A;  1ROD A;  4NXM L;  4AH6 A;  4DNR B;  1BBX C;  3I4O A;  1SMY C;  1TU2 B;  2D0O A;  3LPE B;  3D6W A;  5LHY 1;  4DU9 A;  3PO2 L;  1GHK A;  1JCK B;  4HIO A;  1BFY A;  4F7X A;  4UAI A;  4UP7 A;  4I65 A;  1I50 B;  2IL8 A;  3DHQ A;  3K7A H;  1A62 A;  2JEA I;  2E2I B;  5IGF A;  4KTA A;  4YIJ A;  5K5P A;  3CRL C;  5M5W B;  3HOY B;  3S15 L;  1BF4 A;  3PO3 G;  3S1N B;  1BCP D;  2TSS A;  4HIK A;  2N3S A;  2M6P A;  2D62 A;  2EOT A;  4PMC A;  2HIV A;  4RKB A;  4CGY B;  3KYX A;  1YEZ A;  2NVY B;  1K28 A;  3OW2 A;  3CQZ B;  1M1K C;  5EGT A;  3OTO Q;  5MLC 3;  1U9R A;  2R3Z A;  2SNS A;  2LXJ A;  1Z92 B;  2UXD L;  4AI0 A;  1VQH A;  4JI7 L;  5I2Y A;  3C2P A;  4G4K A;  3KUP A;  4IOA A;  3NBH B;  2O5J C;  2A1A A;  3P7J A;  3UDI A;  5E3F A;  1RD9 D;  1TWH L;  1SRU A;  3GTJ H;  1VQ6 A;  1KRT A;  3GTL L;  4DV2 L;  4ULL A;  4IFD H;  1VF5 C;  1B13 A;  4N9T A;  5H1S E;  3GTG B;  4BBR L;  1U4L A;  1K83 H;  1JWU D;  3DWA A;  3CHB D;  3E5S A;  4HMI A;  1R4P B;  5DM7 1;  4A3C L;  4JV5 L;  2JI3 A;  3ER0 A;  4C3J G;  3I55 A;  3M4O H;  3PUW A;  5RXN A;  4J1M A;  5CYU A;  1PVO A;  4YWL A;  1L1O C;  2QF7 A;  1TWA H;  4A3G G;  1IZ6 A;  1LTR D;  1BVS A;  2AHO B;  2V3B B;  1PH2 A;  3FVQ A;  2UUB L;  4K5W A;  1CA6 A;  5D14 A;  1GVP A;  4IUR A;  5FLM G;  1VQ9 A;  4ZUJ A;  1PHJ A;  1K3R A;  3IFD A;  3RYG A;  4DR5 L;  4DV0 L;  4UDU C;  1XPU A;  4TVM A;  1V8Q A;  3K57 A;  1OWC A;  4LFA Q;  3I56 A;  2A8V A;  2UUA Q;  2HT1 A;  4A3M H;  1WI5 A;  4JBK A;  1EEF D;  1JOK A;  3RLN A;  1YHA A;  2EYM A;  2XN9 C;  1K0R A;  4IUP A;  1CKN A;  2JA8 G;  4A93 H;  2EE1 A;  1ASZ A;  4A3B H;  1SFO L;  2PZW A;  2D0P A;  1EU3 A;  1D5M C;  1BR9 A;  4LUZ A;  3M7G A;  2K5H A;  4C1N I;  4K6L A;  5CV9 A;  4DR7 Q;  3RNU A;  2M2L A;  2ICI A;  4JYA L;  2F0D A;  3CCM A;  1PDQ A;  5C44 L;  4BA1 I;  2R93 L;  3MHB A;  3CCV A;  2WAQ E;  2XGT A;  3U4Z A;  2M4V A;  1B70 B;  2MUY A;  3KJP A;  5CGK A;  4L63 B;  1HJP A;  5EQ0 A;  1SBB B;  5M5X H;  1QB5 D;  1V9P A;  4C3H G;  1PZX A;  2CCZ A;  4MTK A;  5M9O A;  3S14 H;  4LF8 L;  4FXG C;  1LYL A;  2Y0S E;  2BCO A;  1HNX Q;  3MC0 B;  3SXH A;  5IYC G;  4XQQ A;  4UP9 A;  1NY4 A;  5C0X H;  2KEE A;  1D1I A;  2VY3 A;  4JC0 A;  4K2K A;  1N33 Q;  1H9J A;  3WDN A;  2Q2T A;  3ND8 A;  3KLS A;  3GD7 A;  4A3E G;  4KN4 C;  3H99 A;  1I50 L;  2E2I L;  4GN5 A;  3VR3 A;  3HOY L;  2XJQ A;  5M5W L;  2JXM B;  3KK7 A;  5IGC A;  3S1N L;  3S1Q B;  3HP3 A;  4DUZ Q;  3J80 i;  3QR8 A;  3HOX B;  4GS7 D;  2AUK A;  2NZ1 D;  4C3I G;  2A69 C;  3EIV A;  3CQZ L;  1YUX A;  1RDP D;  1PYS B;  4A3D G;  1EYC A;  5CC4 A;  3QOJ A;  2B63 B;  1CZG A;  2ZJQ A;  1B3Q A;  1A2U A;  3K58 A;  3DXJ C;  2LCQ A;  4IPD A;  4AYB P;  3OOC A;  4R8I A;  1HUN A;  1S3O A;  4OWT B;  1CM9 A;  1Y1V H;  4WJW A;  5BN5 A;  2AYJ A;  2PNH A;  2RVL A;  4BXX G;  1P8L A;  4AYB B;  4FNF A;  5DM6 3;  3GTG L;  5COY A;  3TP5 A;  1LT4 D;  1B9M A;  2R6G A;  3RMH A;  2K5W A;  1Q1E A;  2A68 D;  3WOE A;  4IFD I;  2C35 B;  1F9Q A;  3HKZ P;  3IL8 A;  2KQ3 A;  1WTH A;  5EPJ A;  1STB A;  2F0J A;  4HCS A;  2R92 G;  1E1O A;  2F0F A;  4RHS A;  3S15 H;  1LO5 D;  5GQO A;  3AEV A;  1X6O A;  1ILP A;  2GA4 B;  4F8M A;  3V2T A;  2VB2 X;  4FVM A;  2O5I C;  1WTP A;  4X3U A;  1U4R A;  4A3F B;  2NBF A;  3SGI A;  2ZTD A;  5AI3 A;  1Q86 C;  3HEJ A;  2B2U A;  2F0H A;  3FKI B;  2KKD A;  4A75 A;  3UI2 A;  2L12 A;  3MQK B;  2F0T A;  1JJG A;  1SYF A;  5CV7 A;  1XMQ L;  2PMZ P;  1A8V A;  2EXZ A;  1NMF A;  1YIJ A;  1T9Q A;  4LHN A;  4DFA A;  1D7Q A;  1NR4 A;  2BOS A;  3F2U A;  4RCN A;  1CI3 M;  1TQO A;  1TWH H;  4ODG A;  2PMZ B;  1W6K A;  1OXV A;  3MFY A;  1M8A A;  1ML0 D;  3E9I A;  4QUC A;  1SEB D;  2B2Y A;  3D6C A;  2M9V A;  4BBR H;  1ZYR C;  3VA7 A;  3I4M B;  3K35 A;  4OHJ A;  4A3J L;  2PQA B;  3CW2 C;  3NWT A;  4X66 Q;  3GTO B;  4A3C H;  1I4X A;  1BCP B;  1H9S B;  4GOP B;  1WTQ A;  1SSO A;  1E22 A;  3S24 A;  1CHP D;  3I4L A;  1YVC A;  4KV6 A;  4JI6 L;  4JBM A;  2A6H D;  5I2X A;  4LMQ D;  5MGN A;  5ELE A;  2VUM G;  3I4N G;  1TII D;  2GVB A;  1IRO A;  5C4X L;  5CBA E;  3VPB E;  1PTO D;  4DK1 A;  3HOZ B;  1Z7T A;  2EDG A;  1YJ9 A;  1QG7 A;  3BS1 A;  4WJ3 M;  5DLQ E;  3SDZ A;  1XTD A;  1HR0 Q;  1NNX A;  4FF1 A;  4CKC A;  2F4I A;  1F9S A;  1EZ8 A;  4KMU C;  1SFO H;  3OMG A;  3S1Q L;  5T1I A;  2EPB A;  1LAB A;  3ULJ A;  3HOX L;  3NEM A;  3S2D H;  3PGZ A;  4RMF A;  4QGU A;  2K50 A;  3BZC A;  2A5H A;  4XQN A;  4DXF A;  2JA9 A;  1HZ9 A;  1KD1 C;  5JAV A;  5C44 H;  1N32 L;  2R93 H;  4XGH A;  4YWM A;  2Z3R B;  1IKL A;  3K80 C;  1MBY A;  3X3M A;  1EWC A;  3KDF B;  4N9P A;  3QG1 A;  4CJ1 B;  4BY7 B;  3S16 L;  3RZD H;  2NTS A;  5C5L A;  1E2V A;  4OEM B;  1B4O A;  3TEH B;  1HA5 A;  1G2T A;  5DNF A;  2B2T A;  3EBE A;  4DAY A;  5I9O A;  3S2H L;  4LJZ C;  5J1Z A;  2F0W A;  2E76 C;  4L5R C;  2K5V A;  1IW7 D;  2ERS A;  2CWP A;  1VMP A;  2SDF A;  4J15 A;  1EYG A;  1XJV A;  1B44 D;  4GLA C;  3HGB A;  2Z6B A;  4GLV B;  1LTA D;  2LSS A;  1N34 Q;  4PZ6 A;  1QCB D;  3MWY W;  4LNQ A;  4XTC S;  5IOC A;  1MJC A;  4A76 A;  2IJ0 A;  1UE6 A;  1SMY D;  1SE3 A;  1EY7 A;  2E2I H;  2B39 A;  3M4Q A;  3HOY H;  5M5W H;  4K2L A;  3CC7 A;  2CWA A;  4JI4 L;  3S1N H;  1LKO A;  2N55 A;  2YYZ A;  2MPM A;  2NVY H;  5GAE C;  3KBG A;  1ESF A;  3CQZ H;  5JJI A;  4NXM Q;  4A3F L;  1PRT C;  1SDF A;  2MP1 A;  3KF6 B;  1HNW L;  3FKI L;  4JI2 Q;  2BA1 A;  2FFK B;  4HSP A;  1CTM A;  5EAY A;  1NUC A;  3HOV B;  2G5D A;  1JJC B;  4YY3 L;  3RUZ A;  1XX8 A;  3SR1 A;  3NFP I;  2K01 A;  1I6H B;  3WWN B;  5GAD c;  4LF7 Q;  2BDO A;  2OTJ A;  3J81 i;  1B9N A;  3GTG H;  2O5J D;  2J4X A;  4V19 0;  3I4M L;  3UDF A;  2KCC A;  1E0B A;  3KLR A;  4KHV A;  2QEX A;  4DV6 L;  1FGU A;  1XPR A;  3GTO L;  3H3V C;  2RA4 A;  1DJR D;  1B3A A;  2UXD Q;  1QIL A;  2Q8T A;  3KF8 A;  2PVX A;  4JI7 Q;  5HUR A;  2YV5 A;  1ET6 A;  4R4Q A;  2BE5 C;  3BVG A;  4LFB Q;  3MTS A;  3HOZ L;  2KVM A;  5FK9 C;  1EFW A;  4OX9 Q;  3PUZ A;  3PIO 3;  5EJW A;  5GAH c;  1L2F A;  3PIP 3;  1D1K A;  1IBM L;  1PFM A;  3MXN B;  5C4Z A;  3U50 C;  2ZM6 Q;  1VQL A;  1RYT A;  1UWV A;  4AYB E;  2AQ2 B;  4KKU A;  2M00 A;  1DYQ A;  1VQE A;  3A0J A;  2JI1 A;  1FD7 D;  2WFW A;  1TS3 A;  3BVM A;  2UUB Q;  4C2M B;  1A6X A;  4DAM A;  4P73 A;  4AQY L;  4J6H A;  2HQL A;  4Y7N L;  1E7Z A;  4AI3 A;  4ZKB B;  5JPN C;  5J39 A;  5A2Q L;  4DR5 Q;  4DV0 Q;  4BY7 L;  1B53 A;  1VQI A;  4IFD J;  3CCS A;  2VZA A;  3KYH C;  4GN3 B;  4IQZ A;  4C56 C;  1VZG A;  4IFD G;  2F0I A;  5K2M E;  2K4K A;  1PH1 A;  3MEF A;  3NHH A;  4UY8 C;  1N36 L;  1UE1 A;  2WP8 J;  4FO2 A;  4MN3 A;  2JA6 H;  5JVG 3;  2JP1 A;  4JYA Q;  3S17 B;  1STE A;  3LGJ A;  1OXT A;  1A2T A;  2B5I D;  1GO3 E;  1KAW A;  5KNB A;  1QQT A;  3KJO A;  1B1Z A;  2RHS B;  1I94 Q;  4XYO A;  4DR1 L;  5D3I B;  3TBI B;  4C1N K;  4ZCK A;  3NTH A;  4FP5 D;  3S1Q H;  4S3S A;  1VZI A;  3HOX H;  1ZRP A;  4LF8 Q;  4CJ0 B;  1X3P A;  3CU7 A;  2VW9 A;  3HFZ B;  1TWG B;  2LY7 A;  1VQC A;  3DEO A;  4A3M G;  1JYB A;  1M4V A;  5IGD A;  4K9F A;  1E8J A;  1G2S A;  4DUY Q;  2B63 H;  3H6M A;  5LMU L;  4IZ8 A;  5CV5 A;  3HOV L;  3CMA A;  2XRQ D;  4LF9 L;  5CMD A;  3DUZ A;  5C4J B;  2B2U C;  4JI5 L;  2NN6 H;  3K5L A;  1I6H L;  1ICF B;  1KAB A;  3X3N A;  1Z9F A;  1PTO B;  3RZO B;  3T1Y L;  4AIM A;  3VYR A;  2YTV A;  4TPU A;  4DN4 M;  2MNA A;  1T9P A;  2QGQ A;  1TWA L;  1G8Z D;  3UDX A;  1SYC A;  3A8K E;  4LW1 A;  2B2Y C;  1HR0 W;  2NVX B;  2MJ8 A;  2MQH A;  1ONL A;  3QVD A;  2KEC A;  3H0G B;  5C0X J;  5IYD L;  1SE8 A;  1RWD A;  4X65 L;  3CCQ A;  2NVQ H;  2RDH A;  1VS0 A;  2GMG A;  1TY0 A;  5ELO A;  4MIU A;  3L7Z C;  4DV3 L;  4K6D A;  1FHM A;  1ILQ A;  4RGN A;  5IWA L;  2PPT A;  4A93 L;  2D5D A;  2K04 A;  2OF1 A;  5ELB A;  1HTP A;  4A3F H;  5A2Q E;  1QCV A;  1FR3 A;  3JC6 2;  1A63 A;  3FKI H;  7RXN A;  2NYD A;  1BQ9 A;  3K5O A;  4QJF A;  2R7Z G;  3MA2 B;  2XJS A;  5COR A;  5KNC A;  3F2B A;  3JAM L;  1T9H A;  3CRK C;  2Z6K A;  2JI2 A;  1RDG A;  1FHH A;  5E7N A;  4N8X 1;  1JOR A;  3CME A;  4BBS B;  4YHH Q;  5M5X L;  1NAP A;  1WJV A;  1KHI A;  2VS1 A;  4JAD A;  2UXB Q;  3I4M H;  2CH4 W;  4DV7 L;  1J8I A;  2KHS A;  2ZJR A;  1Y1W B;  3TZU A;  3D4D A;  1VQK A;  1STH A;  3GTO H;  1EOT A;  1YJN A;  3T51 B;  2CKC A;  3HAX C;  1Y1V G;  3BDC A;  3VR6 A;  3K8A A;  4GKK L;  4CDD C;  1SE4 A;  1ZYR D;  4B3R Q;  1HCZ A;  3K81 C;  1PH6 A;  2GN5 A;  2OQK A;  1TT2 A;  1S2Z A;  5JJZ A;  1YNJ D;  2UXC Q;  3KYV A;  5EKL A;  2JSO A;  4ZQ3 A;  1N8R C;  5DEH A;  2KCT A;  2B2T C;  4HCE A;  1QNU A;  1QUQ B;  3HOZ H;  3PO2 G;  3S17 L;  5JEA G;  4O1N A;  2PCF B;  2GVA A;  1D5X C;  1CHQ D;  1WCM B;  2F1M A;  2JE6 I;  4OEL B;  3E6Z X;  4OXP A;  4AHY A;  2Y0S G;  1SNC A;  4QCL A;  1Z6H A;  1LTG D;  4PV1 C;  3SEB A;  4L6T B;  3I73 A;  4DR2 L;  4R9W A;  4P2C B;  4DV4 L;  4FYD A;  2XIW A;  4X6A L;  2VB3 X;  1TWG L;  1S30 A;  4JI6 Q;  3HOW B;  5I6Y A;  3AU7 A;  4JBJ A;  1HNZ L;  1MSH A;  3FPP A;  1EY9 A;  5IP9 L;  1TVX A;  3H91 A;  4PQX A;  3IAY A;  1EY0 A;  4BY7 H;  5C4J L;  5CV6 A;  1VQO A;  2K52 A;  4C3J B;  4OWW B;  2Z4I A;  1L1O B;  1YNN C;  5IYB L;  2RQX A;  5GAD C;  2K5Q A;  4G6B A;  4U67 1;  3RZO L;  1M90 C;  2MS3 A;  3RLF A;  5ISR A;  2NN6 I;  2NVT B;  4BBR G;  3H97 A;  3D3R A;  1F9P A;  4ID6 A;  4R4O A;  3G4S A;  3M3Y B;  3PWF A;  4A3C G;  4OL7 A;  2NVX L;  2XRS D;  1N32 Q;  3A8J E;  4GNX A;  2IT1 A;  3HZX A;  3H0G L;  3MEH A;  3Q6S A;  2NZH A;  4AI1 A;  3JAM E;  1IBL Q;  3OHX C;  1X3F A;  4RG1 A;  3RZ6 A;  4A3L L;  4Q5V A;  1QJO A;  3J7A V;  5BR8 L;  3T1H Q;  2B3G A;  4JI8 L;  2MGS A;  2NB0 A;  3TRE A;  3HRZ C;  4LK1 C;  1BUV T;  1XWE A;  1SRO A;  1GUW A;  3LWV B;  4HID A;  3HOV H;  1HRJ A;  1I4H A;  1EYA A;  3FHW A;  1X3G A;  1DOM A;  1I6H H;  3QOL A;  4NKL A;  4JAG A;  4ZN1 B;  2NTT A;  2XNA C;  1DGS A;  3I70 A;  5C3E B;  3GTP B;  2Q8I B;  4JI4 Q;  4BBS L;  4OIK A;  2K6A A;  3CKI B;  1GHJ A;  3F2C A;  5C44 G;  2R93 G;  1HZC A;  2RSO A;  4FDB A;  2UU9 L;  1EQT A;  1Y1W L;  1KLU D;  1PZI D;  1HH2 P;  4WFN 3;  1YUZ A;  1VQF A;  1OXX K;  1X32 A;  1XYI A;  4LWC A;  4HJ7 A;  3ERS X;  4PZ8 A;  3CC4 A;  2PO4 A;  2KHI A;  5IYD H;  2APO B;  2F0O A;  1FNU A;  1TWF B;  2ZXR A;  3WWV A;  4BY1 H;  1BBW A;  1FNW A;  1B7Y B;  4Y52 L;  2K75 A;  2EYF A;  4B3M L;  2EXD A;  3SHL A;  1DCZ A;  1S5E D;  2Z0S A;  1K73 C;  1X55 A;  1GUO A;  3BJU A;  3N6R A;  2ZIX A;  2VQE Q;  4JAE A;  3GQB A;  1DX8 A;  1WCM L;  5ELD A;  4CDE C;  3S2D L;  4DV6 Q;  4B3S L;  3HOU H;  2BE5 D;  3UE1 A;  3HOY G;  3NTI A;  1B2J A;  5IP7 G;  5EBD A;  5M3F B;  3FEW X;  5LMN L;  5AJ3 Q;  4XIG S;  1J5E L;  1SYG A;  2Q2H A;  2PNR C;  3DWQ A;  3HOW L;  4X3S A;  3RZD L;  4C2M H;  3C46 A;  1AP0 A;  2EZV A;  2DSX A;  4I7Z C;  2N88 A;  5I6W A;  1WTX A;  1D6E C;  3OWE B;  3H09 A;  4E6I A;  3FRP B;  3NP8 A;  4K14 A;  4IUQ A;  1CSQ A;  5GAG c;  1BKB A;  1HXY D;  3L3O C;  4MTN A;  1IBM Q;  5IGG A;  2EY5 A;  4DR6 L;  2DNC A;  1JIC A;  2RDG A;  2JA6 B;  1U0L A;  3ZG6 A;  4HTH A;  3LWQ B;  4GN4 B;  3H15 A;  4JI0 L;  1A3T A;  2NVT L;  4M8A A;  3K0Y A;  1EWH A;  3ZJY C;  3OMC A;  1PZJ D;  2C6A A;  1CQV A;  3VA5 A;  3SK8 A;  4DR3 Q;  3M3Y L;  5IY0 A;  1PLF A;  1SAP A;  3M7N A;  2EJF C;  4AQY Q;  5C5M A;  3S17 H;  1E2W A;  3OWF A;  4RKL A;  4RGT A;  3LX0 A;  2HCI A;  2KUM A;  3T13 A;  2NVY L;  1CQF A;  1QWY A; 
#chains in the Genus database with same CATH homology
 3BU2 A;  1NXE A;  2JJQ A;  2F4V Q;  4X6A H;  1TWG H;  2QA4 A;  3OYY A;  2EIF A;  3KFU A;  1BE7 A;  1N36 Q;  2VNU D;  5IP9 H;  2J9U B;  5HGQ A;  3RLO A;  5C4J H;  1V43 A;  3PIO 1;  5IYB H;  4DR1 Q;  3RZO H;  3CCE A;  1KC8 C;  2Z6K C;  4P74 A;  4GKJ Q;  4A3J G;  1FVI A;  1WOC A;  2NVX H;  4L5S A;  5LMU Q;  3H0G H;  2AWN A;  3MPS A;  1B2O A;  2JK8 A;  4LF9 Q;  2N78 A;  2XTI A;  4AHX A;  4L5T A;  1VCX A;  4B3T L;  4A3L H;  5C4X G;  3T1Y Q;  5EIO C;  2H5X A;  1S24 A;  4L5Q A;  3A5Z B;  3UDG A;  4LF5 L;  2ASB A;  3M9B A;  4DV1 L;  5JVG 1;  3JAM c;  3HOX G;  1U5K A;  1XNQ L;  4X65 Q;  4K0K Q;  3RR5 A;  1W3S A;  4BBS H;  5ELN A;  3W5O A;  4DV3 Q;  4JI3 Q;  4LF6 Q;  5FJ8 G;  4YCV A;  2JA5 G;  5MFP A;  4IJL A;  1IBK Q;  1Y1W H;  4P72 A;  2XJU A;  3STB C;  2IHE A;  1G6P A;  2NN6 G;  1UE7 A;  1VQA A;  4IPH A;  3MSU A;  5H1S c;  2JEB I;  5EIN C;  1YHB A;  4OWX B;  4Y52 H;  1XNR L;  3J7Z 1;  3PO3 H;  5C0X I;  4X62 L;  2IHF A;  4DV7 Q;  1WCM H;  1IL2 A;  1RDV A;  4LF4 L;  4GNX C;  1L0W A;  2OQ0 A;  1PH4 A;  4ME3 A;  1CKN B;  4A3F G;  3HOW H;  2HHH L;  5IE8 A;  2RCN A;  4HJ9 A;  3FKI G;  1DVB A;  1GM5 A;  4IJH A;  4C3J H;  2K5N A;  2CR8 A;  2F3I A;  1H7V A;  4X64 Q;  3CXC A;  3K7U C;  4DNI A;  3OTO L;  4R4I A;  2NVT H;  3I4M G;  4DV4 Q;  3M3Y H;  1VQD A;  1HNZ Q;  1UEB A;  2DGY A;  4AR5 A;  4R1J A;  3F2D A;  1VCI A;  3RN5 A;  2VQF L;  3DM3 A;  1R0F A;  3PF4 A;  3RN2 A;  1HZB A;  1Y14 B;  2XJV A;  1SMU A;  3U4V A;  1Q46 A;  1EIF A;  1YK4 A;  2N8N A;  3ICE A;  3BZK A;  1Q12 A;  5C3E H;  3GTP H;  2BA0 A;  4DK3 C;  5IYC H;  3TS2 A;  4KI0 A;  1MKH A;  4EX5 A;  3K0X A;  4JI8 Q;  5GAG C;  1X9N A;  4KHP L;  4OON A;  2RDV A;  4DV2 Q;  1TWF H;  2UUC L;  1S40 A;  4C3I H;  4JV5 Q;  4PMW A;  1AE2 A;  3GO5 A;  4AHW A;  6RXN A;  1PV4 A;  2PYA A;  1C09 A;  5M3F H;  1KRS A;  2C6B A;  1R0J A;  1Q1B A;  4NB3 A;  4B3M Q;  1JT8 A;  2M4Y A;  3HKZ E;  3HOV G;  1OWB A;  1P16 A;  4B3S Q;  2KEN A;  4DUZ L;  4QIW E;  5LMN Q;  2KBN A;  1LKP A;  4APV A;  1I5F A;  4HJ8 A;  3J81 j;  4LUO A;  2E8G A;  2CFM A;  4LUV A;  3A5U A;  2ZJP A;  2PMZ E;  1YHQ A;  5IYD G;  1EOV A;  4JI1 L;  1GKH A;  1SN8 A;  4WFN 1;  3E9H A;  3CD6 A;  4A93 G;  2A69 D;  4A3B G;  4QL5 A;  4IPG A;  1FJG L;  3PUX A;  2M6O A;  4NPS A;  1CKM A;  2IY5 B;  1QYB A;  1NNQ A;  4AR6 A;  2E5L L;  2K2D A;  3TS0 A;  2VUM H;  4DAY B;  3I7F A;  1PH8 A;  5C0X G;  1CAA A;  1EQR A;  3UE0 A;  1JE5 A;  3G71 A;  1O7I A;  1YK5 A;  3I2Z A;  2ZTC A;  4X66 L;  1W2B A;  2I5M X;  3CCR A;  2R7D A;  1SLJ A;  1B71 A;  4PG3 A;  4R4C A;  3WWL A;  3KLW A;  3ULP A;  1XMQ Q;  3TRZ A;  1PH9 A;  2Z3Q B;  1RL2 A;  4QY7 A;  1CAD A;  1VQP A;  4LF5 Q;  5IYB G;  2WAQ G;  5GRO A;  1C7Y A;  2RF4 A;  1XNQ Q;  5DM6 1;  3KF8 B;  4V19 6;  1I3Q H;  4AR3 A;  2I5L X;  3H0G G;  8RXN A;  1YV1 A;  1VQN A;  1BQ8 A;  1OXU A;  1BBU A;  2EQS A;  2OWO A;  4DV5 L;  4A3L G;  1XNR Q;  1E1T A;  1N34 L;  2OTL A;  1QZG A;  3S1R H;  1Q7Y C;  3H3V H;  4LHL A;  3IRB A;  5AN9 H;  1PH3 A;  3B08 B;  3Q8D A;  4BBS G;  3CCL A;  3AQQ A;  5FLX c;  3AYH B;  3VDY A;  4IOC A;  4JI2 L;  2YU9 H;  1Y1W G;  3NEN A;  2HHH Q;  1QZH A;  4DR4 L;  5IT9 c;  3GTQ H;  1VQB A;  1IXR A;  4JOI A;  1LUZ A;  5GAH C;  2CQO A;  5M3M H;  1YJW A;  4LF7 L;  1PYB A;  1EWI A;  3GTM H;  4QQB X;  1WCM G;  2PQA A;  1VQ7 A;  3W1B A;  1OXS C;  3CAM A;  4GOP A;  2ALY B;  5LMN W;  1HNW Q;  2R7F A;  3HOW G;  2VQF Q;  4DPG A;  4LFB L;  4MNO A;  4OX9 L;  3PKI A;  3CPW A;  2WB1 E;  1NJI C;  4YY3 Q;  1KXL A;  3CP0 A;  1Q81 C;  1C0A A;  2ZM6 L;  1QVG A;  3J7Y 1;  4YWK A;  2K14 A;  1G51 A;  4NXN L;  5GAE c;  1D8L A;  1YNX A;  4OO1 I;  3KDF A;  4UY8 1;  4A3I H;  4KHP Q;  2JQO A;  1TXY A;  1XPO A;  4IO9 A;  4BA2 I;  4GS3 A;  4KHZ A;  1YIT A;  2UUC Q;  2L0Z A;  4RXN A;  1NMG A;  4JG2 A;  3HKS A;  2ERJ A;  5JVH 1;  3B6Y A;  1I94 L;  3ULL A;  1OTC A;  4GLX A;  1RYQ A;  3GDE A;  5C3E G;  2JA7 H;  3H3V I;  1SMX A;  1LM0 A;  3JC6 6;  3JC6 3;  5HY6 A;  4DUY L;  3KF6 A;  1ASY A;  1SR3 A;  1FL0 A;  2AMC B;  2R7Z H;  3D31 A;  2ATW A;  4ZN3 B;  2V1C C;  3P2A A;  2MO1 A;  1B8A A;  3PIP 1;  3J81 c;  1LTL A;  1Q82 C;  5M3F G;  1XMO L;  1KQS A;  1RIP A;  4JI1 Q;  1KL9 A;  4A4I A;  4A3K H;  4AI2 A;  4O0A A;  1BRF A;  3LNL A;  3KOJ A;  5M5Y H;  3PO2 H;  1SMM A;  4JI5 Q;  4LFC L;  1FJG Q;  2I0Q A;  2H12 A;  2JA6 G;  3E0E A;  1KIX A;  1MIU A;  1VQG A;  4GNX B;  4YHH L;  2Q2U A;  4PZ7 A;  2UXB L;  1AE3 A;  3PUV A;  4DK6 C;  1NE3 A;  1H95 A;  2N49 A;  2E5L Q;  4EQ5 A;  1Z47 A;  1CKO A;  4B3R L;  5IWA Q;  2B63 G;  4R4T A;  2UXC L;  2E2H H;  1VZH A;  2PVE A;  2AWO A;  3GTL H;  1K8G A;  1VQ4 A;  1VQJ A;  1SMW A;  4AYB G;  4HJA A;  2PI2 E;  1R0I A;  3PIO A;  3L2P A;  1Q8K A;  3PIP A;  2VL6 A;  2RHQ B;  3AFP A;  3HKZ G;  3A44 A;  3CCJ A;  4O2D A;  4GKK Q;  2Q2I A;  3D0F A;  2HIX A;  1VQM A;  2OCE A;  3KYW A;  4JOI C;  5MFZ A;  2KN9 A;  1V1Q A;  1E3P A;  4YCU A;  4P75 A;  1JMC A;  4A3G H;  2XJP A;  3NEL A;  4HIM A;  1IBL L;  3A74 A;  5FLM H;  4DR2 Q;  4IPC A;  4AR4 A;  1WYD A;  1YZ6 A;  4GOP C;  4DV5 Q;  3T1H L;  5JJL A;  2V0F A;  5J3B A;  1EUJ A;  2JA8 H;  3CCU A;  2IX0 A;  1G29 1;  3U58 A;  2QL0 A;  1N9W A;  3M4P A;  3HOZ G;  1I50 H;  1PH5 A;  5IP7 H;  4OO1 G;  3J7A 5;  2BH2 A;  4C3H H;  1X56 A;  4DR4 Q;  2PSM C;  1X65 A;  4LFA L;  1IU6 A;  2UUA L;  5BR8 Q;  3L0O A;  4TQU S;  4BY7 G;  2XJT A;  4A3E H;  1K9M C;  2VQE L;  1QUQ A;  1HZA A;  3PV0 A;  4DR7 L;  1VQ8 A;  5AJ3 L;  2B29 A;  3PSI A;  2NZO A;  1IU5 A;  3G6E A;  1IYJ B;  4A3D H;  2UU9 Q;  4JCV E;  4E6Y A;  3DLL A;  3FP9 A;  1VQ5 A;  1A0I A;  3CPF A;  1IRN A;  1HNX L;  5AI2 A;  1CUK A;  2A19 A;  4BXX H;  3M85 A;  5M3M G;  2DUD A;  2AKW B;  2V0E A;  1N33 L;  1L1O A;  1JJ2 A;  1EQQ A;  1S72 A;  1PA6 A;  1ODH A;  1NBW A;  3JAM i;  4DR3 L;  1R9T H;  1YBY A;  3S1M H;  2ZTE A;  1UE5 A;  2YTX A;  4A3J H;  4NXN Q;  3G48 A;  2R92 H;  2KCM A;  1PFS A;  3PUY A;  1J5E Q;  4YCW A;  1WFQ A;  2F4V L;  4JBW A;  2PI2 A;  2A6E D;  1MJE A;  4BY1 G;  5C4X H;  2E2J H;  4XXB B;  3B0A B;  1NTG A;  4DR6 Q;  2FXQ A;  2YTY A;  1QVC A;  3PKJ A;  3IU3 I;  4POF A;  4JI0 Q;  3KYU A;  4AHZ A;  4H02 A;  3HOU G;  1K8A C;  4GKJ L;  4TVA B;  4UPA A;  2L15 A;  1JB7 A;  5FJ8 H;  2JA5 H;  3PZA A;  2BH8 A;  3TQY A;  2ES2 A;  4A3I G;  3P8B A;  3S16 H;  2F52 A;  3I4N H;  4KLK A;  1R0G A;  1E24 A;  3S2H H;  3GTK H;  2HR5 A;  4B8C D;  2LXK A;  2CKA A;  2CKZ B;  1NXG A;  2IX1 A;  3F1Z A;  2MFI A;  3F8T A;  4K0K L;  5K36 G;  1R0H A;  2XJR A;  1XMO Q;  2JA7 G;  2MO0 A;  3PCO B;  1LKM A;  4JI3 L;  4LF6 L;  1IBK L;  2WB1 G;  4POG A;  2KHJ A;  3CC2 A;  4LFC Q;  1T9O A;  4B3T Q;  4DKA C;  5IP9 G;  3EN2 A;  4JAF A;  1HR0 L;  2I5H A;  4HJ5 A;  1YI2 A;  1J6Q A;  3PF5 A;  4WJ4 A;  4DV1 Q;  3STB D;  1C9O A;  3SS2 A;  4A3K G;  3RZT A;  4P71 A;  3J80 c;  2ID0 A;  3AFQ A;  1PH7 A;  4MZ9 A;  5JEA J;  3CF5 A;  1AH9 A;  1QVF A;  4UP8 A;  5MF6 A;  4X64 L;  1WJJ A;  5JJK A;  1EIY B;  3KYY A;  4X62 Q;  1RB9 A;  4ALP A;  1X3E A;  3J7Z C;  1CSP A;  1GD7 A;  3QQC E;  3W1G A;  1X54 A;  1TWC H;  4Y7N H;  4LF4 Q;  4NXM L;  4AH6 A;  3I4O A;  2D0O A;  3LPE B;  4HIO A;  1BFY A;  4UP7 A;  3K7A H;  2JEA I;  1A62 A;  3PO3 G;  4HIK A;  2N3S A;  2M6P A;  2D62 A;  2HIV A;  3KYX A;  1YEZ A;  3OW2 A;  1M1K C;  3OTO Q;  5MLC 3;  2LXJ A;  1Z92 B;  2UXD L;  4AI0 A;  1VQH A;  4JI7 L;  4IOA A;  3NBH B;  2A1A A;  3UDI A;  1SRU A;  3GTJ H;  1VQ6 A;  1KRT A;  4DV2 L;  1B13 A;  5H1S E;  1K83 H;  5DM7 1;  4JV5 L;  2JI3 A;  3ER0 A;  3I55 A;  3M4O H;  3PUW A;  5RXN A;  1PVO A;  4YWL A;  1L1O C;  4A3G G;  1TWA H;  1IZ6 A;  1BVS A;  2AHO B;  2V3B B;  1PH2 A;  2UUB L;  1VQ9 A;  5FLM G;  1GVP A;  1PHJ A;  1K3R A;  3RYG A;  4DR5 L;  4DV0 L;  1XPU A;  4TVM A;  1OWC A;  4LFA Q;  2A8V A;  3I56 A;  2UUA Q;  2HT1 A;  4A3M H;  1WI5 A;  4JBK A;  3RLN A;  1YHA A;  1K0R A;  1CKN A;  2JA8 G;  4A93 H;  1ASZ A;  4A3B H;  2D0P A;  4LUZ A;  2K5H A;  4DR7 Q;  3RNU A;  4JYA L;  3CCM A;  4BA1 I;  3CCV A;  2WAQ E;  2XGT A;  3U4Z A;  2M4V A;  1B70 B;  3KJP A;  1HJP A;  5M5X H;  1V9P A;  2CCZ A;  3S14 H;  4LF8 L;  1LYL A;  2Y0S E;  1HNX Q;  5IYC G;  4UP9 A;  1NY4 A;  2VY3 A;  4JC0 A;  1N33 Q;  2Q2T A;  3GD7 A;  4A3E G;  4GN5 A;  2XJQ A;  4DUZ Q;  3J80 i;  4GS7 D;  3EIV A;  1YUX A;  1PYS B;  4A3D G;  2ZJQ A;  2LCQ A;  4IPD A;  1S3O A;  4OWT B;  1Y1V H;  2AYJ A;  2PNH A;  4BXX G;  1P8L A;  2R6G A;  1Q1E A;  2A68 D;  4IFD I;  2C35 B;  2R92 G;  1E1O A;  3S15 H;  5GQO A;  3AEV A;  1X6O A;  3SGI A;  2ZTD A;  5AI3 A;  1Q86 C;  4A75 A;  2KKD A;  1JJG A;  1XMQ L;  1A8V A;  1NMF A;  1YIJ A;  1T9Q A;  4LHN A;  1D7Q A;  1TWH H;  1OXV A;  3E9I A;  4BBR H;  3K35 A;  2PQA B;  3CW2 C;  4X66 Q;  4A3C H;  4GOP B;  1E22 A;  3S24 A;  1YVC A;  4JI6 L;  4JBM A;  2A6H D;  5MGN A;  2VUM G;  3I4N G;  2GVB A;  1IRO A;  3VPB E;  1YJ9 A;  4WJ3 M;  5DLQ E;  1XTD A;  1HR0 Q;  1SFO H;  3ULJ A;  3NEM A;  3S2D H;  3PGZ A;  4RMF A;  4QGU A;  2K50 A;  3BZC A;  2JA9 A;  1HZ9 A;  1KD1 C;  5C44 H;  1N32 L;  2R93 H;  4XGH A;  4YWM A;  2Z3R B;  3K80 C;  3KDF B;  3RZD H;  3TEH B;  3EBE A;  4L5R C;  2K5V A;  1IW7 D;  2ERS A;  2CWP A;  4J15 A;  1EYG A;  1XJV A;  4GLA C;  4GLV B;  2LSS A;  1N34 Q;  4PZ6 A;  4LNQ A;  4XTC S;  1MJC A;  4A76 A;  1UE6 A;  2E2I H;  3M4Q A;  3HOY H;  5M5W H;  3CC7 A;  2CWA A;  4JI4 L;  3S1N H;  1LKO A;  2YYZ A;  2NVY H;  5GAE C;  3CQZ H;  5JJI A;  4NXM Q;  3KF6 B;  1HNW L;  4JI2 Q;  2BA1 A;  5EAY A;  1JJC B;  4YY3 L;  3NFP I;  3WWN B;  5GAD c;  4LF7 Q;  2OTJ A;  3J81 i;  3GTG H;  2O5J D;  3UDF A;  2QEX A;  4DV6 L;  1FGU A;  1XPR A;  2UXD Q;  2PVX A;  4JI7 Q;  2YV5 A;  4R4Q A;  4LFB Q;  1EFW A;  4OX9 Q;  3PUZ A;  5GAH c;  1L2F A;  1IBM L;  3MXN B;  3U50 C;  2ZM6 Q;  1VQL A;  1RYT A;  1UWV A;  4AYB E;  1VQE A;  3A0J A;  2JI1 A;  2WFW A;  2UUB Q;  4DAM A;  4P73 A;  4AQY L;  2HQL A;  1E7Z A;  4AI3 A;  4DR5 Q;  4DV0 Q;  1VQI A;  4IFD J;  3CCS A;  2VZA A;  3KYH C;  4GN3 B;  1VZG A;  4IFD G;  5K2M E;  2K4K A;  1PH1 A;  3MEF A;  4UY8 C;  1N36 L;  1UE1 A;  2WP8 J;  2JA6 H;  4JYA Q;  3LGJ A;  1OXT A;  2B5I D;  1GO3 E;  1KAW A;  3KJO A;  2RHS B;  1I94 Q;  4DR1 L;  3S1Q H;  1VZI A;  3HOX H;  1ZRP A;  4LF8 Q;  2VW9 A;  3HFZ B;  1VQC A;  4A3M G;  1JYB A;  4K9F A;  1E8J A;  4DUY Q;  2B63 H;  5LMU L;  3CMA A;  4LF9 L;  4JI5 L;  1Z9F A;  3T1Y L;  4AIM A;  2YTV A;  4TPU A;  2MNA A;  1T9P A;  2QGQ A;  3UDX A;  4LW1 A;  1HR0 W;  2MQH A;  3QVD A;  5C0X J;  1SE8 A;  1RWD A;  4X65 L;  3CCQ A;  2NVQ H;  1VS0 A;  2GMG A;  5ELO A;  3L7Z C;  4DV3 L;  1FHM A;  5IWA L;  2PPT A;  4A3F H;  1QCV A;  3JC6 2;  1A63 A;  3FKI H;  7RXN A;  2NYD A;  1BQ9 A;  4QJF A;  2R7Z G;  2XJS A;  3F2B A;  1T9H A;  2Z6K A;  2JI2 A;  1RDG A;  1FHH A;  5E7N A;  3CME A;  4YHH Q;  1WJV A;  1KHI A;  2VS1 A;  4JAD A;  2UXB Q;  3I4M H;  4DV7 L;  2ZJR A;  1VQK A;  3GTO H;  1YJN A;  2CKC A;  1Y1V G;  3K8A A;  4GKK L;  4B3R Q;  3K81 C;  1PH6 A;  2GN5 A;  2OQK A;  1S2Z A;  2UXC Q;  3KYV A;  1N8R C;  2KCT A;  1QUQ B;  3HOZ H;  3PO2 G;  5JEA G;  2GVA A;  2JE6 I;  4OXP A;  4AHY A;  2Y0S G;  4DR2 L;  4DV4 L;  1S30 A;  4JI6 Q;  4JBJ A;  1HNZ L;  4BY7 H;  1VQO A;  2K52 A;  4OWW B;  1L1O B;  5GAD C;  4G6B A;  4U67 1;  1M90 C;  2MS3 A;  3RLF A;  2NN6 I;  4BBR G;  4R4O A;  3G4S A;  3PWF A;  4A3C G;  1N32 Q;  4GNX A;  2IT1 A;  2NZH A;  4AI1 A;  1IBL Q;  1X3F A;  4RG1 A;  3RZ6 A;  5BR8 L;  3T1H Q;  2B3G A;  4JI8 L;  3TRE A;  1SRO A;  4HID A;  3HOV H;  3FHW A;  1X3G A;  1I6H H;  4JAG A;  4ZN1 B;  1DGS A;  4JI4 Q;  3F2C A;  5C44 G;  2R93 G;  1HZC A;  4FDB A;  2UU9 L;  1HH2 P;  1YUZ A;  1VQF A;  1OXX K;  4LWC A;  4HJ7 A;  3ERS X;  4PZ8 A;  3CC4 A;  2KHI A;  5IYD H;  3WWV A;  4BY1 H;  1BBW A;  1B7Y B;  2K75 A;  4B3M L;  2EXD A;  2Z0S A;  1K73 C;  1X55 A;  3BJU A;  2ZIX A;  2VQE Q;  4JAE A;  1DX8 A;  4DV6 Q;  4B3S L;  3HOU H;  2BE5 D;  3UE1 A;  3HOY G;  1B2J A;  5IP7 G;  5LMN L;  5AJ3 Q;  4XIG S;  1J5E L;  2Q2H A;  4C2M H;  2DSX A;  1CSQ A;  5GAG c;  1BKB A;  4MTN A;  1IBM Q;  4DR6 L;  1U0L A;  3ZG6 A;  4GN4 B;  3H15 A;  4JI0 L;  3ZJY C;  2C6A A;  4DR3 Q;  5IY0 A;  3M7N A;  4AQY Q;  3S17 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...