4POFA

Pfmcm n-terminal domain without dna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
255
Chain Sequence
b'SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 21
publication title A conserved MCM single-stranded DNA binding element is essential for replication initiation.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication, dna binding protein
total genus 60
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4pofA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4pofA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4pofA01
3J81i 1ZRPA 1A0IA 4RMFA 3S24A 1VQJA 2A19A 2RF4A 5EAYA 4JI8L 3CCEA 1J5EL 4QJFA 3KYHC 1FJGL 2VUMH 1K9MC 4DV7Q 3S14H 2AWOA 1FGUA 4B3RL 4JI3L 1N33L 4IJLA 4BA1I 4TPUA 4A3IG 1VQDA 2HIVA 4JCVE 4BA2I 4TVAB 1K8AC 2QEXA 1K73C 3F1ZA 3PWFA 5HGQA 1VQPA 3CD6A 1PH5A 4BY7G 1DGSA 2CWPA 4KHZA 3S2HH 3RLFA 4C3IH 2JJQA 1G51A 2K5HA 3T1HQ 1KL9A 1W2BA 4DV0L 4HIOA 1PA6A 4L5QA 1EIFA 3GTKH 4GOPB 4YWLA 1R0HA 2JA5H 2WB1G 1KAWA 1A62A 1PV4A 2OTJA 1OXVA 1VQGA 3GTLH 4DR3L 3A74A 2JA6H 2D62A 3BU2A 1HNWL 2NN6G 2PNHA 1TWCH 1J6QA 3K8AA 1MJEA 5GAEC 2ES2A 3RZ6A 2KBNA 2WP8J 2OTLA 2KCTA 1B71A 4JI1L 4DR7L 2ZTEA 1L1OB 2Q2TA 1VQNA 2V3BB 1N34Q 4A3DG 4K9FA 4R4OA 3UDFA 5M3MG 1YUZA 2HR5A 3M4QA 2JEAI 3RR5A 4XIGS 5GQOA 3F2CA 4BBSG 5ELNA 4X62Q 4EQ5A 4KHPQ 4DR6Q 3F8TA 1QCVA 3PZAA 3JC66 4DAMA 1T9PA 5JEAG 3FKIH 4PZ7A 2VL6A 1EQQA 4JI5Q 1JYBA 1WCMH 2MO0A 3PUWA 4PZ8A 4LF8L 2JA8H 3PO2G 1PH8A 4HJ9A 1E7ZA 2N78A 3MXNB 1I94L 4IPHA 1JMCA 3OYYA 4JC0A 5LMUL 1FL0A 4A3EH 3S1RH 1Z9FA 1GM5A 4LFBL 2NZHA 3TEHB 3BJUA 3KYVA 1VQFA 1R0FA 3AFPA 4JV5Q 3TRZA 2VNUD 3CW2C 5HY6A 3CC2A 2UXCQ 1M90C 4JI2L 4B3MQ 1B8AA 2V1CC 3TREA 4A3BH 4QQBX 1HZCA 3Q8DA 4IOAA 3VDYA 2UUAQ 2XGTA 2EIFA 2PVXA 1R0GA 3AQQA 1YITA 2HHHQ 3HOYH 1V9PA 2F3IA 3PF5A 3RLNA 3KJPA 1K8GA 2D0PA 1C9OA 5FLMG 1VQLA 3EIVA 4JI8Q 3WWVA 2UU9Q 3S1QH 3AFQA 1J5EQ 4DV7L 1NE3A 2LXJA 4P72A 1LM0A 4DV4Q 5LMNW 1PH6A 4DPGA 3GD7A 3RZOH 4X66Q 2GVBA 1JE5A 1U0LA 1YHBA 2Z6KC 3L0OA 4YCVA 4YCWA 1Y1VG 3T1YL 4A3JG 2UUBQ 2K5VA 2H5XA 1P8LA 2PQAA 5FJ8H 3KDFA 5C3EH 2QA4A 3NELA 1HNXL 2I5LX 1VQ8A 2I0QA 4P71A 2UUCQ 3STBC 3M7NA 4DKAC 1DX8A 1HZBA 1DVBA 4DR2L 2CKZB 3PF4A 1X6OA 3I7FA 3PGZA 5AI2A 4DUZQ 4IPDA 3U4ZA 3M85A 3CCUA 2PI2E 4B3TQ 4LF9Q 2RHSB 1Y1WG 2JA5G 3M9BA 1GKHA 1HZAA 4JOIC 3J7ZC 3CCVA 1YIJA 2Z6KA 2CWAA 4NXNQ 3GTJH 3K0XA 2JA6G 4APVA 2BA0A 4KI0A 3UDIA 1SRUA 2ID0A 1HNZQ 1N34L 1X56A 1RIPA 2Y0SE 3E0EA 1CAAA 1C09A 1RDVA 2GVAA 2YTXA 1KD1C 2OWOA 1SR3A 1CKNB 3PSIA 1CKOA 2ZJPA 4X62L 3RN2A 4KHPL 1E24A 1SROA 5M5WH 2ZJRA 4DR6L 4JYAQ 3RYGA 2JA7H 1Q46A 1A63A 2E8GA 4NXMQ 2VW9A 4IFDJ 4WJ4A 3JC63 4A3FH 1XMQQ 1Q12A 1MKHA 3K80C 4AH6A 4JOIA 4LF8Q 1D8LA 3FKIG 2ZJQA 1XTDA 2WFWA 1WCMG 5LMUQ 2JA8G 3HOWH 3QVDA 1YJWA 4ME3A 3HOUH 3SGIA 5BR8Q 3A0JA 4JV5L 4C2MH 1X55A 1BBUA 1QZHA 1VQAA 2UXCL 4B3ML 4BY1H 2CFMA 3S1MH 5JEAJ 4J15A 1ASYA 2NN6I 4DR4Q 3ZJYC 2AMCB 4Y7NH 4JG2A 4AQYL 4DK6C 4JI2Q 3HOZH 4A3GH 4X64Q 2HHHL 2VZAA 3H0GH 3RLOA 1IYJB 1JJ2A 1MJCA 2UU9L 4GLAC 3HOYG 1SN8A 1JJCB 1O7IA 4AR6A 1TXYA 2K52A 4DV4L 4JI7Q 3JC62 1RL2A 3S16H 1JJGA 4GN3B 4HJ5A 4X66L 2PVEA 2UUBL 3CMAA 1B2OA 5E7NA 3T1YQ 4A3BG 1X65A 1N32Q 1A8VA 1VQ9A 5C4XH 2MFIA 1IROA 3TQYA 1HNXQ 3KF8B 1HR0Q 1QUQA 2UUCL 1CSPA 5LMNQ 1KIXA 3AYHB 1EUJA 5C3EG 3HOXH 5FJ8G 4DR2Q 4XTCS 4MZ9A 1V43A 4AIMA 1S40A 2R7ZG 1Q86C 2IX1A 2B29A 4DUZL 4UY8C 2M4YA 4C3HH 3CC4A 1YEZA 4LF9L 4B3TL 4AYBG 3MEFA 2EQSA 3HKZG 1B70B 4OWTB 4H02A 4NXNL 1AE2A 1YHQA 3E9HA 4R4TA 1H7VA 1UE7A 4A3LH 2BH8A 3EBEA 1BQ8A 1VQHA 3W1BA 1HNZL 1G6PA 1YUXA 1E3PA 2CQOA 5RXNA 4IPGA 4DV3Q 4OWWB 1XNQQ 2NVQH 1S30A 1VQMA 2K75A 1T9HA 1QZGA 1K0RA 4JYAL 1WFQA 3H3VH 2UXBL 1YV1A 5ELOA 2YYZA 4TQUS 1IU6A 4NXML 1IU5A 1S3OA 4JI0L 1VQIA 1XMQL 4JBMA 3B6YA 1QVCA 2JA7G 1KRSA 3U50C 4HJ8A 3J80c 1EFWA 4DNIA 2YTYA 1G291 3K7UC 4A3FG 3EN2A 4R4QA 2VQEQ 1N8RC 1I50H 1LKMA 5C0XG 2B63H 3CPFA 4OXPA 3NEMA 1XPUA 1Y14B 3KF6A 4JBJA 5BR8L 3HOWG 3I4NH 4C3JH 1KQSA 2MS3A 4A93H 4POGA 1CKMA 2N49A 5IYBH 3I2ZA 1OTCA 3HOUG 4A3CH 1LKPA 1VQ5A 3CP0A 4DR4L 3H15A 2MO1A 1SMWA 1CSQA 2JE6I 4BY1G 3J80i 1E22A 1VS0A 2K5NA 2EXDA 3DM3A 4X64L 4AQYQ 1K3RA 1TWFH 3KYUA 4YHHL 1WI5A 3RNUA 4L5SA 3OTOQ 3HOZG 3H0GG 4NPSA 4JI7L 1SMMA 2WB1E 2VUMG 4HIKA 1FHHA 4RG1A 2AHOB 1EIYB 2K2DA 3CMEA 4LFAQ 4R1JA 4GOPC 4K0KL 3H3VI 3UE1A 4GNXB 1N32L 1S24A 5M3FH 1C0AA 1HH2P 1HR0L 5JJLA 1SLJA 1X3FA 3NENA 5LMNL 5JJKA 1VCXA 3J81j 1IBML 3UDGA 3A44A 5C4XG 3L2PA 3RZTA 2VY3A 3CAMA 3I4OA 1D7QA 4DR5Q 2C35B 5H1SE 1LUZA 1E8JA 4AR4A 3HKSA 3A5ZB 4LFCL 3HOXG 4JI4Q 4Y52H 1IRNA 1HZ9A 1PVOA 1Q8KA 3PCOB 3KLWA 3PV0A 2WAQE 1Q81C 2IY5B 2QL0A 1PYBA 4GLVB 3UDXA 2ATWA 1L2FA 5IYDH 5M5XH 2ZTCA 3GDEA 5IY0A 3CCMA 4GOPA 3G48A 4LUVA 2IHFA 1SE8A 2VS1A 4GKKQ 2FXQA 1LTLA 4A4IA 4DV3L 1XNQL 1Q1BA 3BZKA 2JK8A 2E5LQ 4LF4Q 3FP9A 3TS0A 1X3EA 4DV1Q 4DR1Q 1XNRL 4NB3A 4L5TA 4P74A 1L1OA 2F4VL 1X3GA 3PIPA 2UXBQ 1YVCA 1XPRA 2F52A 1YJ9A 1YK4A 2GMGA 2BA1A 2LSSA 5FLXc 2YTVA 1RB9A 2R6GA 5AI3A 2KENA 1NTGA 1W3SA 4HJ7A 1OXUA 4QL5A 1YK5A 2VQEL 2ASBA 2KN9A 4LW1A 1VQKA 3I4MH 3CXCA 4A3KH 3U58A 4YY3Q 4LNQA 4YWKA 4A3EG 2E2JH 5AJ3Q 1N36Q 1V1QA 4KLKA 1FHMA 3A5UA 2LXKA 1CADA 2R7FA 3I4NG 1P16A 3CCRA 4A93G 5IYBG 3GTMH 3J7A5 4A3CG 1UE5A 2IHEA 4A3MH 3GTQH 3KYYA 2PMZE 3K81C 4GS3A 3ICEA 5IYCH 3DLLA 4JBKA 4YHHQ 4O2DA 2ZTDA 3ULJA 2ZM6Q 1T9QA 3CQZH 4PZ6A 4JBWA 3OTOL 5IT9c 1YJNA 3CCLA 3D0FA 3HOVH 3PO3H 1ASZA 3SS2A 1B7YB 1HJPA 1UE6A 1VCIA 4YCUA 4HIDA 2E2HH 3J81c 1EWIA 1SFOH 1M1KC 4QGUA 4LF6Q 1NNQA 1SMXA 4LFAL 1I3QH 2RDVA 1XPOA 2NVXH 3GO5A 1PHJA 4LF5Q 4K0KQ 1NY4A 2Q2HA 4BBRH 1BE7A 5GADC 4GKJQ 3CCQA 2MQHA 5C0XI 5M3FG 3G4SA 1IBMQ 4UPAA 4UP7A 3KJOA 3GTGH 1YNXA 1UE1A 2Q2IA 3G71A 1CUKA 5C44H 4DR5L 4JI4L 4LFCQ 4IPCA 4L5RC 1AH9A 5IP9H 3GTPH 4AR3A 1Q1EA 1VQCA 1VQBA 2NZOA 2Z0SA 1KHIA 2HIXA 1RDGA 2PQAB 4UP8A 1XMOQ 3KDFB 1Y1VH 2KHJA 4PMWA 1NBWA 3STBD 4A3JH 3ULPA 1JB7A 3M4OH 1KC8C 3AEVA 4GKKL 4HJAA 3F2DA 1UEBA 3W5OA 5IYDG 3S2DH 4X65L 3I56A 1QVGA 4OX9L 1FVIA 4WJ3M 4DV6Q 2E5LL 4LF4L 4JI6Q 4BXXH 4DV1L 4DR1L 2KKDA 1VQ7A 1XNRQ 2PI2A 5M5YH 1IBKL 2F4VQ 3KOJA 3KYXA 2A1AA 1EQRA 1Y1WH 2I5HA 1CKNA 4LUZA 3TS2A 1SMUA 2DGYA 4EX5A 2AWNA 1S72A 4IFDG 2JA9A 3S17H 4LUOA 1K83H 4OWXB 4LF7Q 4PG3A 4QY7A 4YY3L 2N3SA 2K14A 2DUDA 2R92H 4OO1G 3I4MG 5AJ3L 1N36L 1UWVA 2QGQA 5IWAQ 4A3KG 3BZCA 1H95A 1AE3A 5IP7H 1YHAA 2BH2A 4RXNA 4JI0Q 1TWGH 2KCMA 1GD7A 1R0JA 5J3BA 4DV2L 4A76A 3E9IA 2OQKA 1VQEA 2K50A 4IO9A 1IL2A 4B3SL 2WAQG 2ZM6L 2R93H 1PH4A 2PYAA 4A3MG 1NMFA 1YI2A 4A3GG 5IYCG 2KHIA 3I55A 4POFA 5C4JH 2NVTH 2YU9H 3HOVG 3PIOA 3FHWA 3F2BA 2E2IH 2VQFQ 2Y0SG 1MIUA 4LF6L 3PO3G 4AYBE 4LWCA 2UXDQ 2LCQA 2RCNA 4O0AA 4DK3C 3RZDH 3HKZE 4LF5L 3KFUA 3CC7A 5GROA 3PUXA 4DV5L 3S15H 1WJJA 1RWDA 1RYTA 1OXTA 1T9OA 4FDBA 2ALYB 1PH7A 4DUYQ 1BFYA 4GKJL 4GN5A 3MPSA 1PH3A 4BBRG 1BRFA 3RN5A 1IBLQ 3M4PA 1L1OC 1QYBA 1PFSA 5GAGC 1PH2A 2R7DA 2OCEA 6RXNA 1GO3E 4OONA 3OW2A 4A75A 1OXXK 2IT1A 5C44G 1NMGA 1R9TH 1XMOL 2GN5A 1FJGQ 1VQ6A 1WOCA 1IZ6A 4P73A 1HR0W 5IP9G 4A3IH 1NJIC 4B3RQ 5IE8A 1QUQB 2A8VA 4JI3Q 1EYGA 4P75A 4R4CA 3ERSX 3PUVA 3CCJA 1N33Q 4A3LG 2OQ0A 4MNOA 2B3GA 4X65Q 2YV5A 4DV6L 4BY7H 2JQOA 4JI6L 2R7ZH 1S2ZA 1XJVA 3HFZB 3T1HL 4BXXG 1IBKQ 2JEBI 1PH9A 1BBWA 1TWHH 3GTOH 4AR5A 1N9WA 4QIWE 4DV0Q 3CPWA 4ALPA 1OXSC 4UP9A 1YBYA 4HIMA 4GN4B 4X6AH 1PYSB 4DR3Q 1HNWQ 4LF7L 3K7AH 3NBHB 1TWAH 2XTIA 1BQ9A 5DLQE 3UE0A 4A3DH 4DR7Q 3JAMc 3S1NH 4JI1Q 3LGJA 1E1OA 1KRTA 5IWAL 5M3MH 2B63G 4BBSH 2IX0A 2R92G 3PUYA 1I5FA 1B2JA 2D0OA 1U5KA 2I5MX 7RXNA 2NVYH 3L7ZC 1LKOA 1LYLA 3PUZA 4MTNA 1C7YA 5IP7G 4DV2Q 3KYWA 2CCZA 1QVFA 1BVSA 4GNXC 4JI5L 4B3SQ 3PO2H 3CCSA 2K4KA 2HQLA 3U4VA 3KF6B 3IRBA 3ULLA 1IXRA 8RXNA 4YWMA 1E1TA 3JAMi 5C0XJ 1VQOA 1KXLA 1GVPA 1X54A 3D31A 3ER0A 4GLXA 1I94Q 3M3YH 2DSXA 4OX9Q 2R93G 1JT8A 2VQFL 1I6HH 4LFBQ 1PH1A 1WYDA 1YZ6A 1VQ4A 2UXDL 1BKBA 3G6EA 2N8NA 1B13A 3W1GA 1X9NA 3CF5A 1R0IA 2AKWB 4DV5Q 1Q82C 5JJIA 1EOVA 1Q7YC 2L15A 4IFDI 2Q2UA 4DUYL 1Z47A 4R4IA 5GAHC 2MNAA 2UUAL 1L0WA 1IBLL 5K36G 4IOCA 4IJHA 4OO1I 5FLMH 4GNXA 2HT1A 2RHQB 4DAYB
chains in the Genus database with same CATH superfamily
2RF4A 1J5EL 4QJFA 2EDGA 1B1ZA 2AWOA 2KCCA 2D9UA 3DM1A 4RCNA 4BA1I 2IPKD 3BVZA 2SEBD 1LLRD 1ESFA 1K73C 4HSPA 2SNMA 1W2BA 3VR3A 2RA4A 3GTKH 5HGTA 3MHBA 1I50B 1KAWA 1A62A 1PV4A 1OXVA 1JICA 5BN3A 2JA6H 4OIKA 3I4NB 2ES2A 2OTLA 2ZT9C 3RZ6A 2KBNA 4DR7L 1R4PB 1B71A 2WV6D 4JI1L 2ZTEA 2V3BB 1GHJA 4A3DG 4QMGA 1ONLA 4AI2A 3ND9A 4K9FA 3DWAA 1YUZA 1TWFB 1JC7A 1EEID 1SMYC 4CDFC 3D3RA 2OEOA 3A55A 1VZGA 3W2DA 1TS5A 2BDOA 1EQTA 3PMFA 1WCMH 4BY1L 4LF8L 4KV6A 1I94L 4K5XA 4OX9L 4IPHA 4JC0A 4A3EH 2V0EA 2F1MA 5E4WC 1MSHA 4QQBX 1ICWA 4JVZA 1EWHA 2JN4A 4L63B 1I6VC 2XGTA 2PVXA 1R0GA 1YITA 5GADc 3HOYH 4ME5A 5DEHA 3RLNA 4CKBA 3KJPA 1C9OA 5C4XL 3WWVA 5M5XB 1O78A 2UU9Q 5JJZA 3HAXC 1NE3A 2LXJA 2EYFA 1QJOA 4P72A 4DV4Q 2KECA 3DWQA 3RZOH 4X66Q 1CTMA 1JE5A 4YCVA 2F0TA 4A3BH 1B9NA 4YCWA 4C3HL 3T1YL 4KTAA 2H5XA 5FJ8H 1HNXL 4KD3A 5EBDA 3M7NA 4DKAC 1HZBA 4DR2L 3I90A 2A6ED 4MIUA 4N8FA 3I4MB 3M85A 1SYBA 2PI2E 2A68C 1Y1WG 3KBGA 3CCVA 1YIJA 2ZXRA 2VB3X 3A56A 4IUVA 3LWEA 5CV4A 4U68A 5F2DA 1BXTA 4XQJA 4KI0A 1A3UA 2JA6G 2ID0A 1HNZQ 2EYPA 1X56A 2QILA 3E0EA 2YTXA 1CKNB 1GUNA 3PSIA 1SROA 5EKKA 1SE4A 5M5WH 1RCVD 3RYGA 2EPBA 2E8GA 2VW9A 4CJ0B 4A93L 2E2HB 2H1EA 1GXDC 1RKNA 1EWCA 1XTDA 1WCMG 1PFYA 4ME3A 4H44C 1FR3A 2FHTA 3HOUH 3SGIA 3TMEA 4LAAA 4C2MH 1X55A 5DM71 1NAPA 1ASYA 4B8CD 4DR4Q 3GTPB 4AQYL 4DK6C 3HOZH 4X64Q 5IGDA 1IYJB 1Y1VB 3OIQA 5M3FL 4A3JB 2UU9L 4QCLA 3HOYG 5ELEA 1O7IA 4AR6A 4DV4L 5GAGc 3S16H 3S2DB 4HJ5A 1ENFA 1STBA 1D5MC 4JW0A 4X66L 1IHZA 4A3BG 1X65A 1A8VA 2L55A 5K5PA 1IROA 4BWGB 1HR0Q 3KF8B 1KIXA 1S5ED 1EUJA 5IYDL 3HOXH 5FJ8G 1ILQA 3PIO1 4GS7D 1QWYA 4KJNA 4UY8C 2IX1A 1SNOA 1F2ZA 1YEZA 4XYOA 4O42A 3BVGA 2VB2X 4M8AA 3E9HA 4R4TA 4A3LH 3EBEA 4I7ZC 1BQ8A 3FDJA 1HNZL 2CQOA 1PZID 5RXNA 1XNQQ 4H7BA 1S30A 2Z3RB 3NBHA 3ND8A 2K75A 1QZGA 3NWSA 1PFBA 4MHEA 1PRTB 2J0TD 2KOLA 3H3VH 5ELOA 4TQUS 4K5WA 5C4JB 1IU5A 4H13C 3B6YA 1EYAA 1G291 3EN2A 5TSSA 4ZN3B 3GTQL 3CPFA 4JBJA 3MXGA 3HOVL 4C3JH 2MS3A 4POGA 5IYBH 3HOUG 3PO3L 2PW7A 3I2ZA 4C1NK 1D1KA 4A3CH 1LKPA 5MFPA 3CP0A 4LMQD 4DR4L 1SFOL 2MO1A 1MBYA 1E22A 2EXDA 4X64L 2V0FA 2EY5A 3LWRB 1WTWA 3HOZG 3H3VC 1DOKA 4R8IA 1WTHA 3D4WA 2CR8A 1OWBA 4HIKA 4RG1A 2M6PA 3CMEA 4GOPC 4R1JA 2FINB 2EZVA 4K8IA 1RF2D 1HH2P 2A6HC 3FVQA 1HR0L 1SLJA 2K01A 1TS2A 5IGBA 1K8MA 4UDUC 1IBML 3RZTA 2VY3A 3CAMA 1D7QA 3HOXG 3K0YA 1E8JA 4Y52H 1EY4A 3K7AB 1CZWA 4A3DB 4IUUA 4RHRA 1VF5C 2XJTA 1STEA 1Q81C 1SYCA 2QL0A 1BF4A 1H9KA 1A6XA 1L2FA 2ZTCA 3GDEA 3NFPI 1SE8A 1Y1WL 3VPBE 1LTLA 1XNQL 5EGTA 2O5JC 3FP9A 3WWLA 1X3EA 1KAAA 4NB3A 2B5ID 2K1BA 3KK7A 1LTSD 3PIPA 2B2UC 3IFDA 1YK4A 1G6ZA 2L4NA 2LMCB 1I6HB 2F03A 1TS3A 3QB3A 2BCOA 2AUSB 1YK5A 4OO1H 1CT1D 4A3KH 1SMYD 4XYQA 1SJED 4YWKA 2R93L 5AJ3Q 1V1QA 1VZIA 3A5UA 1CADA 2NVTL 2YU9L 1LTTD 2R7FA 3BG3A 4C3JG 3CCRA 5IYBG 3GTMH 4A3CG 4LHLA 2IHEA 3KYYA 1CZGA 2F0GA 3K81C 3RZDL 2B2TC 3ICEA 5D3DA 3VA5A 4O2DA 2ZM6Q 2ERSA 3CQZH 3VR6A 3HGBA 3EFXD 1ASZA 3IFTA 2RSNA 5KNCA 2XRQD 2RDVA 2NVXH 3GO5A 1MGSA 3KLSX 5MGNA 4K6DA 4U673 5K2ME 1PHJA 1CHQD 3RD4A 4BBRH 4K8JA 3GTKB 3CCQA 4A3IL 5C0XI 1HCZA 5EKIA 1A2TA 2XVSA 4UP7A 3IU3I 4BS9A 3GTGH 5C44H 2JA6B 3TP7A 2PW5A 1XWEA 3QIAA 3RMHA 3SE0A 1AH9A 2K03A 4AR3A 1VQCA 2NZOA 1VQBA 1FYCA 4IUPA 3J81E 3IAYA 2NYDA 4FVMA 4KN7C 3N52A 1I4GA 1KC8C 2Q8IB 3V05A 3AEVA 1SXTA 3U9SA 4J8QA 4NW2A 4WJ3M 1LTBD 4BXXH 2A68D 2DNCA 4ZYSA 1YNNC 2KKDA 2A74C 1XNRQ 1SSOA 4EQPA 4JPBW 1IBKL 2F4VQ 3NTIA 1WCMB 1X3PA 3NPPA 3TZDA 2A1AA 2TSSA 3DMUA 5KYIA 4EQNA 4A3EB 2I5HA 5M5YL 4LUZA 3TS2A 2NVYL 2AWNA 2A5HA 1K83H 4QY7A 4ZLTF 2N3SA 2R92H 2F0MA 4OO1G 5AJ3L 1UWVA 4EQOA 4A3KG 1SE3A 1YHAA 3F2UA 2BH2A 4JI0Q 2PPBC 1TWGH 3M3YL 1DOMA 3P1HA 3HOYB 1R0JA 2EY2A 2HCIA 4IO9A 2K50A 3HOUL 4ZKCB 4B3SL 1F9QA 4XT1B 2ZM6L 2PYAA 1D2BA 2Z4IA 3RZOB 2KHIA 4A3BB 2WKCA 4XGHA 3F2BA 1EY8A 1HQRD 1MIUA 2Y0SG 4KY5A 3HOZL 4E6IA 2LCQA 2RCNA 4DAPA 3PUXA 4Q0FA 2ALYB 3LNNA 3S14L 4K2KA 4BBRG 3RN5A 1KNEA 1I4HA 4IZ8A 3VR2A 1BNZA 2F0OA 5D14A 4NKLA 3VR4A 2PNRC 3QWNA 4A75A 5C44G 1NMGA 1CI3M 2GN5A 3X3MA 4RGOS 1QUQB 4PV1C 5LHY1 4JI3Q 4P75A 4R4CA 3ERSX 3PUVA 2JA5L 2HD3A 3AMUA 2B3GA 4X65Q 5M5WB 4BY7H 2MP1A 3GTLL 1D6EC 2JQOA 5I6WA 1PFUA 2R7ZH 2Z9HA 1XJVA 2PZWA 4CKEA 1PTOF 3HFZB 3MVVA 4BXXG 3EROA 3GTOH 2O2LD 4AR5A 4DV0Q 4F8MA 3CPWA 3NWTA 4IUNA 3U9OA 1GUWA 3HOUB 1EZ8A 3BDLA 4C2MB 1TWAH 1BQ9A 5CV8A 5DLQE 1E1OA 2IX0A 2R92G 2JI2A 4JI0L 2I5MX 3HOZB 1HFGA 1C7YA 1JWSD 1AN8A 3SEBA 4DV2Q 2CCZA 5CR3A 1QVFA 4ZK9B 4KKUA 4ID6A 2H4OA 4GNXC 1JWUD 3U4VA 3KF6B 3IRBA 3S16B 8RXNA 1PTOH 3D31A 4GLXA 4LFBQ 4C2M1 2EYMA 1R0IA 3HOXB 3MZ5A 3P2AA 1TR5A 1Y8NB 3QO2A 3SK6A 1QNKA 3IL8A 1L0WA 4IJHA 3WOFA 4CKCA 1KLUD 2K04A 1TY0A 5BN5A 1A0IA 3S24A 1VQJA 2A19A 4JI8L 3C46A 2F0FA 3URYA 1J8IA 2A6HD 3JR7A 4JI3L 4TPUA 4WFN3 1PMRA 2F0IA 4TVAB 1HTLD 3K58A 3F1ZA 5HGQA 3CD6A 3S2HH 4BY7G 1PH5A 3GTJL 2I07B 4KHZA 1G51A 1KL9A 4DV0L 1W6JA 4GOPB 5C3WA 2PSMC 1RODA 3WDNA 5FKAC 3TP6A 2O5JD 3QG1A 1DJRD 4C3JB 1I4QA 1TWCH 2JA7L 2KCTA 1L1OB 3MFGA 4WJWA 2Q2TA 1S5DD 2K33A 3UDFA 2JEAI 3MC0B 2K5QA 4XIGS 3ITPA 3OOCA 5ELNA 4EQ5A 4KHPQ 2SDFA 4TRDA 1QCVA 3JC66 1T9PA 3T13A 1RJTA 3FKIH 4PZ7A 2VL6A 2Z4HA 2CKCA 5JAVA 1JYBA 3PUWA 4QUCA 1JMCA 1EYDA 2N78A 2G5DA 2OWOA 5EKLA 3S1RH 1VF7A 4LFBL 4Y7NL 5KNDA 4RCOA 3MSUA 4FXDA 1DZ1A 3AFPA 4JV5Q 4K2LA 2VNUD 3CC2A 4AHWA 5I2XA 4CJ2C 5C4ZA 2XIWA 2F4IA 1HZCA 4IOAA 3VDYA 4ULLA 2UUAQ 3R3OA 5FOBB 4WORA 1VQLA 1STAA 4QF4A 1J5EQ 1SNQA 2BE5C 5C5LA 4JK1C 2EY6A 1PRTC 4H0LC 3T56B 2GVBA 3KBXA 3L0OA 1Y1VG 4A3JG 1GUTA 2UUBQ 4ZQ3A 2PQAA 1P8LA 3EA6A 5C3EH 2QA4A 3NELA 1CHPD 1IYUA 1DX8A 4FF4A 5J22A 3P7JA 3I7FA 3LX0A 3PGZA 5CC4A 5AI2A 1AEXA 1CQFA 1LT4D 4LF9Q 4A3KB 4B3TQ 2RHSB 3M9BA 1GKHA 2IX3A 2Z6KA 1YNND 3K0XA 2B2VC 4APVA 5CBAE 1NNXA 3UDIA 5BN4A 4DGZA 1GJXA 1ZEQX 3D4RA 1RIPA 2Y0SE 1KD1C 1SR3A 4RGMA 1I50L 2ZJPA 4KHPL 3CQZB 2ZJRA 2BDNA 3SK4A 2Y0SB 5JPMC 2WIIB 2JSOA 4G7OC 4IFDJ 3I4NL 1QNUA 1MI2A 4A3FH 1XMQQ 4JOIA 4LF8Q 3FKIG 2NVXB 4RAUC 3HOWH 4MN3A 1X32A 4BBRB 3OHXC 5LL6S 1TWFL 3A0JA 4JV5L 3S9WA 1EL0A 1BBUA 1EIGA 3S1MH 2CFMA 4I7AA 3GTGB 1NXGA 3FPPA 2NN6I 5C44B 5G3LF 3A8KE 1IW7C 1ZKOA 2B2UA 4C1NI 4A3GH 4JI2Q 2WINB 3HKZP 3H0GH 4YIJA 5E3FA 4KK7A 1BR9A 2M9VA 3R2IA 1SN8A 1JJCB 3TP5A 2K52A 4JI7Q 3K5LA 1RL2A 4GN3B 2XJVA 2UUBL 4B08A 2H12A 3T1YQ 4K5VA 1VQ9A 1HNXQ 2J9UB 5EPKA 5C3EG 1S5CD 5M5XL 4DR2Q 3QOLA 4FXGC 4MZ9A 1V43A 4AIMA 1Q86C 3H09A 1K83B 4F7XA 4LF9L 4BY7L 4B3TL 3O13A 2M6OA 2R92B 3HKZG 1CM9A 2Z8LA 4H02A 1H7VA 1MSGA 1ENCA 1TWGB 2FJ2A 1LT3D 4L8JA 5I9PA 1S4ZA 1YUXA 1E3PA 3H91A 3LWQB 2NVQH 1VQMA 3A8JE 4KKTA 1W6KA 3I4ML 1HTPA 5DM63 2X6GA 1WFQA 1AFPA 3D8GA 1MD2D 1VQIA 1DCZA 1XMQL 3NHHA 3H9CA 3BYTB 3CKIB 4HJ8A 4DNIA 3OIPA 3K7UC 3VR5A 4A3FG 1GUGA 1N8RC 1LKMA 2AQ3B 2B63H 2RSOA 1D5ZC 1XPUA 5C5MA 3BZDB 3CHBD 3HOWG 1KQSA 4E6YA 3HJWB 5CYUA 2E2HL 2WKDA 1CSQA 3J80i 2F0VA 1F77A 1VS0A 4AI3A 2K5NA 4AQYQ 4JI2L 4YHHL 3KYUA 4DK1A 3J80E 4C56C 3RNUA 3OTOQ 1TS4A 2E75C 2X6LA 3H0GG 3NQTA 4JI7L 1R4QB 1KTKA 1E2VA 1FHHA 3NTKA 3SK5A 2AHOB 1EIYB 4BY7B 2M2LA 2R7ZB 3H3VI 4GNXB 1HA5A 3GTPL 3E3XA 1C0AA 4FXKC 2Z3QB 3GTOB 3A8IE 1X3FA 4KN4C 1Y1VL 4A3JL 1HA6A 3A44A 1CFMA 3J7Z1 5H1SE 3D6WA 1LUZA 4AR4A 3S2DL 3HKSA 1TWAB 4RGNA 1IRNA 1PVOA 4KY7A 1V8QA 2CVRA 1J9OA 4FP5D 2IY5B 1PYBA 2EJFC 1FGBD 4LUVA 2IHFA 1GOZA 3C2PA 3TN2A 2FXQA 1E2WA 1FD7D 3NUCA 1KLGD 2XWBB 2JI1A 2XJSA 4L5TA 3OMCA 1KABA 3SHLA 2ERJA 1PTOB 5C4HA 2LSSA 2GMGA 1YJ9A 1RB9A 1W3SA 2K7VA 1CK1A 1EY5A 1QILA 4ZN1B 3U58A 2N55A 1BQQT 4A3EG 2E2JH 3Q23A 1WTXA 2CHBD 4AHXA 3DHQA 4KLKA 1D5XC 5C4JL 4U671 1P16A 2NZ1D 4OELB 3R2TA 1E2ZA 1RDPD 2C6BA 2Z1CA 1UE5A 4A3MH 2PMZE 5IYCH 3ULJA 2K28A 2KQ3A 3OTOL 3SS2A 1VCIA 1UE6A 2PMZB 3J81c 3HRZC 3IKJA 4QGUA 1NNQA 1I3QH 1XPOA 4UAIA 3S2HB 1PXUA 1QCBD 4QUFA 5KEEA 4DXFA 4CJ1B 4X3KA 2BE5D 3G4SA 5C3XA 1IBMQ 4IALA 1PRTD 3HJYB 1YNXA 1CUKA 5IT9E 1TWCB 5IP9H 2Z0SA 2Z6BA 3KDFB 4OGQC 4X3TA 4V190 4TSSA 4WRDA 1RTOA 1UEBA 3W5OA 2EXZA 2JYOA 4KY6A 4KKSA 1FVIA 2F0HA 4OEMB 3HP3A 3K7AL 5A2QE 3FKIB 2PI2A 4A3DL 1EQRA 3FDTA 3S1RB 1CKNA 1SMUA 5CORA 2JA9A 3S17H 4LJZC 1SBBB 2DUDA 5IWAQ 1B3AA 1H95A 5IP7H 4RXNA 2KHSA 2KCMA 1GD7A 1I6HL 5J3BA 5JVG3 4A76A 1IL2A 4K14A 2WAQG 1PH4A 4A3MG 5IYCG 1JQYD 4HSVA 1G8ZD 4P2CB 3PIOA 1I4XA 3FHWA 2E2IH 2VQFQ 1B9MA 4LWCA 5C3EB 1AZPA 1IW7D 3HKZE 1LACA 3S15H 1T9OA 4FDBA 5K36H 1BRFA 3HKZB 4L6TB 1IBLQ 1L1OC 3SDZA 1PFSA 1PH2A 4ZKBB 2OXPA 3KF8A 2E74C 4OONA 1OXXK 2IT1A 4MTKA 1R9TH 2D2CC 5IP9G 1VMCA 3JAML 1NJIC 4DFAA 4B3RQ 2A8VA 1EQVA 3MFYA 3GTKL 1N33Q 1PFVA 1TIID 4A3LG 1T5EA 3DEPA 2PZTA 3HS0C 2JA6L 4N9PA 3OWEB 3NBIA 4A3FB 3T1HL 2Q8TA 1ESRA 2JEBI 1PH9A 1IBKQ 1TWHH 1LTID 1N9WA 2Q8RE 1H9MA 4GN4B 3HOWB 5FO7B 1XXGA 3J81L 2EVBA 1HNWQ 4AHZA 3S1NH 3VYUA 3S1MB 5IGEA 1KRTA 2D5DA 5IWAL 5M3MH 1EYCA 4BBSH 1WCML 3PUYA 1I5FA 1B2JA 3PUZA 1U5KA 3M4OH 4A3GB 4MTNA 3KLRA 4A3EL 5JEAH 5CV7A 5IP7G 3KYWA 3H0GB 4M1UB 1M4VA 1EEFD 1BVSA 4B3SQ 2K6AA 4JI5L 3PO2H 2M4VA 3CCSA 2HQLA 2B2WC 2DN8A 1IXRA 1VQOA 3JAMi 5I4DA 1X54A 3TDQA 1SDFA 3JAME 2VQFL 2B2VA 1WYDA 3KUPA 3J7AV 3HOYL 3TP8A 3WWNB 1IYVA 4OIJA 4IFDI 2Q2UA 3MA2B 4WFN1 3HZXA 4R4IA 1NR2A 2EJMA 5GAHC 2MNAA 1IBLL 3RZOL 4A3BL 4IOCA 5K36G 5FLMH 5KYLA 2HT1A 1PFMA 2RHQB 4DAYB 5COYA 3J81i 5CBEE 5FJ8L 3CCEA 1DONA 2VUMH 1K9MC 3I8ZA 4XQNA 1FGUA 4B3RL 1U4MA 2NVQB 1QB5D 1N33L 1K3BC 4IJLA 4JCVE 1K8AC 2QEXA 4R9WA 5CV6A 4JADA 3PWFA 4X6AH 1DGSA 2CWPA 2P5ZX 3RLFA 4C3IH 2JJQA 1PA6A 3S1QH 2F0JA 4HIOA 4L5QA 2G9HD 4YWLA 1R0HA 2QKIC 2WB1G 1JE4A 2B63B 1DXMA 2OTJA 2Y0SP 1VQGA 5ELFA 3VYRA 1HNWL 2D62A 2O4XA 1ICFB 5M5WL 3K8AA 1MJEA 5GAEC 2WP8J 4G57A 2C9OA 1VQNA 2PYKA 4DXGA 2LY7A 1N34Q 5M3MG 2HR5A 1LT5D 3M4QA 4JAEA 5GQOA 4LHNA 3RR5A 4BBSG 5DAUA 4DR6Q 3LPEB 3F8TA 2RDGA 3PZAA 2JP1A 2DJGC 4HEDA 4DAMA 1F4LA 5JEAG 1WTRA 1V1OA 2JA8H 2MO0A 4PZ8A 3PO2G 1PH8A 4HJ9A 1E7ZA 3MXNB 1A3VA 5LMUL 3MQKB 2NZHA 3BJUA 1R0FA 1DOLA 3TRZA 4V196 1VMPA 3FEWX 5HY6A 4X3SA 4EVOA 1M90C 4B3MQ 1B8AA 1SNCA 2V1CC 2E76C 3ONAB 4F88A 5KGUA 3S16L 3Q8DA 4OL7A 3ZG6A 2EIFA 4G4KA 3CU7A 2F3IA 3PF5A 1K8GA 2K32A 5FLMG 3EIVA 4JI8Q 2TMPA 3AFQA 2RFKB 1F2YA 1F9SA 4JAGA 3HOXL 3X3NA 2LFNA 1QG7A 3GD7A 3PIP3 3K5NA 4HMJA 2CW0C 1VQ8A 3E5SA 2I0QA 1FNUA 4P71A 3STBC 3DXJC 4HCSA 3VYTA 4A3LL 2JI3A 4Q5VA 4ILWA 3M4YA 1EY0A 4J1MA 4C3IG 3PQIA 2AYJA 1IL8A 2E2JB 3J7ZC 1ZYRC 2BA0A 1SRUA 1N34L 3E0JA 3NE5B 2WAQB 1CAAA 1C09A 4A3MB 1CKOA 2DY7A 1E24A 4DR6L 4JYAQ 1Q46A 4NXMQ 3JC63 4C3JL 5IYBL 1Q12A 4ZCKA 2IL8A 3K80C 4A3CL 1LTRD 4AH6A 5C0XH 1RD9D 2ZJQA 1I3QB 2WFWA 3MXUA 2L9HA 2JA8G 1WJVA 2KEDA 1YJWA 3H97A 1ENAA 5BR8Q 3Q6SA 1VZHA 2NTTA 5EJWA 3PKIA 1QZHA 1WD0A 1JWMD 4B3ML 4BY1H 1HRJA 5JEAJ 4J15A 1H9SB 3ZJYC 2AMCB 1SYEA 4JG2A 2E2DC 1LTAD 3T51B 2PCFB 4GLAC 2HCCA 1KDCA 3H6MA 2FMMA 1TXYA 1SNMA 5HURA 1IKLA 1WVLA 1SYGA 1PTOC 4Y52L 3CMAA 1B2OA 2WACA 1NSNS 3NTHA 4CBVA 5C4XH 2MFIA 3TQYA 1QUQA 1TQOA 5AFWA 2RVLA 3AYHB 4XTCS 4XQQA 2R7ZG 5DM61 2B29A 3B08B 3CC4A 4C3HH 3S17B 4AYBG 1PZKD 1YNJC 1LO5D 1B70B 4OWTB 2BOSA 1AE2A 1YHQA 1TWHL 3BDOA 2BH8A 4CGYB 1VQHA 3I72A 1PDQA 5C6AA 4IPGA 2HDMA 4DV3Q 3K35A 2C5CA 2M00A 2RCFA 1T5XD 1T9HA 1K0RA 4A3KL 4JYAL 3Q22A 1A3TA 2UXBL 1YV1A 2XJRA 2YYZA 1IU6A 4NXML 5A35A 1Q8IA 4JBMA 1QOHA 1QVCA 1JB3A 2E2IB 3J80c 1EFWA 4R4QA 2ZIXA 3GTML 3S15B 5C0XG 4OXPA 3NEMA 3KF6A 5BR8L 2PMZP 4RGTA 3CQZL 4A93H 1CKMA 1F2LA 2CQAA 4JAFA 3H15A 1ET9A 4BY1G 3DM3A 2F3VA 2NVXL 1R9TB 1K3RA 2O5IC 2J4XA 4FYDA 4BBRL 5H1Sc 1BCPB 1Z7TA 2NTSA 3DWPA 1SMMA 1S5BD 2WB1E 1V1PB 3GTGL 5C44L 4LFAQ 5CMDA 4K0KL 4DF7A 3UE1A 3LWPB 5M3FH 2WB1B 1TWHB 2B2YC 5JJLA 3NENA 1SYDA 4XXBB 5C4XG 3UDGA 5CGKA 3LWOB 2C35B 4JI4Q 4LFCL 3A5ZB 1HZ9A 3CRKC 4BXXL 4C3HG 3PCOB 3S1NB 3I3CA 3TSSA 3FRPB 5M3MB 3UDXA 1WD1A 3S1QL 4BBSB 5IYDH 3CCMA 4GOPA 3G48A 3M4OB 3CRLC 2HDLA 3H3VM 2QDLA 4A4IA 1XX8A 4DV3L 3GTMB 2L0ZA 1Q1BA 3BZKA 5NUCA 2E5LQ 3TS0A 1K83L 2AUJD 4DV1Q 3PO2B 1L1OA 2FMCA 2R92L 3Q24A 1YVCA 1XPRA 2F52A 1NXEA 5FLXc 1CA5A 2YTVA 2KENA 1TWGL 1NTGA 4HJ7A 4FF3A 2KN9A 4LW1A 1JORA 4UHVA 4YY3Q 5IOCA 2F0KA 1N36Q 2K5WA 1FHMA 1UAPA 4A93G 2PQEA 5MFZA 3J7A5 3C1EA 5AN9H 3GTQH 4GS3A 3DLLA 4JBKA 4YHHQ 1HHVA 2F0DA 3HOVH 4PZ6A 4CDDC 1YJNA 5IT9c 3CCLA 3DEOA 3D0FA 3PO3H 3OWFA 1B7YB 1M1KC 2PPTA 1EWIA 3BS1A 1SFOH 4LF6Q 1PYWD 1ODHA 4LFAL 4G7HC 4LF5Q 5MLC3 1NY4A 4AHYA 3EVQA 1G91A 2Q2HA 4C3IB 1BOSA 5GADC 1WTQA 3S1QB 2EYLA 2MQHA 5M3FG 4FO2A 2B2TA 4UPAA 3KJOA 1UE1A 2Q2IA 3G71A 4JI4L 2B2WA 4IPCA 3J80L 4L5RC 2B8FA 1Q1EA 1WTVA 4FF1A 2QW7A 2R7ZL 2CW0D 1KHIA 3UI2A 1XMOQ 3H94A 2KHJA 4PMWA 1NBWA 3STBD 1JB7A 3GTOL 1DM0B 4HJAA 3F2DA 5IYDG 1QE6A 1QVGA 4RFBA 2E5LL 4NDXA 2L12A 3WOEA 4I65A 2R61A 1UNSA 4DV1L 2B8GA 1TWAL 1VQ7A 2JA8B 3KOJA 1ZYRD 5JVG1 3TBIB 3TZUA 1Y1WH 2F3WA 3M7GA 4X3UA 2XJQA 1OWCA 4EX5A 1S72A 2EY1A 4LUOA 4OWXB 4PG3A 4YY3L 2K14A 3NQIA 1RTNA 1N36L 2DNEA 4XDXA 1II3A 3BZCA 2PZUA 1AE3A 5E1FA 2F0EA 2F0QA 3VYSA 2ENBA 5IGFA 3E9IA 1VQEA 4KMUC 1U4RA 1AZQA 5L37A 1EOTA 2FFKB 1BDOA 2ZXOA 2R93H 2XSCA 1L0YB 5D3IB 4FF2A 4A3GG 2EY4E 3NSWA 3I55A 4POFA 2NVTH 2YU9H 3HOVG 3PO3G 5JOBA 1BBXC 1NR4A 4LF6L 4AYBE 3L3OC 2HVYC 4DK3C 5M9OA 3RZDH 4LF5L 3CC7A 4RH6A 5GROA 4DV5L 1GUOA 1OXTA 3GV3A 4AYBB 4DUYQ 1BFYA 4GN5A 3MPSA 3L9AX 1CQVA 1MHWC 2ZXPA 1PTOD 5GAGC 5FLXL 1WTPA 2OCEA 1GO3E 2NBFA 1OO9B 3MWYW 1FJGQ 1XMOL 4DN4M 1LABA 3S2HL 1WOCA 1HR0W 4P73A 5IIFA 4A3IH 5J39A 3CCJA 1KDBA 4ZUIA 2RDHA 1S2ZA 1ET6A 1YNJD 1TWCL 5D65A 1C8CA 3V2TA 3A7LA 3MEHA 5IT9L 4ALPA 1YBYA 4HIMA 3G7LA 2KA7A 2IJ0A 2NN6H 5FO9B 5I2YA 4DR3Q 1O7LA 3NBHB 3UE0A 2KJXA 1IKMA 3JAMc 4BY1B 3FKIL 1C4QA 1BUVT 2XN9C 2B63G 2SNSA 5DNFA 2NB0A 5M5YH 2D0OA 4RKBA 5JVH3 2NVYH 7RXNA 1I4PA 1PFNA 3L7ZC 4PNYA 3S1RL 5A2QL 2JXMB 5FLXE 2NWGA 2A69C 2CH4W 2K4KA 3PKJA 2ICEC 4YWMA 1E1TA 5CV5A 2R93G 3E6ZX 3ER0A 3M3YH 2DSXA 1JT8A 2NUCA 1PH1A 1VQ4A 2G9DA 2KCNA 3AU7A 5C4XB 4HMIA 4HTHA 1A2UA 2F0NA 2L15A 4DUYL 2MPMA 4C3HB 4OO1I 1K28A 4GNXA 1ZRPA 4RMFA 5C3EL 5EAYA 1FJGL 3KYHC 4ZRZA 4DV7Q 3S14H 1HUMA 1C48A 3QQCE 3KLSA 4A3IG 1VQDA 3J7Y1 2HIVA 1LTGD 4BA2I 1VQPA 2WAQP 4O1NA 5EBCA 3T1HQ 4DA2A 2K5HA 2B39A 2MJ8A 1EIFA 2RQXA 1U4PA 2JA5H 3Q0AA 3GTLH 4DR3L 4AI0A 3A74A 3BU2A 1TVXA 2NN6G 1GUSA 2PNHA 1J6QA 4A93B 2LS01 1D1IA 2QCPX 4A3FL 4R4OA 3MTSA 3QOJA 3F2CA 3HOWL 4X62Q 3K6OA 4QB4A 1EU4A 1PZJD 1QQTA 1BCPF 1EQQA 4JI5Q 1LV9A 3S1ML 4IURA 3OYYA 4CHTB 4GZYC 1FL0A 4NMZA 1GM5A 1Z9FA 3TEHB 4A3GL 5M3FB 3KYVA 1VQFA 3H0GL 4N9TA 3PIP1 3CW2C 5JPNC 2UXCQ 2XRSD 3TREA 4HCEA 3V96A 1Q90A 5I9OA 1B53A 1G2TA 1U4LA 3AQQA 2HHHQ 1V9PA 1STYA 2D0PA 3FMCA 1B3QA 4DV7L 3NXWA 3LWVB 2QF7A 5KIXA 1LM0A 5LMNW 1PH6A 4RHSA 4DPGA 3H9BA 2Z6KC 1U0LA 1YHBA 1ILPA 1B2TA 2K5VA 3I73A 1S5FD 3KDFA 1UUPA 3C1FA 2I5LX 1M8AA 2UUCQ 4ZAIA 4HAEA 1NCVA 1DVBA 2RDFA 2CKZB 3GV6A 3PF4A 2VXWA 1X6OA 1LT6D 4DUZQ 4PMBA 3K59A 2NVQL 4IPDA 3U4ZA 3CCUA 3N6RA 2JA5G 1HZAA 4JOIC 2CWAA 4NXNQ 4B9WA 2HUGA 3GTJH 4RKLA 1UEAB 2XWJB 5LL6X 1BCPC 2B2YA 1CA6A 3GTQB 1RDVA 2GVAA 1F2MA 2RKSA 4X62L 4XXEA 2B63L 4KJOA 3RN2A 3HOVB 2L1BA 2JA7H 3PO3B 3D6CA 5G3LD 1A63A 4WJ4A 3HG9A 1SFOB 1MKHA 1PFWA 4RA8A 1D8LA 5EINC 2NYZD 1JR0D 5LMUQ 3QVDA 4DU9A 3FPUB 2IW3A 3BVMA 1JCKB 1VQAA 2UXCL 4ZUJA 2PO4A 2F0WA 1PZXA 4Y7NH 2WB1P 4N8X1 2HHHL 2VZAA 1Z6HA 3RLOA 1JJ2A 1MJCA 5E4XA 2MHVA 2AQ2B 3JC62 3MAQA 1JJGA 2PVEA 1F9RA 4AI1A 5DM73 2R3ZA 5E7NA 1EY6A 4G6BA 1EIHA 1O80A 1N32Q 1Q3LA 2SOBA 2UUCL 1CSPA 1EZ6A 2EYJA 5LMNQ 1Y1WB 1EFID 5EPJA 1S40A 1HXYD 4DUZL 4Z9CB 2M4YA 2C6AA 3P75A 4ODGA 3MEFA 3R93A 2EQSA 1JOKA 3EQLC 2EYOA 4NXNL 1SE2A 1UE7A 5J1ZA 1AP0A 3W1BA 4QIWP 1G6PA 1L0XB 2F0PA 2L5TA 1U9RA 3I70A 3NP8A 4OWWB 2XJPA 1STGA 3PIO3 2R93B 3A54A 3H99A 1HQMC 5MF6A 2E2JL 1O7YA 2NVTB 1S3OA 2YU9B 2JA7G 1KRSA 5EPLA 3U50C 2YTYA 2N88A 1STHA 3RZDB 2VQEQ 1I50H 1HPCA 4A3ML 3P20A 2V4DA 5IYCL 1Y14B 3I91A 3I4NH 3K5OA 2N49A 2A69D 1OTCA 3P8BA 5I6YA 1VQ5A 3OW7A 1FNVA 1SMWA 1F9PA 2JE6I 3SXHA 2L11A 1I3QL 1TWFH 1WI5A 4A3IB 5GAHc 4L5SA 1XTCD 2AQ1B 4NPSA 5EIOC 4DAYA 2VUMG 3G6JB 1BO0A 4B9XA 2K2DA 5IODA 4KHVA 2MGSA 2I46A 5IP9L 2GA4B 4NP5A 1S24A 1EU3A 1N32L 3LNLA 1RHPA 5LMNL 5JJKA 1VCXA 1G2SA 3J81j 5ELBA 3L2PA 3I4OA 1SNPA 3OMGA 1EY9A 4DR5Q 4IQZA 5EQ0A 1Q8KA 3OPOA 3KLWA 3PV0A 2WAQE 1B50A 4GLVB 2ATWA 5M5XH 1TT2A 5IY0A 5M5YB 4F87A 1A15A 2F0LA 1TY2A 2NVYB 4GKKQ 2VS1A 4R8NA 4DK0A 2QEJC 5T1IA 2JK8A 3S17L 5GAEc 4LF4Q 2HQEA 2IWHA 4DR1Q 4P74A 4KD4A 2DY8A 4CDEC 1XNRL 3AB9A 2F4VL 1X3GA 1DYQA 2UXBQ 1X3QA 3SVMA 3M3YB 4IFDH 2BA1A 2OT2A 5IP7L 2CH4A 2RBMA 1SNDA 5AI3A 2R6GA 1JOOA 1OXUA 4QL5A 2VQEL 2ASBA 1ML0D 5ISRA 1VQKA 3I4MH 3CXCA 4LNQA 3VA7A 4S3SA 2EYHA 3MXNA 2LXKA 3I4NG 4IUQA 3K5MA 2E2IL 2APOB 3DUZA 4AYBP 4OHJA 1NUCA 2A73B 3S15L 2ZTDA 3S14B 1T9QA 4JBWA 1I4RA 2XNAC 1DD2A 1VDZA 4YCUA 1HJPA 2L0CA 4HIDA 2E2HH 1E0BA 2XJUA 4DAVA 5CV9A 3B0AB 1SMXA 1Y69U 4K0KQ 4UY81 2EOTA 1TU2B 1BE7A 1R9TL 4IN3A 4GKJQ 4G7ZC 1O7ZA 2JA5B 4J6HA 5ELDA 2OF1A 4DR5L 3GTLB 1B4OA 3SR1A 4LFCQ 1SEBD 1KNAA 3LWUA 3GTPH 3ERQA 2LKVA 4FNFA 3D4DA 2HIXA 3QJYA 1RDGA 2PQAB 4UP8A 4XT3B 1Y1VH 4A3JH 2A6EC 3ULPA 4GKKL 4CDCC 3HEJA 3S2DH 1SYFA 4X65L 3I56A 1XYIA 4DV6Q 4LF4L 4JI6Q 4DR1L 1PRTF 2MUYA 3S1NL 4V0BA 3C3LA 3KYXA 5M3ML 3R8BA 4BBSL 1RYQA 3M4OL 2DGYA 1K0SA 1BCPD 3A7AB 4EGVA 4IFDG 4LF7Q 5KRUA 3I4MG 3PL5A 3PO2L 1PLFA 2EJGC 2DJFC 2ICIA 2QGQA 3T4AC 1EY7A 4DV2L 3NK9A 2OQKA 1Z92B 3T53B 2QDBA 1JOQA 1NMFA 1YI2A 1H9SA 5ELCA 1FNWA 3T16A 4DNTB 5C4JH 3W3AA 2F0UA 5FLML 2UXDQ 3GP7A 4O0AA 3KFUA 2X69A 1WJJA 1RWDA 1RYTA 2VUML 2J7ZA 3I4LA 5FO8B 3QR8A 1PH7A 4GKJL 3J7YW 1PH3A 5T1GA 3M4PA 4PMCA 1QYBA 2R7DA 6RXNA 3OW2A 2K05A 3GTJB 4HR7B 2KEEA 3BDCA 1VQ6A 1IZ6A 4X6AL 4C3IL 5IE8A 5KNBA 1TKWB 1EYGA 2OQ0A 1P7PA 4MNOA 2YV5A 4ABNA 4DV6L 4JI6L 2JA7B 1STNA 5IGGA 5JVH1 3MXPA 4LK1C 4RWSC 1BBWA 1GHKA 4QIWE 2EE1A 1B44D 1OXSC 4UP9A 3SK8A 1ZXTA 2KUMA 1PYSB 2AQCA 4LF7L 3K7AH 4QIWB 2AUKA 2XTIA 4A3DH 4DR7Q 3K57A 4JI1Q 3ZYYX 3LGJA 1HUNA 1H9JA 4TVMA 2JA8L 4Y7NB 1LKOA 1LYLA 1SAPA 2KVMA 3EJIA 5IGCA 2VUMB 1HFNA 4HN7A 3ULLA 5C0XJ 1AW7A 1KDAA 3J7AF 4DNRB 1KXLA 1GVPA 1I94Q 2CKAA 1WTOA 3RUZA 4OX9Q 1I6HH 1YZ6A 2UXDL 1BKBA 2F0SA 4TKOB 3G6EA 2N8NA 1B13A 4PQXA 3W1GA 1X9NA 3CF5A 2AKWB 3BYYB 4DV5Q 1Q82C 5JJIA 3GQBA 1K8OA 1EOVA 1Q7YC 1Y8OB 1Y8PB 3OSOA 1Z47A 1V1PA 4K6LA 5FK9C 2UUAL 1SJHD 4IUTA 2K5DA 1H9RA
chains in the Genus database with same CATH topology
2RF4A 1J5EL 4QJFA 2AWOA 4BA1I 1K73C 1W2BA 3GTKH 1KAWA 1A62A 1PV4A 1OXVA 2JA6H 2ES2A 2OTLA 3RZ6A 2KBNA 4DR7L 4JI1L 1B71A 2ZTEA 2V3BB 4A3DG 4AI2A 4K9FA 1YUZA 1VZGA 1WCMH 4LF8L 1I94L 4OX9L 4IPHA 4JC0A 4A3EH 2V0EA 4QQBX 2XGTA 2PVXA 1R0GA 1YITA 5GADc 3HOYH 3RLNA 3KJPA 1C9OA 2UU9Q 3WWVA 1NE3A 2LXJA 4P72A 4DV4Q 4A3BH 3RZOH 4X66Q 1JE5A 4YCVA 4YCWA 3T1YL 2H5XA 5FJ8H 1HNXL 3M7NA 4DKAC 1HZBA 4DR2L 2A6ED 3M85A 2PI2E 1Y1WG 3CCVA 1YIJA 2JA6G 4KI0A 2ID0A 1HNZQ 1X56A 3E0EA 2YTXA 1CKNB 3PSIA 1SROA 5M5WH 3RYGA 2E8GA 2VW9A 1XTDA 1WCMG 4ME3A 3HOUH 3SGIA 4C2MH 1X55A 5DM71 1ASYA 4B8CD 4DR4Q 4AQYL 4DK6C 3HOZH 4X64Q 1IYJB 2UU9L 3HOYG 1O7IA 4AR6A 4DV4L 5GAGc 3S16H 4HJ5A 4X66L 4A3BG 1X65A 1A8VA 1IROA 1HR0Q 3KF8B 1KIXA 1EUJA 3HOXH 5FJ8G 3PIO1 4UY8C 4GS7D 2IX1A 1YEZA 3E9HA 4R4TA 4A3LH 3EBEA 1BQ8A 1HNZL 2CQOA 5RXNA 1XNQQ 1S30A 2Z3RB 2K75A 1QZGA 3H3VH 5ELOA 4TQUS 1IU5A 3B6YA 1G291 3EN2A 4ZN3B 3CPFA 4JBJA 4C3JH 2MS3A 4POGA 5IYBH 3HOUG 3I2ZA 4A3CH 1LKPA 5MFPA 3CP0A 4DR4L 2MO1A 1E22A 2EXDA 4X64L 2V0FA 3HOZG 2CR8A 1OWBA 4HIKA 4RG1A 2M6PA 3CMEA 4GOPC 4R1JA 1HH2P 1HR0L 1SLJA 1IBML 3RZTA 2VY3A 3CAMA 1D7QA 3HOXG 4Y52H 1E8JA 2XJTA 1Q81C 2QL0A 1L2FA 2ZTCA 3GDEA 3NFPI 1SE8A 3VPBE 1LTLA 1XNQL 3FP9A 3WWLA 1X3EA 4NB3A 2B5ID 3PIPA 1YK4A 1YK5A 4A3KH 4YWKA 5AJ3Q 1V1QA 1VZIA 3A5UA 1CADA 2R7FA 3CCRA 5IYBG 3GTMH 4A3CG 4LHLA 2IHEA 3KYYA 3K81C 3ICEA 4O2DA 2ZM6Q 2ERSA 3CQZH 1ASZA 2RDVA 2NVXH 3GO5A 1PHJA 5MGNA 5K2ME 4BBRH 3CCQA 5C0XI 4UP7A 3IU3I 3GTGH 5C44H 1AH9A 4AR3A 1VQCA 2NZOA 1VQBA 2NYDA 1KC8C 3AEVA 4WJ3M 4BXXH 2A68D 2KKDA 1XNRQ 1IBKL 2F4VQ 2A1AA 2I5HA 4LUZA 3TS2A 2AWNA 1K83H 4QY7A 2N3SA 2R92H 4OO1G 5AJ3L 1UWVA 4A3KG 1YHAA 2BH2A 4JI0Q 1TWGH 1R0JA 4IO9A 2K50A 4B3SL 2ZM6L 2PYAA 2KHIA 4XGHA 3F2BA 2Y0SG 1MIUA 2LCQA 2RCNA 3PUXA 2ALYB 4BBRG 3RN5A 4A75A 5C44G 1NMGA 2GN5A 1QUQB 4JI3Q 4P75A 4R4CA 3ERSX 3PUVA 2B3GA 4X65Q 4BY7H 2JQOA 2R7ZH 1XJVA 3HFZB 4BXXG 3GTOH 4AR5A 4DV0Q 3CPWA 1TWAH 1BQ9A 5DLQE 1E1OA 2IX0A 2R92G 2JI2A 4JI0L 2I5MX 1C7YA 4DV2Q 2CCZA 1QVFA 4GNXC 3U4VA 3KF6B 3IRBA 8RXNA 3D31A 4GLXA 4LFBQ 1R0IA 3P2AA 1L0WA 4IJHA 1A0IA 3S24A 1VQJA 2A19A 4JI8L 2A6HD 4JI3L 4TPUA 4TVAB 3F1ZA 5HGQA 3CD6A 3S2HH 4BY7G 1PH5A 4KHZA 1G51A 1KL9A 4DV0L 4GOPB 2PSMC 2O5JD 1TWCH 2KCTA 1L1OB 2Q2TA 3UDFA 2JEAI 4XIGS 5ELNA 4EQ5A 4KHPQ 1QCVA 3JC66 1T9PA 3FKIH 4PZ7A 2VL6A 2CKCA 1JYBA 3PUWA 1JMCA 2N78A 2OWOA 3S1RH 4LFBL 3MSUA 3AFPA 4JV5Q 2VNUD 3CC2A 4AHWA 1HZCA 4IOAA 3VDYA 2UUAQ 1VQLA 1J5EQ 2GVBA 3L0OA 1Y1VG 4A3JG 2UUBQ 2PQAA 1P8LA 5C3EH 2QA4A 3NELA 1DX8A 3I7FA 3PGZA 5AI2A 4LF9Q 4B3TQ 2RHSB 3M9BA 1GKHA 2Z6KA 3K0XA 4APVA 3UDIA 1RIPA 2Y0SE 1KD1C 1SR3A 2ZJPA 4KHPL 2ZJRA 4IFDJ 4A3FH 1XMQQ 4JOIA 4LF8Q 3FKIG 3HOWH 3A0JA 4JV5L 1BBUA 3S1MH 2CFMA 1NXGA 2NN6I 4A3GH 4JI2Q 3H0GH 1SN8A 1JJCB 2K52A 4JI7Q 1RL2A 4GN3B 2XJVA 2UUBL 2H12A 3T1YQ 1VQ9A 1HNXQ 2J9UB 5C3EG 4DR2Q 4MZ9A 1V43A 4AIMA 1Q86C 4LF9L 4B3TL 2M6OA 3HKZG 4H02A 1H7VA 1YUXA 1E3PA 2NVQH 1VQMA 1WFQA 1VQIA 1XMQL 4HJ8A 4DNIA 3K7UC 4A3FG 1N8RC 1LKMA 2B63H 1XPUA 3HOWG 1KQSA 4E6YA 1CSQA 3J80i 1VS0A 4JI2L 2K5NA 4AI3A 4AQYQ 4YHHL 3KYUA 3RNUA 3OTOQ 3H0GG 4JI7L 1FHHA 2AHOB 1EIYB 3H3VI 4GNXB 1C0AA 2Z3QB 1X3FA 3A44A 3J7Z1 5H1SE 1LUZA 4AR4A 3HKSA 1IRNA 1PVOA 2IY5B 1PYBA 4LUVA 2IHFA 2FXQA 2JI1A 2XJSA 4L5TA 2ERJA 1YJ9A 2LSSA 2GMGA 1RB9A 1W3SA 4ZN1B 3U58A 4A3EG 2E2JH 4KLKA 4AHXA 4U671 1P16A 2C6BA 1UE5A 4A3MH 2PMZE 5IYCH 3ULJA 3OTOL 3SS2A 1VCIA 1UE6A 3J81c 4QGUA 1NNQA 1I3QH 1XPOA 2BE5D 3G4SA 1IBMQ 1YNXA 1CUKA 5IP9H 2Z0SA 3KDFB 1UEBA 3W5OA 1FVIA 2PI2A 1EQRA 1CKNA 1SMUA 2JA9A 3S17H 2DUDA 5IWAQ 1H95A 5IP7H 4RXNA 2KCMA 1GD7A 5J3BA 4A76A 1IL2A 2WAQG 1PH4A 4A3MG 5IYCG 3PIOA 3FHWA 2E2IH 2VQFQ 4LWCA 1IW7D 3HKZE 3S15H 1T9OA 4FDBA 1BRFA 1IBLQ 1L1OC 1PFSA 1PH2A 4OONA 1OXXK 2IT1A 1R9TH 5IP9G 1NJIC 4B3RQ 2A8VA 1N33Q 4A3LG 3T1HL 1IBKQ 2JEBI 1PH9A 1TWHH 1N9WA 4GN4B 1HNWQ 4AHZA 3S1NH 1KRTA 5IWAL 5M3MH 4BBSH 3PUYA 1I5FA 3M4OH 1B2JA 1U5KA 3PUZA 4MTNA 5IP7G 3KYWA 1BVSA 4B3SQ 4JI5L 3PO2H 3CCSA 2M4VA 2HQLA 1IXRA 1VQOA 3JAMi 1X54A 2VQFL 1WYDA 3WWNB 4IFDI 2Q2UA 4WFN1 4R4IA 5GAHC 2MNAA 1IBLL 5K36G 4IOCA 5FLMH 2HT1A 2RHQB 4DAYB 3J81i 3CCEA 2VUMH 1K9MC 1FGUA 4B3RL 1N33L 4IJLA 4JCVE 1K8AC 2QEXA 4JADA 3PWFA 4X6AH 1DGSA 2CWPA 3RLFA 4C3IH 2JJQA 1PA6A 3S1QH 4HIOA 4L5QA 4YWLA 1R0HA 2WB1G 2OTJA 1VQGA 1HNWL 2D62A 3K8AA 1MJEA 5GAEC 2WP8J 1VQNA 1N34Q 5M3MG 2HR5A 3M4QA 4JAEA 5GQOA 4LHNA 3RR5A 4BBSG 4DR6Q 3LPEB 3F8TA 3PZAA 4DAMA 5JEAG 2JA8H 2MO0A 4PZ8A 3PO2G 1PH8A 4HJ9A 1E7ZA 3MXNB 5LMUL 2NZHA 3BJUA 1R0FA 3TRZA 4V196 5HY6A 1M90C 4B3MQ 1B8AA 2V1CC 3Q8DA 3ZG6A 2EIFA 2F3IA 3PF5A 1K8GA 5FLMG 3EIVA 4JI8Q 3AFQA 4JAGA 3GD7A 1VQ8A 2I0QA 4P71A 3STBC 2JI3A 2AYJA 3J7ZC 2BA0A 1SRUA 1N34L 1CAAA 1C09A 1CKOA 1E24A 4DR6L 4JYAQ 1Q46A 4NXMQ 3JC63 1Q12A 3K80C 4AH6A 2ZJQA 2WFWA 2JA8G 1WJVA 1YJWA 5BR8Q 1VZHA 3PKIA 1QZHA 4B3ML 4BY1H 5JEAJ 4J15A 3ZJYC 2AMCB 4JG2A 4GLAC 1TXYA 3CMAA 1B2OA 5C4XH 2MFIA 3TQYA 1QUQA 3AYHB 4XTCS 2R7ZG 5DM61 2B29A 3B08B 3CC4A 4C3HH 4AYBG 1B70B 4OWTB 1AE2A 1YHQA 2BH8A 1VQHA 4IPGA 4DV3Q 3K35A 1T9HA 1K0RA 4JYAL 2UXBL 1YV1A 2XJRA 2YYZA 1IU6A 4NXML 4JBMA 1QVCA 3J80c 1EFWA 4R4QA 2ZIXA 5C0XG 4OXPA 3NEMA 3KF6A 5BR8L 4A93H 1CKMA 4JAFA 3H15A 4BY1G 3DM3A 1K3RA 5H1Sc 1SMMA 2WB1E 4LFAQ 4K0KL 3UE1A 5M3FH 5JJLA 3NENA 4XXBB 5C4XG 3UDGA 2C35B 4JI4Q 4LFCL 3A5ZB 1HZ9A 3PCOB 3UDXA 5IYDH 3CCMA 4GOPA 3G48A 4A4IA 4DV3L 2L0ZA 1Q1BA 3BZKA 2E5LQ 3TS0A 4DV1Q 1L1OA 1YVCA 1XPRA 2F52A 1NXEA 5FLXc 2YTVA 2KENA 1NTGA 4HJ7A 2KN9A 4LW1A 4YY3Q 1N36Q 1FHMA 4A93G 5MFZA 3J7A5 5AN9H 3GTQH 4GS3A 3DLLA 4JBKA 4YHHQ 3HOVH 4PZ6A 1YJNA 3CCLA 5IT9c 3D0FA 3PO3H 1B7YB 1M1KC 2PPTA 1EWIA 1SFOH 4LF6Q 4LFAL 1ODHA 4LF5Q 5MLC3 1NY4A 4AHYA 2Q2HA 5GADC 2MQHA 5M3FG 4UPAA 3KJOA 1UE1A 2Q2IA 3G71A 4JI4L 4IPCA 4L5RC 1Q1EA 1XMOQ 1KHIA 2KHJA 4PMWA 1NBWA 3STBD 1JB7A 4HJAA 3F2DA 5IYDG 1QVGA 2E5LL 4DV1L 1VQ7A 3KOJA 5JVG1 1Y1WH 2XJQA 1OWCA 4EX5A 1S72A 4LUOA 4OWXB 4PG3A 4YY3L 2K14A 1N36L 3BZCA 1AE3A 3E9IA 1VQEA 2R93H 4A3GG 3I55A 4POFA 2NVTH 2YU9H 3HOVG 3PO3G 4LF6L 4AYBE 4DK3C 3RZDH 4LF5L 3CC7A 5GROA 4DV5L 1OXTA 4DUYQ 1BFYA 4GN5A 3MPSA 5GAGC 2OCEA 1GO3E 1FJGQ 1XMOL 1WOCA 1HR0W 4P73A 4A3IH 3CCJA 1S2ZA 4ALPA 1YBYA 4HIMA 4DR3Q 3NBHB 3UE0A 3JAMc 2B63G 5M5YH 2D0OA 2NVYH 7RXNA 3L7ZC 2K4KA 3PKJA 4YWMA 1E1TA 2R93G 3ER0A 3M3YH 2DSXA 1JT8A 1PH1A 1VQ4A 2L15A 4DUYL 4OO1I 4GNXA 1ZRPA 4RMFA 5EAYA 1FJGL 3KYHC 4DV7Q 3S14H 3QQCE 4A3IG 1VQDA 3J7Y1 2HIVA 4BA2I 1VQPA 3T1HQ 2K5HA 1EIFA 2JA5H 3GTLH 4DR3L 4AI0A 3A74A 3BU2A 2NN6G 2PNHA 1J6QA 4R4OA 3F2CA 4X62Q 1EQQA 4JI5Q 3OYYA 1FL0A 1GM5A 1Z9FA 3TEHB 3KYVA 1VQFA 3PIP1 3CW2C 2UXCQ 3TREA 3AQQA 2HHHQ 1V9PA 2D0PA 4DV7L 1LM0A 5LMNW 1PH6A 4DPGA 2Z6KC 1U0LA 1YHBA 2K5VA 3KDFA 2I5LX 2UUCQ 1DVBA 2CKZB 3PF4A 1X6OA 4DUZQ 4IPDA 3U4ZA 3CCUA 2JA5G 1HZAA 4JOIC 2CWAA 4NXNQ 3GTJH 1RDVA 2GVAA 4X62L 3RN2A 2JA7H 1A63A 4WJ4A 1MKHA 1D8LA 5EINC 5LMUQ 3QVDA 1VQAA 2UXCL 4Y7NH 2HHHL 2VZAA 1JJ2A 3RLOA 1MJCA 3JC62 1JJGA 2PVEA 4AI1A 5E7NA 4G6BA 1N32Q 2UUCL 1CSPA 5LMNQ 1S40A 4DUZL 2M4YA 2C6AA 3MEFA 2EQSA 4NXNL 1UE7A 3W1BA 1G6PA 4OWWB 2XJPA 5MF6A 1S3OA 2JA7G 1KRSA 3U50C 2YTYA 2VQEQ 1I50H 1Y14B 3I4NH 2N49A 2A69D 1OTCA 3P8BA 1VQ5A 1SMWA 2JE6I 1TWFH 1WI5A 5GAHc 4L5SA 4NPSA 5EIOC 2VUMG 2K2DA 1N32L 1S24A 3LNLA 5LMNL 5JJKA 1VCXA 3J81j 3L2PA 3I4OA 4DR5Q 1Q8KA 3KLWA 3PV0A 2WAQE 4GLVB 2ATWA 5M5XH 5IY0A 4GKKQ 2VS1A 2JK8A 5GAEc 4LF4Q 4DR1Q 1XNRL 4P74A 2F4VL 1X3GA 2UXBQ 2BA1A 2R6GA 5AI3A 1OXUA 4QL5A 2VQEL 2ASBA 3I4MH 1VQKA 3CXCA 4LNQA 2LXKA 3I4NG 2ZTDA 1T9QA 4JBWA 4YCUA 1HJPA 4HIDA 2E2HH 2XJUA 3B0AB 1SMXA 4K0KQ 4UY81 1BE7A 4GKJQ 4DR5L 4LFCQ 3GTPH 4UP8A 2HIXA 1RDGA 2PQAB 1Y1VH 4A3JH 3ULPA 4GKKL 3S2DH 4X65L 3I56A 4DV6Q 4LF4L 4JI6Q 4DR1L 3KYXA 1RYQA 2DGYA 4IFDG 4LF7Q 3I4MG 2QGQA 4DV2L 2OQKA 1Z92B 1NMFA 1YI2A 5C4JH 2UXDQ 4O0AA 3KFUA 1WJJA 1RWDA 1RYTA 1PH7A 4GKJL 1PH3A 3M4PA 1QYBA 2R7DA 6RXNA 3OW2A 1VQ6A 1IZ6A 5IE8A 1EYGA 2OQ0A 4MNOA 2YV5A 4DV6L 4JI6L 5JVH1 1BBWA 4QIWE 1OXSC 4UP9A 1PYSB 4LF7L 3K7AH 2XTIA 4A3DH 4DR7Q 4JI1Q 3LGJA 4TVMA 1LKOA 1LYLA 3ULLA 5C0XJ 1KXLA 1GVPA 1I94Q 2CKAA 4OX9Q 1I6HH 1YZ6A 2UXDL 1BKBA 3G6EA 2N8NA 1B13A 3W1GA 1X9NA 3CF5A 2AKWB 4DV5Q 1Q82C 5JJIA 1EOVA 1Q7YC 1Z47A 2UUAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 i;  1ZRP A;  1A0I A;  4RMF A;  3S24 A;  1VQJ A;  2A19 A;  2RF4 A;  5EAY A;  4JI8 L;  3CCE A;  1J5E L;  4QJF A;  3KYH C;  1FJG L;  2VUM H;  1K9M C;  4DV7 Q;  3S14 H;  2AWO A;  1FGU A;  4B3R L;  4JI3 L;  1N33 L;  4IJL A;  4BA1 I;  4TPU A;  4A3I G;  1VQD A;  2HIV A;  4JCV E;  4BA2 I;  4TVA B;  1K8A C;  2QEX A;  1K73 C;  3F1Z A;  3PWF A;  5HGQ A;  1VQP A;  3CD6 A;  1PH5 A;  4BY7 G;  1DGS A;  2CWP A;  4KHZ A;  3S2H H;  3RLF A;  4C3I H;  2JJQ A;  1G51 A;  2K5H A;  3T1H Q;  1KL9 A;  1W2B A;  4DV0 L;  4HIO A;  1PA6 A;  4L5Q A;  1EIF A;  3GTK H;  4GOP B;  4YWL A;  1R0H A;  2JA5 H;  2WB1 G;  1KAW A;  1A62 A;  1PV4 A;  2OTJ A;  1OXV A;  1VQG A;  3GTL H;  4DR3 L;  3A74 A;  2JA6 H;  2D62 A;  3BU2 A;  1HNW L;  2NN6 G;  2PNH A;  1TWC H;  1J6Q A;  3K8A A;  1MJE A;  5GAE C;  2ES2 A;  3RZ6 A;  2KBN A;  2WP8 J;  2OTL A;  2KCT A;  1B71 A;  4JI1 L;  4DR7 L;  2ZTE A;  1L1O B;  2Q2T A;  1VQN A;  2V3B B;  1N34 Q;  4A3D G;  4K9F A;  4R4O A;  3UDF A;  5M3M G;  1YUZ A;  2HR5 A;  3M4Q A;  2JEA I;  3RR5 A;  4XIG S;  5GQO A;  3F2C A;  4BBS G;  5ELN A;  4X62 Q;  4EQ5 A;  4KHP Q;  4DR6 Q;  3F8T A;  1QCV A;  3PZA A;  3JC6 6;  4DAM A;  1T9P A;  5JEA G;  3FKI H;  4PZ7 A;  2VL6 A;  1EQQ A;  4JI5 Q;  1JYB A;  1WCM H;  2MO0 A;  3PUW A;  4PZ8 A;  4LF8 L;  2JA8 H;  3PO2 G;  1PH8 A;  4HJ9 A;  1E7Z A;  2N78 A;  3MXN B;  1I94 L;  4IPH A;  1JMC A;  3OYY A;  4JC0 A;  5LMU L;  1FL0 A;  4A3E H;  3S1R H;  1Z9F A;  1GM5 A;  4LFB L;  2NZH A;  3TEH B;  3BJU A;  3KYV A;  1VQF A;  1R0F A;  3AFP A;  4JV5 Q;  3TRZ A;  2VNU D;  3CW2 C;  5HY6 A;  3CC2 A;  2UXC Q;  1M90 C;  4JI2 L;  4B3M Q;  1B8A A;  2V1C C;  3TRE A;  4A3B H;  4QQB X;  1HZC A;  3Q8D A;  4IOA A;  3VDY A;  2UUA Q;  2XGT A;  2EIF A;  2PVX A;  1R0G A;  3AQQ A;  1YIT A;  2HHH Q;  3HOY H;  1V9P A;  2F3I A;  3PF5 A;  3RLN A;  3KJP A;  1K8G A;  2D0P A;  1C9O A;  5FLM G;  1VQL A;  3EIV A;  4JI8 Q;  3WWV A;  2UU9 Q;  3S1Q H;  3AFQ A;  1J5E Q;  4DV7 L;  1NE3 A;  2LXJ A;  4P72 A;  1LM0 A;  4DV4 Q;  5LMN W;  1PH6 A;  4DPG A;  3GD7 A;  3RZO H;  4X66 Q;  2GVB A;  1JE5 A;  1U0L A;  1YHB A;  2Z6K C;  3L0O A;  4YCV A;  4YCW A;  1Y1V G;  3T1Y L;  4A3J G;  2UUB Q;  2K5V A;  2H5X A;  1P8L A;  2PQA A;  5FJ8 H;  3KDF A;  5C3E H;  2QA4 A;  3NEL A;  1HNX L;  2I5L X;  1VQ8 A;  2I0Q A;  4P71 A;  2UUC Q;  3STB C;  3M7N A;  4DKA C;  1DX8 A;  1HZB A;  1DVB A;  4DR2 L;  2CKZ B;  3PF4 A;  1X6O A;  3I7F A;  3PGZ A;  5AI2 A;  4DUZ Q;  4IPD A;  3U4Z A;  3M85 A;  3CCU A;  2PI2 E;  4B3T Q;  4LF9 Q;  2RHS B;  1Y1W G;  2JA5 G;  3M9B A;  1GKH A;  1HZA A;  4JOI C;  3J7Z C;  3CCV A;  1YIJ A;  2Z6K A;  2CWA A;  4NXN Q;  3GTJ H;  3K0X A;  2JA6 G;  4APV A;  2BA0 A;  4KI0 A;  3UDI A;  1SRU A;  2ID0 A;  1HNZ Q;  1N34 L;  1X56 A;  1RIP A;  2Y0S E;  3E0E A;  1CAA A;  1C09 A;  1RDV A;  2GVA A;  2YTX A;  1KD1 C;  2OWO A;  1SR3 A;  1CKN B;  3PSI A;  1CKO A;  2ZJP A;  4X62 L;  3RN2 A;  4KHP L;  1E24 A;  1SRO A;  5M5W H;  2ZJR A;  4DR6 L;  4JYA Q;  3RYG A;  2JA7 H;  1Q46 A;  1A63 A;  2E8G A;  4NXM Q;  2VW9 A;  4IFD J;  4WJ4 A;  3JC6 3;  4A3F H;  1XMQ Q;  1Q12 A;  1MKH A;  3K80 C;  4AH6 A;  4JOI A;  4LF8 Q;  1D8L A;  3FKI G;  2ZJQ A;  1XTD A;  2WFW A;  1WCM G;  5LMU Q;  2JA8 G;  3HOW H;  3QVD A;  1YJW A;  4ME3 A;  3HOU H;  3SGI A;  5BR8 Q;  3A0J A;  4JV5 L;  4C2M H;  1X55 A;  1BBU A;  1QZH A;  1VQA A;  2UXC L;  4B3M L;  4BY1 H;  2CFM A;  3S1M H;  5JEA J;  4J15 A;  1ASY A;  2NN6 I;  4DR4 Q;  3ZJY C;  2AMC B;  4Y7N H;  4JG2 A;  4AQY L;  4DK6 C;  4JI2 Q;  3HOZ H;  4A3G H;  4X64 Q;  2HHH L;  2VZA A;  3H0G H;  3RLO A;  1IYJ B;  1JJ2 A;  1MJC A;  2UU9 L;  4GLA C;  3HOY G;  1SN8 A;  1JJC B;  1O7I A;  4AR6 A;  1TXY A;  2K52 A;  4DV4 L;  4JI7 Q;  3JC6 2;  1RL2 A;  3S16 H;  1JJG A;  4GN3 B;  4HJ5 A;  4X66 L;  2PVE A;  2UUB L;  3CMA A;  1B2O A;  5E7N A;  3T1Y Q;  4A3B G;  1X65 A;  1N32 Q;  1A8V A;  1VQ9 A;  5C4X H;  2MFI A;  1IRO A;  3TQY A;  1HNX Q;  3KF8 B;  1HR0 Q;  1QUQ A;  2UUC L;  1CSP A;  5LMN Q;  1KIX A;  3AYH B;  1EUJ A;  5C3E G;  3HOX H;  5FJ8 G;  4DR2 Q;  4XTC S;  4MZ9 A;  1V43 A;  4AIM A;  1S40 A;  2R7Z G;  1Q86 C;  2IX1 A;  2B29 A;  4DUZ L;  4UY8 C;  2M4Y A;  4C3H H;  3CC4 A;  1YEZ A;  4LF9 L;  4B3T L;  4AYB G;  3MEF A;  2EQS A;  3HKZ G;  1B70 B;  4OWT B;  4H02 A;  4NXN L;  1AE2 A;  1YHQ A;  3E9H A;  4R4T A;  1H7V A;  1UE7 A;  4A3L H;  2BH8 A;  3EBE A;  1BQ8 A;  1VQH A;  3W1B A;  1HNZ L;  1G6P A;  1YUX A;  1E3P A;  2CQO A;  5RXN A;  4IPG A;  4DV3 Q;  4OWW B;  1XNQ Q;  2NVQ H;  1S30 A;  1VQM A;  2K75 A;  1T9H A;  1QZG A;  1K0R A;  4JYA L;  1WFQ A;  3H3V H;  2UXB L;  1YV1 A;  5ELO A;  2YYZ A;  4TQU S;  1IU6 A;  4NXM L;  1IU5 A;  1S3O A;  4JI0 L;  1VQI A;  1XMQ L;  4JBM A;  3B6Y A;  1QVC A;  2JA7 G;  1KRS A;  3U50 C;  4HJ8 A;  3J80 c;  1EFW A;  4DNI A;  2YTY A;  1G29 1;  3K7U C;  4A3F G;  3EN2 A;  4R4Q A;  2VQE Q;  1N8R C;  1I50 H;  1LKM A;  5C0X G;  2B63 H;  3CPF A;  4OXP A;  3NEM A;  1XPU A;  1Y14 B;  3KF6 A;  4JBJ A;  5BR8 L;  3HOW G;  3I4N H;  4C3J H;  1KQS A;  2MS3 A;  4A93 H;  4POG A;  1CKM A;  2N49 A;  5IYB H;  3I2Z A;  1OTC A;  3HOU G;  4A3C H;  1LKP A;  1VQ5 A;  3CP0 A;  4DR4 L;  3H15 A;  2MO1 A;  1SMW A;  1CSQ A;  2JE6 I;  4BY1 G;  3J80 i;  1E22 A;  1VS0 A;  2K5N A;  2EXD A;  3DM3 A;  4X64 L;  4AQY Q;  1K3R A;  1TWF H;  3KYU A;  4YHH L;  1WI5 A;  3RNU A;  4L5S A;  3OTO Q;  3HOZ G;  3H0G G;  4NPS A;  4JI7 L;  1SMM A;  2WB1 E;  2VUM G;  4HIK A;  1FHH A;  4RG1 A;  2AHO B;  1EIY B;  2K2D A;  3CME A;  4LFA Q;  4R1J A;  4GOP C;  4K0K L;  3H3V I;  3UE1 A;  4GNX B;  1N32 L;  1S24 A;  5M3F H;  1C0A A;  1HH2 P;  1HR0 L;  5JJL A;  1SLJ A;  1X3F A;  3NEN A;  5LMN L;  5JJK A;  1VCX A;  3J81 j;  1IBM L;  3UDG A;  3A44 A;  5C4X G;  3L2P A;  3RZT A;  2VY3 A;  3CAM A;  3I4O A;  1D7Q A;  4DR5 Q;  2C35 B;  5H1S E;  1LUZ A;  1E8J A;  4AR4 A;  3HKS A;  3A5Z B;  4LFC L;  3HOX G;  4JI4 Q;  4Y52 H;  1IRN A;  1HZ9 A;  1PVO A;  1Q8K A;  3PCO B;  3KLW A;  3PV0 A;  2WAQ E;  1Q81 C;  2IY5 B;  2QL0 A;  1PYB A;  4GLV B;  3UDX A;  2ATW A;  1L2F A;  5IYD H;  5M5X H;  2ZTC A;  3GDE A;  5IY0 A;  3CCM A;  4GOP A;  3G48 A;  4LUV A;  2IHF A;  1SE8 A;  2VS1 A;  4GKK Q;  2FXQ A;  1LTL A;  4A4I A;  4DV3 L;  1XNQ L;  1Q1B A;  3BZK A;  2JK8 A;  2E5L Q;  4LF4 Q;  3FP9 A;  3TS0 A;  1X3E A;  4DV1 Q;  4DR1 Q;  1XNR L;  4NB3 A;  4L5T A;  4P74 A;  1L1O A;  2F4V L;  1X3G A;  3PIP A;  2UXB Q;  1YVC A;  1XPR A;  2F52 A;  1YJ9 A;  1YK4 A;  2GMG A;  2BA1 A;  2LSS A;  5FLX c;  2YTV A;  1RB9 A;  2R6G A;  5AI3 A;  2KEN A;  1NTG A;  1W3S A;  4HJ7 A;  1OXU A;  4QL5 A;  1YK5 A;  2VQE L;  2ASB A;  2KN9 A;  4LW1 A;  1VQK A;  3I4M H;  3CXC A;  4A3K H;  3U58 A;  4YY3 Q;  4LNQ A;  4YWK A;  4A3E G;  2E2J H;  5AJ3 Q;  1N36 Q;  1V1Q A;  4KLK A;  1FHM A;  3A5U A;  2LXK A;  1CAD A;  2R7F A;  3I4N G;  1P16 A;  3CCR A;  4A93 G;  5IYB G;  3GTM H;  3J7A 5;  4A3C G;  1UE5 A;  2IHE A;  4A3M H;  3GTQ H;  3KYY A;  2PMZ E;  3K81 C;  4GS3 A;  3ICE A;  5IYC H;  3DLL A;  4JBK A;  4YHH Q;  4O2D A;  2ZTD A;  3ULJ A;  2ZM6 Q;  1T9Q A;  3CQZ H;  4PZ6 A;  4JBW A;  3OTO L;  5IT9 c;  1YJN A;  3CCL A;  3D0F A;  3HOV H;  3PO3 H;  1ASZ A;  3SS2 A;  1B7Y B;  1HJP A;  1UE6 A;  1VCI A;  4YCU A;  4HID A;  2E2H H;  3J81 c;  1EWI A;  1SFO H;  1M1K C;  4QGU A;  4LF6 Q;  1NNQ A;  1SMX A;  4LFA L;  1I3Q H;  2RDV A;  1XPO A;  2NVX H;  3GO5 A;  1PHJ A;  4LF5 Q;  4K0K Q;  1NY4 A;  2Q2H A;  4BBR H;  1BE7 A;  5GAD C;  4GKJ Q;  3CCQ A;  2MQH A;  5C0X I;  5M3F G;  3G4S A;  1IBM Q;  4UPA A;  4UP7 A;  3KJO A;  3GTG H;  1YNX A;  1UE1 A;  2Q2I A;  3G71 A;  1CUK A;  5C44 H;  4DR5 L;  4JI4 L;  4LFC Q;  4IPC A;  4L5R C;  1AH9 A;  5IP9 H;  3GTP H;  4AR3 A;  1Q1E A;  1VQC A;  1VQB A;  2NZO A;  2Z0S A;  1KHI A;  2HIX A;  1RDG A;  2PQA B;  4UP8 A;  1XMO Q;  3KDF B;  1Y1V H;  2KHJ A;  4PMW A;  1NBW A;  3STB D;  4A3J H;  3ULP A;  1JB7 A;  3M4O H;  1KC8 C;  3AEV A;  4GKK L;  4HJA A;  3F2D A;  1UEB A;  3W5O A;  5IYD G;  3S2D H;  4X65 L;  3I56 A;  1QVG A;  4OX9 L;  1FVI A;  4WJ3 M;  4DV6 Q;  2E5L L;  4LF4 L;  4JI6 Q;  4BXX H;  4DV1 L;  4DR1 L;  2KKD A;  1VQ7 A;  1XNR Q;  2PI2 A;  5M5Y H;  1IBK L;  2F4V Q;  3KOJ A;  3KYX A;  2A1A A;  1EQR A;  1Y1W H;  2I5H A;  1CKN A;  4LUZ A;  3TS2 A;  1SMU A;  2DGY A;  4EX5 A;  2AWN A;  1S72 A;  4IFD G;  2JA9 A;  3S17 H;  4LUO A;  1K83 H;  4OWX B;  4LF7 Q;  4PG3 A;  4QY7 A;  4YY3 L;  2N3S A;  2K14 A;  2DUD A;  2R92 H;  4OO1 G;  3I4M G;  5AJ3 L;  1N36 L;  1UWV A;  2QGQ A;  5IWA Q;  4A3K G;  3BZC A;  1H95 A;  1AE3 A;  5IP7 H;  1YHA A;  2BH2 A;  4RXN A;  4JI0 Q;  1TWG H;  2KCM A;  1GD7 A;  1R0J A;  5J3B A;  4DV2 L;  4A76 A;  3E9I A;  2OQK A;  1VQE A;  2K50 A;  4IO9 A;  1IL2 A;  4B3S L;  2WAQ G;  2ZM6 L;  2R93 H;  1PH4 A;  2PYA A;  4A3M G;  1NMF A;  1YI2 A;  4A3G G;  5IYC G;  2KHI A;  3I55 A;  4POF A;  5C4J H;  2NVT H;  2YU9 H;  3HOV G;  3PIO A;  3FHW A;  3F2B A;  2E2I H;  2VQF Q;  2Y0S G;  1MIU A;  4LF6 L;  3PO3 G;  4AYB E;  4LWC A;  2UXD Q;  2LCQ A;  2RCN A;  4O0A A;  4DK3 C;  3RZD H;  3HKZ E;  4LF5 L;  3KFU A;  3CC7 A;  5GRO A;  3PUX A;  4DV5 L;  3S15 H;  1WJJ A;  1RWD A;  1RYT A;  1OXT A;  1T9O A;  4FDB A;  2ALY B;  1PH7 A;  4DUY Q;  1BFY A;  4GKJ L;  4GN5 A;  3MPS A;  1PH3 A;  4BBR G;  1BRF A;  3RN5 A;  1IBL Q;  3M4P A;  1L1O C;  1QYB A;  1PFS A;  5GAG C;  1PH2 A;  2R7D A;  2OCE A;  6RXN A;  1GO3 E;  4OON A;  3OW2 A;  4A75 A;  1OXX K;  2IT1 A;  5C44 G;  1NMG A;  1R9T H;  1XMO L;  2GN5 A;  1FJG Q;  1VQ6 A;  1WOC A;  1IZ6 A;  4P73 A;  1HR0 W;  5IP9 G;  4A3I H;  1NJI C;  4B3R Q;  5IE8 A;  1QUQ B;  2A8V A;  4JI3 Q;  1EYG A;  4P75 A;  4R4C A;  3ERS X;  3PUV A;  3CCJ A;  1N33 Q;  4A3L G;  2OQ0 A;  4MNO A;  2B3G A;  4X65 Q;  2YV5 A;  4DV6 L;  4BY7 H;  2JQO A;  4JI6 L;  2R7Z H;  1S2Z A;  1XJV A;  3HFZ B;  3T1H L;  4BXX G;  1IBK Q;  2JEB I;  1PH9 A;  1BBW A;  1TWH H;  3GTO H;  4AR5 A;  1N9W A;  4QIW E;  4DV0 Q;  3CPW A;  4ALP A;  1OXS C;  4UP9 A;  1YBY A;  4HIM A;  4GN4 B;  4X6A H;  1PYS B;  4DR3 Q;  1HNW Q;  4LF7 L;  3K7A H;  3NBH B;  1TWA H;  2XTI A;  1BQ9 A;  5DLQ E;  3UE0 A;  4A3D H;  4DR7 Q;  3JAM c;  3S1N H;  4JI1 Q;  3LGJ A;  1E1O A;  1KRT A;  5IWA L;  5M3M H;  2B63 G;  4BBS H;  2IX0 A;  2R92 G;  3PUY A;  1I5F A;  1B2J A;  2D0O A;  1U5K A;  2I5M X;  7RXN A;  2NVY H;  3L7Z C;  1LKO A;  1LYL A;  3PUZ A;  4MTN A;  1C7Y A;  5IP7 G;  4DV2 Q;  3KYW A;  2CCZ A;  1QVF A;  1BVS A;  4GNX C;  4JI5 L;  4B3S Q;  3PO2 H;  3CCS A;  2K4K A;  2HQL A;  3U4V A;  3KF6 B;  3IRB A;  3ULL A;  1IXR A;  8RXN A;  4YWM A;  1E1T A;  3JAM i;  5C0X J;  1VQO A;  1KXL A;  1GVP A;  1X54 A;  3D31 A;  3ER0 A;  4GLX A;  1I94 Q;  3M3Y H;  2DSX A;  4OX9 Q;  2R93 G;  1JT8 A;  2VQF L;  1I6H H;  4LFB Q;  1PH1 A;  1WYD A;  1YZ6 A;  1VQ4 A;  2UXD L;  1BKB A;  3G6E A;  2N8N A;  1B13 A;  3W1G A;  1X9N A;  3CF5 A;  1R0I A;  2AKW B;  4DV5 Q;  1Q82 C;  5JJI A;  1EOV A;  1Q7Y C;  2L15 A;  4IFD I;  2Q2U A;  4DUY L;  1Z47 A;  4R4I A;  5GAH C;  2MNA A;  2UUA L;  1L0W A;  1IBL L;  5K36 G;  4IOC A;  4IJH A;  4OO1 I;  5FLM H;  4GNX A;  2HT1 A;  2RHQ B;  4DAY B; 
#chains in the Genus database with same CATH topology
 2RF4 A;  1J5E L;  4QJF A;  2EDG A;  1B1Z A;  2AWO A;  2KCC A;  2D9U A;  3DM1 A;  4RCN A;  4BA1 I;  2IPK D;  3BVZ A;  2SEB D;  1LLR D;  1ESF A;  1K73 C;  4HSP A;  2SNM A;  1W2B A;  3VR3 A;  2RA4 A;  3GTK H;  5HGT A;  3MHB A;  1I50 B;  1KAW A;  1A62 A;  1PV4 A;  1OXV A;  1JIC A;  5BN3 A;  2JA6 H;  4OIK A;  3I4N B;  2ES2 A;  2OTL A;  2ZT9 C;  3RZ6 A;  2KBN A;  4DR7 L;  1R4P B;  1B71 A;  2WV6 D;  4JI1 L;  2ZTE A;  2V3B B;  1GHJ A;  4A3D G;  4QMG A;  1ONL A;  4AI2 A;  3ND9 A;  4K9F A;  3DWA A;  1YUZ A;  1TWF B;  1JC7 A;  1EEI D;  1SMY C;  4CDF C;  3D3R A;  2OEO A;  3A55 A;  1VZG A;  3W2D A;  1TS5 A;  2BDO A;  1EQT A;  3PMF A;  1WCM H;  4BY1 L;  4LF8 L;  4KV6 A;  1I94 L;  4K5X A;  4OX9 L;  4IPH A;  4JC0 A;  4A3E H;  2V0E A;  2F1M A;  5E4W C;  1MSH A;  4QQB X;  1ICW A;  4JVZ A;  1EWH A;  2JN4 A;  4L63 B;  1I6V C;  2XGT A;  2PVX A;  1R0G A;  1YIT A;  5GAD c;  3HOY H;  4ME5 A;  5DEH A;  3RLN A;  4CKB A;  3KJP A;  1C9O A;  5C4X L;  3WWV A;  5M5X B;  1O78 A;  2UU9 Q;  5JJZ A;  3HAX C;  1NE3 A;  2LXJ A;  2EYF A;  1QJO A;  4P72 A;  4DV4 Q;  2KEC A;  3DWQ A;  3RZO H;  4X66 Q;  1CTM A;  1JE5 A;  4YCV A;  2F0T A;  4A3B H;  1B9N A;  4YCW A;  4C3H L;  3T1Y L;  4KTA A;  2H5X A;  5FJ8 H;  1HNX L;  4KD3 A;  5EBD A;  3M7N A;  4DKA C;  1HZB A;  4DR2 L;  3I90 A;  2A6E D;  4MIU A;  4N8F A;  3I4M B;  3M85 A;  1SYB A;  2PI2 E;  2A68 C;  1Y1W G;  3KBG A;  3CCV A;  1YIJ A;  2ZXR A;  2VB3 X;  3A56 A;  4IUV A;  3LWE A;  5CV4 A;  4U68 A;  5F2D A;  1BXT A;  4XQJ A;  4KI0 A;  1A3U A;  2JA6 G;  2ID0 A;  1HNZ Q;  2EYP A;  1X56 A;  2QIL A;  3E0E A;  2YTX A;  1CKN B;  1GUN A;  3PSI A;  1SRO A;  5EKK A;  1SE4 A;  5M5W H;  1RCV D;  3RYG A;  2EPB A;  2E8G A;  2VW9 A;  4CJ0 B;  4A93 L;  2E2H B;  2H1E A;  1GXD C;  1RKN A;  1EWC A;  1XTD A;  1WCM G;  1PFY A;  4ME3 A;  4H44 C;  1FR3 A;  2FHT A;  3HOU H;  3SGI A;  3TME A;  4LAA A;  4C2M H;  1X55 A;  5DM7 1;  1NAP A;  1ASY A;  4B8C D;  4DR4 Q;  3GTP B;  4AQY L;  4DK6 C;  3HOZ H;  4X64 Q;  5IGD A;  1IYJ B;  1Y1V B;  3OIQ A;  5M3F L;  4A3J B;  2UU9 L;  4QCL A;  3HOY G;  5ELE A;  1O7I A;  4AR6 A;  4DV4 L;  5GAG c;  3S16 H;  3S2D B;  4HJ5 A;  1ENF A;  1STB A;  1D5M C;  4JW0 A;  4X66 L;  1IHZ A;  4A3B G;  1X65 A;  1A8V A;  2L55 A;  5K5P A;  1IRO A;  4BWG B;  1HR0 Q;  3KF8 B;  1KIX A;  1S5E D;  1EUJ A;  5IYD L;  3HOX H;  5FJ8 G;  1ILQ A;  3PIO 1;  4GS7 D;  1QWY A;  4KJN A;  4UY8 C;  2IX1 A;  1SNO A;  1F2Z A;  1YEZ A;  4XYO A;  4O42 A;  3BVG A;  2VB2 X;  4M8A A;  3E9H A;  4R4T A;  4A3L H;  3EBE A;  4I7Z C;  1BQ8 A;  3FDJ A;  1HNZ L;  2CQO A;  1PZI D;  5RXN A;  1XNQ Q;  4H7B A;  1S30 A;  2Z3R B;  3NBH A;  3ND8 A;  2K75 A;  1QZG A;  3NWS A;  1PFB A;  4MHE A;  1PRT B;  2J0T D;  2KOL A;  3H3V H;  5ELO A;  4TQU S;  4K5W A;  5C4J B;  1IU5 A;  4H13 C;  3B6Y A;  1EYA A;  1G29 1;  3EN2 A;  5TSS A;  4ZN3 B;  3GTQ L;  3CPF A;  4JBJ A;  3MXG A;  3HOV L;  4C3J H;  2MS3 A;  4POG A;  5IYB H;  3HOU G;  3PO3 L;  2PW7 A;  3I2Z A;  4C1N K;  1D1K A;  4A3C H;  1LKP A;  5MFP A;  3CP0 A;  4LMQ D;  4DR4 L;  1SFO L;  2MO1 A;  1MBY A;  1E22 A;  2EXD A;  4X64 L;  2V0F A;  2EY5 A;  3LWR B;  1WTW A;  3HOZ G;  3H3V C;  1DOK A;  4R8I A;  1WTH A;  3D4W A;  2CR8 A;  1OWB A;  4HIK A;  4RG1 A;  2M6P A;  3CME A;  4GOP C;  4R1J A;  2FIN B;  2EZV A;  4K8I A;  1RF2 D;  1HH2 P;  2A6H C;  3FVQ A;  1HR0 L;  1SLJ A;  2K01 A;  1TS2 A;  5IGB A;  1K8M A;  4UDU C;  1IBM L;  3RZT A;  2VY3 A;  3CAM A;  1D7Q A;  3HOX G;  3K0Y A;  1E8J A;  4Y52 H;  1EY4 A;  3K7A B;  1CZW A;  4A3D B;  4IUU A;  4RHR A;  1VF5 C;  2XJT A;  1STE A;  1Q81 C;  1SYC A;  2QL0 A;  1BF4 A;  1H9K A;  1A6X A;  1L2F A;  2ZTC A;  3GDE A;  3NFP I;  1SE8 A;  1Y1W L;  3VPB E;  1LTL A;  1XNQ L;  5EGT A;  2O5J C;  3FP9 A;  3WWL A;  1X3E A;  1KAA A;  4NB3 A;  2B5I D;  2K1B A;  3KK7 A;  1LTS D;  3PIP A;  2B2U C;  3IFD A;  1YK4 A;  1G6Z A;  2L4N A;  2LMC B;  1I6H B;  2F03 A;  1TS3 A;  3QB3 A;  2BCO A;  2AUS B;  1YK5 A;  4OO1 H;  1CT1 D;  4A3K H;  1SMY D;  4XYQ A;  1SJE D;  4YWK A;  2R93 L;  5AJ3 Q;  1V1Q A;  1VZI A;  3A5U A;  1CAD A;  2NVT L;  2YU9 L;  1LTT D;  2R7F A;  3BG3 A;  4C3J G;  3CCR A;  5IYB G;  3GTM H;  4A3C G;  4LHL A;  2IHE A;  3KYY A;  1CZG A;  2F0G A;  3K81 C;  3RZD L;  2B2T C;  3ICE A;  5D3D A;  3VA5 A;  4O2D A;  2ZM6 Q;  2ERS A;  3CQZ H;  3VR6 A;  3HGB A;  3EFX D;  1ASZ A;  3IFT A;  2RSN A;  5KNC A;  2XRQ D;  2RDV A;  2NVX H;  3GO5 A;  1MGS A;  3KLS X;  5MGN A;  4K6D A;  4U67 3;  5K2M E;  1PHJ A;  1CHQ D;  3RD4 A;  4BBR H;  4K8J A;  3GTK B;  3CCQ A;  4A3I L;  5C0X I;  1HCZ A;  5EKI A;  1A2T A;  2XVS A;  4UP7 A;  3IU3 I;  4BS9 A;  3GTG H;  5C44 H;  2JA6 B;  3TP7 A;  2PW5 A;  1XWE A;  3QIA A;  3RMH A;  3SE0 A;  1AH9 A;  2K03 A;  4AR3 A;  1VQC A;  2NZO A;  1VQB A;  1FYC A;  4IUP A;  3J81 E;  3IAY A;  2NYD A;  4FVM A;  4KN7 C;  3N52 A;  1I4G A;  1KC8 C;  2Q8I B;  3V05 A;  3AEV A;  1SXT A;  3U9S A;  4J8Q A;  4NW2 A;  4WJ3 M;  1LTB D;  4BXX H;  2A68 D;  2DNC A;  4ZYS A;  1YNN C;  2KKD A;  2A74 C;  1XNR Q;  1SSO A;  4EQP A;  4JPB W;  1IBK L;  2F4V Q;  3NTI A;  1WCM B;  1X3P A;  3NPP A;  3TZD A;  2A1A A;  2TSS A;  3DMU A;  5KYI A;  4EQN A;  4A3E B;  2I5H A;  5M5Y L;  4LUZ A;  3TS2 A;  2NVY L;  2AWN A;  2A5H A;  1K83 H;  4QY7 A;  4ZLT F;  2N3S A;  2R92 H;  2F0M A;  4OO1 G;  5AJ3 L;  1UWV A;  4EQO A;  4A3K G;  1SE3 A;  1YHA A;  3F2U A;  2BH2 A;  4JI0 Q;  2PPB C;  1TWG H;  3M3Y L;  1DOM A;  3P1H A;  3HOY B;  1R0J A;  2EY2 A;  2HCI A;  4IO9 A;  2K50 A;  3HOU L;  4ZKC B;  4B3S L;  1F9Q A;  4XT1 B;  2ZM6 L;  2PYA A;  1D2B A;  2Z4I A;  3RZO B;  2KHI A;  4A3B B;  2WKC A;  4XGH A;  3F2B A;  1EY8 A;  1HQR D;  1MIU A;  2Y0S G;  4KY5 A;  3HOZ L;  4E6I A;  2LCQ A;  2RCN A;  4DAP A;  3PUX A;  4Q0F A;  2ALY B;  3LNN A;  3S14 L;  4K2K A;  4BBR G;  3RN5 A;  1KNE A;  1I4H A;  4IZ8 A;  3VR2 A;  1BNZ A;  2F0O A;  5D14 A;  4NKL A;  3VR4 A;  2PNR C;  3QWN A;  4A75 A;  5C44 G;  1NMG A;  1CI3 M;  2GN5 A;  3X3M A;  4RGO S;  1QUQ B;  4PV1 C;  5LHY 1;  4JI3 Q;  4P75 A;  4R4C A;  3ERS X;  3PUV A;  2JA5 L;  2HD3 A;  3AMU A;  2B3G A;  4X65 Q;  5M5W B;  4BY7 H;  2MP1 A;  3GTL L;  1D6E C;  2JQO A;  5I6W A;  1PFU A;  2R7Z H;  2Z9H A;  1XJV A;  2PZW A;  4CKE A;  1PTO F;  3HFZ B;  3MVV A;  4BXX G;  3ERO A;  3GTO H;  2O2L D;  4AR5 A;  4DV0 Q;  4F8M A;  3CPW A;  3NWT A;  4IUN A;  3U9O A;  1GUW A;  3HOU B;  1EZ8 A;  3BDL A;  4C2M B;  1TWA H;  1BQ9 A;  5CV8 A;  5DLQ E;  1E1O A;  2IX0 A;  2R92 G;  2JI2 A;  4JI0 L;  2I5M X;  3HOZ B;  1HFG A;  1C7Y A;  1JWS D;  1AN8 A;  3SEB A;  4DV2 Q;  2CCZ A;  5CR3 A;  1QVF A;  4ZK9 B;  4KKU A;  4ID6 A;  2H4O A;  4GNX C;  1JWU D;  3U4V A;  3KF6 B;  3IRB A;  3S16 B;  8RXN A;  1PTO H;  3D31 A;  4GLX A;  4LFB Q;  4C2M 1;  2EYM A;  1R0I A;  3HOX B;  3MZ5 A;  3P2A A;  1TR5 A;  1Y8N B;  3QO2 A;  3SK6 A;  1QNK A;  3IL8 A;  1L0W A;  4IJH A;  3WOF A;  4CKC A;  1KLU D;  2K04 A;  1TY0 A;  5BN5 A;  1A0I A;  3S24 A;  1VQJ A;  2A19 A;  4JI8 L;  3C46 A;  2F0F A;  3URY A;  1J8I A;  2A6H D;  3JR7 A;  4JI3 L;  4TPU A;  4WFN 3;  1PMR A;  2F0I A;  4TVA B;  1HTL D;  3K58 A;  3F1Z A;  5HGQ A;  3CD6 A;  3S2H H;  4BY7 G;  1PH5 A;  3GTJ L;  2I07 B;  4KHZ A;  1G51 A;  1KL9 A;  4DV0 L;  1W6J A;  4GOP B;  5C3W A;  2PSM C;  1ROD A;  3WDN A;  5FKA C;  3TP6 A;  2O5J D;  3QG1 A;  1DJR D;  4C3J B;  1I4Q A;  1TWC H;  2JA7 L;  2KCT A;  1L1O B;  3MFG A;  4WJW A;  2Q2T A;  1S5D D;  2K33 A;  3UDF A;  2JEA I;  3MC0 B;  2K5Q A;  4XIG S;  3ITP A;  3OOC A;  5ELN A;  4EQ5 A;  4KHP Q;  2SDF A;  4TRD A;  1QCV A;  3JC6 6;  1T9P A;  3T13 A;  1RJT A;  3FKI H;  4PZ7 A;  2VL6 A;  2Z4H A;  2CKC A;  5JAV A;  1JYB A;  3PUW A;  4QUC A;  1JMC A;  1EYD A;  2N78 A;  2G5D A;  2OWO A;  5EKL A;  3S1R H;  1VF7 A;  4LFB L;  4Y7N L;  5KND A;  4RCO A;  3MSU A;  4FXD A;  1DZ1 A;  3AFP A;  4JV5 Q;  4K2L A;  2VNU D;  3CC2 A;  4AHW A;  5I2X A;  4CJ2 C;  5C4Z A;  2XIW A;  2F4I A;  1HZC A;  4IOA A;  3VDY A;  4ULL A;  2UUA Q;  3R3O A;  5FOB B;  4WOR A;  1VQL A;  1STA A;  4QF4 A;  1J5E Q;  1SNQ A;  2BE5 C;  5C5L A;  4JK1 C;  2EY6 A;  1PRT C;  4H0L C;  3T56 B;  2GVB A;  3KBX A;  3L0O A;  1Y1V G;  4A3J G;  1GUT A;  2UUB Q;  4ZQ3 A;  2PQA A;  1P8L A;  3EA6 A;  5C3E H;  2QA4 A;  3NEL A;  1CHP D;  1IYU A;  1DX8 A;  4FF4 A;  5J22 A;  3P7J A;  3I7F A;  3LX0 A;  3PGZ A;  5CC4 A;  5AI2 A;  1AEX A;  1CQF A;  1LT4 D;  4LF9 Q;  4A3K B;  4B3T Q;  2RHS B;  3M9B A;  1GKH A;  2IX3 A;  2Z6K A;  1YNN D;  3K0X A;  2B2V C;  4APV A;  5CBA E;  1NNX A;  3UDI A;  5BN4 A;  4DGZ A;  1GJX A;  1ZEQ X;  3D4R A;  1RIP A;  2Y0S E;  1KD1 C;  1SR3 A;  4RGM A;  1I50 L;  2ZJP A;  4KHP L;  3CQZ B;  2ZJR A;  2BDN A;  3SK4 A;  2Y0S B;  5JPM C;  2WII B;  2JSO A;  4G7O C;  4IFD J;  3I4N L;  1QNU A;  1MI2 A;  4A3F H;  1XMQ Q;  4JOI A;  4LF8 Q;  3FKI G;  2NVX B;  4RAU C;  3HOW H;  4MN3 A;  1X32 A;  4BBR B;  3OHX C;  5LL6 S;  1TWF L;  3A0J A;  4JV5 L;  3S9W A;  1EL0 A;  1BBU A;  1EIG A;  3S1M H;  2CFM A;  4I7A A;  3GTG B;  1NXG A;  3FPP A;  2NN6 I;  5C44 B;  5G3L F;  3A8K E;  1IW7 C;  1ZKO A;  2B2U A;  4C1N I;  4A3G H;  4JI2 Q;  2WIN B;  3HKZ P;  3H0G H;  4YIJ A;  5E3F A;  4KK7 A;  1BR9 A;  2M9V A;  3R2I A;  1SN8 A;  1JJC B;  3TP5 A;  2K52 A;  4JI7 Q;  3K5L A;  1RL2 A;  4GN3 B;  2XJV A;  2UUB L;  4B08 A;  2H12 A;  3T1Y Q;  4K5V A;  1VQ9 A;  1HNX Q;  2J9U B;  5EPK A;  5C3E G;  1S5C D;  5M5X L;  4DR2 Q;  3QOL A;  4FXG C;  4MZ9 A;  1V43 A;  4AIM A;  1Q86 C;  3H09 A;  1K83 B;  4F7X A;  4LF9 L;  4BY7 L;  4B3T L;  3O13 A;  2M6O A;  2R92 B;  3HKZ G;  1CM9 A;  2Z8L A;  4H02 A;  1H7V A;  1MSG A;  1ENC A;  1TWG B;  2FJ2 A;  1LT3 D;  4L8J A;  5I9P A;  1S4Z A;  1YUX A;  1E3P A;  3H91 A;  3LWQ B;  2NVQ H;  1VQM A;  3A8J E;  4KKT A;  1W6K A;  3I4M L;  1HTP A;  5DM6 3;  2X6G A;  1WFQ A;  1AFP A;  3D8G A;  1MD2 D;  1VQI A;  1DCZ A;  1XMQ L;  3NHH A;  3H9C A;  3BYT B;  3CKI B;  4HJ8 A;  4DNI A;  3OIP A;  3K7U C;  3VR5 A;  4A3F G;  1GUG A;  1N8R C;  1LKM A;  2AQ3 B;  2B63 H;  2RSO A;  1D5Z C;  1XPU A;  5C5M A;  3BZD B;  3CHB D;  3HOW G;  1KQS A;  4E6Y A;  3HJW B;  5CYU A;  2E2H L;  2WKD A;  1CSQ A;  3J80 i;  2F0V A;  1F77 A;  1VS0 A;  4AI3 A;  2K5N A;  4AQY Q;  4JI2 L;  4YHH L;  3KYU A;  4DK1 A;  3J80 E;  4C56 C;  3RNU A;  3OTO Q;  1TS4 A;  2E75 C;  2X6L A;  3H0G G;  3NQT A;  4JI7 L;  1R4Q B;  1KTK A;  1E2V A;  1FHH A;  3NTK A;  3SK5 A;  2AHO B;  1EIY B;  4BY7 B;  2M2L A;  2R7Z B;  3H3V I;  4GNX B;  1HA5 A;  3GTP L;  3E3X A;  1C0A A;  4FXK C;  2Z3Q B;  3GTO B;  3A8I E;  1X3F A;  4KN4 C;  1Y1V L;  4A3J L;  1HA6 A;  3A44 A;  1CFM A;  3J7Z 1;  5H1S E;  3D6W A;  1LUZ A;  4AR4 A;  3S2D L;  3HKS A;  1TWA B;  4RGN A;  1IRN A;  1PVO A;  4KY7 A;  1V8Q A;  2CVR A;  1J9O A;  4FP5 D;  2IY5 B;  1PYB A;  2EJF C;  1FGB D;  4LUV A;  2IHF A;  1GOZ A;  3C2P A;  3TN2 A;  2FXQ A;  1E2W A;  1FD7 D;  3NUC A;  1KLG D;  2XWB B;  2JI1 A;  2XJS A;  4L5T A;  3OMC A;  1KAB A;  3SHL A;  2ERJ A;  1PTO B;  5C4H A;  2LSS A;  2GMG A;  1YJ9 A;  1RB9 A;  1W3S A;  2K7V A;  1CK1 A;  1EY5 A;  1QIL A;  4ZN1 B;  3U58 A;  2N55 A;  1BQQ T;  4A3E G;  2E2J H;  3Q23 A;  1WTX A;  2CHB D;  4AHX A;  3DHQ A;  4KLK A;  1D5X C;  5C4J L;  4U67 1;  1P16 A;  2NZ1 D;  4OEL B;  3R2T A;  1E2Z A;  1RDP D;  2C6B A;  2Z1C A;  1UE5 A;  4A3M H;  2PMZ E;  5IYC H;  3ULJ A;  2K28 A;  2KQ3 A;  3OTO L;  3SS2 A;  1VCI A;  1UE6 A;  2PMZ B;  3J81 c;  3HRZ C;  3IKJ A;  4QGU A;  1NNQ A;  1I3Q H;  1XPO A;  4UAI A;  3S2H B;  1PXU A;  1QCB D;  4QUF A;  5KEE A;  4DXF A;  4CJ1 B;  4X3K A;  2BE5 D;  3G4S A;  5C3X A;  1IBM Q;  4IAL A;  1PRT D;  3HJY B;  1YNX A;  1CUK A;  5IT9 E;  1TWC B;  5IP9 H;  2Z0S A;  2Z6B A;  3KDF B;  4OGQ C;  4X3T A;  4V19 0;  4TSS A;  4WRD A;  1RTO A;  1UEB A;  3W5O A;  2EXZ A;  2JYO A;  4KY6 A;  4KKS A;  1FVI A;  2F0H A;  4OEM B;  3HP3 A;  3K7A L;  5A2Q E;  3FKI B;  2PI2 A;  4A3D L;  1EQR A;  3FDT A;  3S1R B;  1CKN A;  1SMU A;  5COR A;  2JA9 A;  3S17 H;  4LJZ C;  1SBB B;  2DUD A;  5IWA Q;  1B3A A;  1H95 A;  5IP7 H;  4RXN A;  2KHS A;  2KCM A;  1GD7 A;  1I6H L;  5J3B A;  5JVG 3;  4A76 A;  1IL2 A;  4K14 A;  2WAQ G;  1PH4 A;  4A3M G;  5IYC G;  1JQY D;  4HSV A;  1G8Z D;  4P2C B;  3PIO A;  1I4X A;  3FHW A;  2E2I H;  2VQF Q;  1B9M A;  4LWC A;  5C3E B;  1AZP A;  1IW7 D;  3HKZ E;  1LAC A;  3S15 H;  1T9O A;  4FDB A;  5K36 H;  1BRF A;  3HKZ B;  4L6T B;  1IBL Q;  1L1O C;  3SDZ A;  1PFS A;  1PH2 A;  4ZKB B;  2OXP A;  3KF8 A;  2E74 C;  4OON A;  1OXX K;  2IT1 A;  4MTK A;  1R9T H;  2D2C C;  5IP9 G;  1VMC A;  3JAM L;  1NJI C;  4DFA A;  4B3R Q;  2A8V A;  1EQV A;  3MFY A;  3GTK L;  1N33 Q;  1PFV A;  1TII D;  4A3L G;  1T5E A;  3DEP A;  2PZT A;  3HS0 C;  2JA6 L;  4N9P A;  3OWE B;  3NBI A;  4A3F B;  3T1H L;  2Q8T A;  1ESR A;  2JEB I;  1PH9 A;  1IBK Q;  1TWH H;  1LTI D;  1N9W A;  2Q8R E;  1H9M A;  4GN4 B;  3HOW B;  5FO7 B;  1XXG A;  3J81 L;  2EVB A;  1HNW Q;  4AHZ A;  3S1N H;  3VYU A;  3S1M B;  5IGE A;  1KRT A;  2D5D A;  5IWA L;  5M3M H;  1EYC A;  4BBS H;  1WCM L;  3PUY A;  1I5F A;  1B2J A;  3PUZ A;  1U5K A;  3M4O H;  4A3G B;  4MTN A;  3KLR A;  4A3E L;  5JEA H;  5CV7 A;  5IP7 G;  3KYW A;  3H0G B;  4M1U B;  1M4V A;  1EEF D;  1BVS A;  4B3S Q;  2K6A A;  4JI5 L;  3PO2 H;  2M4V A;  3CCS A;  2HQL A;  2B2W C;  2DN8 A;  1IXR A;  1VQO A;  3JAM i;  5I4D A;  1X54 A;  3TDQ A;  1SDF A;  3JAM E;  2VQF L;  2B2V A;  1WYD A;  3KUP A;  3J7A V;  3HOY L;  3TP8 A;  3WWN B;  1IYV A;  4OIJ A;  4IFD I;  2Q2U A;  3MA2 B;  4WFN 1;  3HZX A;  4R4I A;  1NR2 A;  2EJM A;  5GAH C;  2MNA A;  1IBL L;  3RZO L;  4A3B L;  4IOC A;  5K36 G;  5FLM H;  5KYL A;  2HT1 A;  1PFM A;  2RHQ B;  4DAY B;  5COY A;  3J81 i;  5CBE E;  5FJ8 L;  3CCE A;  1DON A;  2VUM H;  1K9M C;  3I8Z A;  4XQN A;  1FGU A;  4B3R L;  1U4M A;  2NVQ B;  1QB5 D;  1N33 L;  1K3B C;  4IJL A;  4JCV E;  1K8A C;  2QEX A;  4R9W A;  5CV6 A;  4JAD A;  3PWF A;  4X6A H;  1DGS A;  2CWP A;  2P5Z X;  3RLF A;  4C3I H;  2JJQ A;  1PA6 A;  3S1Q H;  2F0J A;  4HIO A;  4L5Q A;  2G9H D;  4YWL A;  1R0H A;  2QKI C;  2WB1 G;  1JE4 A;  2B63 B;  1DXM A;  2OTJ A;  2Y0S P;  1VQG A;  5ELF A;  3VYR A;  1HNW L;  2D62 A;  2O4X A;  1ICF B;  5M5W L;  3K8A A;  1MJE A;  5GAE C;  2WP8 J;  4G57 A;  2C9O A;  1VQN A;  2PYK A;  4DXG A;  2LY7 A;  1N34 Q;  5M3M G;  2HR5 A;  1LT5 D;  3M4Q A;  4JAE A;  5GQO A;  4LHN A;  3RR5 A;  4BBS G;  5DAU A;  4DR6 Q;  3LPE B;  3F8T A;  2RDG A;  3PZA A;  2JP1 A;  2DJG C;  4HED A;  4DAM A;  1F4L A;  5JEA G;  1WTR A;  1V1O A;  2JA8 H;  2MO0 A;  4PZ8 A;  3PO2 G;  1PH8 A;  4HJ9 A;  1E7Z A;  3MXN B;  1A3V A;  5LMU L;  3MQK B;  2NZH A;  3BJU A;  1R0F A;  1DOL A;  3TRZ A;  4V19 6;  1VMP A;  3FEW X;  5HY6 A;  4X3S A;  4EVO A;  1M90 C;  4B3M Q;  1B8A A;  1SNC A;  2V1C C;  2E76 C;  3ONA B;  4F88 A;  5KGU A;  3S16 L;  3Q8D A;  4OL7 A;  3ZG6 A;  2EIF A;  4G4K A;  3CU7 A;  2F3I A;  3PF5 A;  1K8G A;  2K32 A;  5FLM G;  3EIV A;  4JI8 Q;  2TMP A;  3AFQ A;  2RFK B;  1F2Y A;  1F9S A;  4JAG A;  3HOX L;  3X3N A;  2LFN A;  1QG7 A;  3GD7 A;  3PIP 3;  3K5N A;  4HMJ A;  2CW0 C;  1VQ8 A;  3E5S A;  2I0Q A;  1FNU A;  4P71 A;  3STB C;  3DXJ C;  4HCS A;  3VYT A;  4A3L L;  2JI3 A;  4Q5V A;  4ILW A;  3M4Y A;  1EY0 A;  4J1M A;  4C3I G;  3PQI A;  2AYJ A;  1IL8 A;  2E2J B;  3J7Z C;  1ZYR C;  2BA0 A;  1SRU A;  1N34 L;  3E0J A;  3NE5 B;  2WAQ B;  1CAA A;  1C09 A;  4A3M B;  1CKO A;  2DY7 A;  1E24 A;  4DR6 L;  4JYA Q;  1Q46 A;  4NXM Q;  3JC6 3;  4C3J L;  5IYB L;  1Q12 A;  4ZCK A;  2IL8 A;  3K80 C;  4A3C L;  1LTR D;  4AH6 A;  5C0X H;  1RD9 D;  2ZJQ A;  1I3Q B;  2WFW A;  3MXU A;  2L9H A;  2JA8 G;  1WJV A;  2KED A;  1YJW A;  3H97 A;  1ENA A;  5BR8 Q;  3Q6S A;  1VZH A;  2NTT A;  5EJW A;  3PKI A;  1QZH A;  1WD0 A;  1JWM D;  4B3M L;  4BY1 H;  1HRJ A;  5JEA J;  4J15 A;  1H9S B;  3ZJY C;  2AMC B;  1SYE A;  4JG2 A;  2E2D C;  1LTA D;  3T51 B;  2PCF B;  4GLA C;  2HCC A;  1KDC A;  3H6M A;  2FMM A;  1TXY A;  1SNM A;  5HUR A;  1IKL A;  1WVL A;  1SYG A;  1PTO C;  4Y52 L;  3CMA A;  1B2O A;  2WAC A;  1NSN S;  3NTH A;  4CBV A;  5C4X H;  2MFI A;  3TQY A;  1QUQ A;  1TQO A;  5AFW A;  2RVL A;  3AYH B;  4XTC S;  4XQQ A;  2R7Z G;  5DM6 1;  2B29 A;  3B08 B;  3CC4 A;  4C3H H;  3S17 B;  4AYB G;  1PZK D;  1YNJ C;  1LO5 D;  1B70 B;  4OWT B;  2BOS A;  1AE2 A;  1YHQ A;  1TWH L;  3BDO A;  2BH8 A;  4CGY B;  1VQH A;  3I72 A;  1PDQ A;  5C6A A;  4IPG A;  2HDM A;  4DV3 Q;  3K35 A;  2C5C A;  2M00 A;  2RCF A;  1T5X D;  1T9H A;  1K0R A;  4A3K L;  4JYA L;  3Q22 A;  1A3T A;  2UXB L;  1YV1 A;  2XJR A;  2YYZ A;  1IU6 A;  4NXM L;  5A35 A;  1Q8I A;  4JBM A;  1QOH A;  1QVC A;  1JB3 A;  2E2I B;  3J80 c;  1EFW A;  4R4Q A;  2ZIX A;  3GTM L;  3S15 B;  5C0X G;  4OXP A;  3NEM A;  3KF6 A;  5BR8 L;  2PMZ P;  4RGT A;  3CQZ L;  4A93 H;  1CKM A;  1F2L A;  2CQA A;  4JAF A;  3H15 A;  1ET9 A;  4BY1 G;  3DM3 A;  2F3V A;  2NVX L;  1R9T B;  1K3R A;  2O5I C;  2J4X A;  4FYD A;  4BBR L;  5H1S c;  1BCP B;  1Z7T A;  2NTS A;  3DWP A;  1SMM A;  1S5B D;  2WB1 E;  1V1P B;  3GTG L;  5C44 L;  4LFA Q;  5CMD A;  4K0K L;  4DF7 A;  3UE1 A;  3LWP B;  5M3F H;  2WB1 B;  1TWH B;  2B2Y C;  5JJL A;  3NEN A;  1SYD A;  4XXB B;  5C4X G;  3UDG A;  5CGK A;  3LWO B;  2C35 B;  4JI4 Q;  4LFC L;  3A5Z B;  1HZ9 A;  3CRK C;  4BXX L;  4C3H G;  3PCO B;  3S1N B;  3I3C A;  3TSS A;  3FRP B;  5M3M B;  3UDX A;  1WD1 A;  3S1Q L;  4BBS B;  5IYD H;  3CCM A;  4GOP A;  3G48 A;  3M4O B;  3CRL C;  2HDL A;  3H3V M;  2QDL A;  4A4I A;  1XX8 A;  4DV3 L;  3GTM B;  2L0Z A;  1Q1B A;  3BZK A;  5NUC A;  2E5L Q;  3TS0 A;  1K83 L;  2AUJ D;  4DV1 Q;  3PO2 B;  1L1O A;  2FMC A;  2R92 L;  3Q24 A;  1YVC A;  1XPR A;  2F52 A;  1NXE A;  5FLX c;  1CA5 A;  2YTV A;  2KEN A;  1TWG L;  1NTG A;  4HJ7 A;  4FF3 A;  2KN9 A;  4LW1 A;  1JOR A;  4UHV A;  4YY3 Q;  5IOC A;  2F0K A;  1N36 Q;  2K5W A;  1FHM A;  1UAP A;  4A93 G;  2PQE A;  5MFZ A;  3J7A 5;  3C1E A;  5AN9 H;  3GTQ H;  4GS3 A;  3DLL A;  4JBK A;  4YHH Q;  1HHV A;  2F0D A;  3HOV H;  4PZ6 A;  4CDD C;  1YJN A;  5IT9 c;  3CCL A;  3DEO A;  3D0F A;  3PO3 H;  3OWF A;  1B7Y B;  1M1K C;  2PPT A;  1EWI A;  3BS1 A;  1SFO H;  4LF6 Q;  1PYW D;  1ODH A;  4LFA L;  4G7H C;  4LF5 Q;  5MLC 3;  1NY4 A;  4AHY A;  3EVQ A;  1G91 A;  2Q2H A;  4C3I B;  1BOS A;  5GAD C;  1WTQ A;  3S1Q B;  2EYL A;  2MQH A;  5M3F G;  4FO2 A;  2B2T A;  4UPA A;  3KJO A;  1UE1 A;  2Q2I A;  3G71 A;  4JI4 L;  2B2W A;  4IPC A;  3J80 L;  4L5R C;  2B8F A;  1Q1E A;  1WTV A;  4FF1 A;  2QW7 A;  2R7Z L;  2CW0 D;  1KHI A;  3UI2 A;  1XMO Q;  3H94 A;  2KHJ A;  4PMW A;  1NBW A;  3STB D;  1JB7 A;  3GTO L;  1DM0 B;  4HJA A;  3F2D A;  5IYD G;  1QE6 A;  1QVG A;  4RFB A;  2E5L L;  4NDX A;  2L12 A;  3WOE A;  4I65 A;  2R61 A;  1UNS A;  4DV1 L;  2B8G A;  1TWA L;  1VQ7 A;  2JA8 B;  3KOJ A;  1ZYR D;  5JVG 1;  3TBI B;  3TZU A;  1Y1W H;  2F3W A;  3M7G A;  4X3U A;  2XJQ A;  1OWC A;  4EX5 A;  1S72 A;  2EY1 A;  4LUO A;  4OWX B;  4PG3 A;  4YY3 L;  2K14 A;  3NQI A;  1RTN A;  1N36 L;  2DNE A;  4XDX A;  1II3 A;  3BZC A;  2PZU A;  1AE3 A;  5E1F A;  2F0E A;  2F0Q A;  3VYS A;  2ENB A;  5IGF A;  3E9I A;  1VQE A;  4KMU C;  1U4R A;  1AZQ A;  5L37 A;  1EOT A;  2FFK B;  1BDO A;  2ZXO A;  2R93 H;  2XSC A;  1L0Y B;  5D3I B;  4FF2 A;  4A3G G;  2EY4 E;  3NSW A;  3I55 A;  4POF A;  2NVT H;  2YU9 H;  3HOV G;  3PO3 G;  5JOB A;  1BBX C;  1NR4 A;  4LF6 L;  4AYB E;  3L3O C;  2HVY C;  4DK3 C;  5M9O A;  3RZD H;  4LF5 L;  3CC7 A;  4RH6 A;  5GRO A;  4DV5 L;  1GUO A;  1OXT A;  3GV3 A;  4AYB B;  4DUY Q;  1BFY A;  4GN5 A;  3MPS A;  3L9A X;  1CQV A;  1MHW C;  2ZXP A;  1PTO D;  5GAG C;  5FLX L;  1WTP A;  2OCE A;  1GO3 E;  2NBF A;  1OO9 B;  3MWY W;  1FJG Q;  1XMO L;  4DN4 M;  1LAB A;  3S2H L;  1WOC A;  1HR0 W;  4P73 A;  5IIF A;  4A3I H;  5J39 A;  3CCJ A;  1KDB A;  4ZUI A;  2RDH A;  1S2Z A;  1ET6 A;  1YNJ D;  1TWC L;  5D65 A;  1C8C A;  3V2T A;  3A7L A;  3MEH A;  5IT9 L;  4ALP A;  1YBY A;  4HIM A;  3G7L A;  2KA7 A;  2IJ0 A;  2NN6 H;  5FO9 B;  5I2Y A;  4DR3 Q;  1O7L A;  3NBH B;  3UE0 A;  2KJX A;  1IKM A;  3JAM c;  4BY1 B;  3FKI L;  1C4Q A;  1BUV T;  2XN9 C;  2B63 G;  2SNS A;  5DNF A;  2NB0 A;  5M5Y H;  2D0O A;  4RKB A;  5JVH 3;  2NVY H;  7RXN A;  1I4P A;  1PFN A;  3L7Z C;  4PNY A;  3S1R L;  5A2Q L;  2JXM B;  5FLX E;  2NWG A;  2A69 C;  2CH4 W;  2K4K A;  3PKJ A;  2ICE C;  4YWM A;  1E1T A;  5CV5 A;  2R93 G;  3E6Z X;  3ER0 A;  3M3Y H;  2DSX A;  1JT8 A;  2NUC A;  1PH1 A;  1VQ4 A;  2G9D A;  2KCN A;  3AU7 A;  5C4X B;  4HMI A;  4HTH A;  1A2U A;  2F0N A;  2L15 A;  4DUY L;  2MPM A;  4C3H B;  4OO1 I;  1K28 A;  4GNX A;  1ZRP A;  4RMF A;  5C3E L;  5EAY A;  1FJG L;  3KYH C;  4ZRZ A;  4DV7 Q;  3S14 H;  1HUM A;  1C48 A;  3QQC E;  3KLS A;  4A3I G;  1VQD A;  3J7Y 1;  2HIV A;  1LTG D;  4BA2 I;  1VQP A;  2WAQ P;  4O1N A;  5EBC A;  3T1H Q;  4DA2 A;  2K5H A;  2B39 A;  2MJ8 A;  1EIF A;  2RQX A;  1U4P A;  2JA5 H;  3Q0A A;  3GTL H;  4DR3 L;  4AI0 A;  3A74 A;  3BU2 A;  1TVX A;  2NN6 G;  1GUS A;  2PNH A;  1J6Q A;  4A93 B;  2LS0 1;  1D1I A;  2QCP X;  4A3F L;  4R4O A;  3MTS A;  3QOJ A;  3F2C A;  3HOW L;  4X62 Q;  3K6O A;  4QB4 A;  1EU4 A;  1PZJ D;  1QQT A;  1BCP F;  1EQQ A;  4JI5 Q;  1LV9 A;  3S1M L;  4IUR A;  3OYY A;  4CHT B;  4GZY C;  1FL0 A;  4NMZ A;  1GM5 A;  1Z9F A;  3TEH B;  4A3G L;  5M3F B;  3KYV A;  1VQF A;  3H0G L;  4N9T A;  3PIP 1;  3CW2 C;  5JPN C;  2UXC Q;  2XRS D;  3TRE A;  4HCE A;  3V96 A;  1Q90 A;  5I9O A;  1B53 A;  1G2T A;  1U4L A;  3AQQ A;  2HHH Q;  1V9P A;  1STY A;  2D0P A;  3FMC A;  1B3Q A;  4DV7 L;  3NXW A;  3LWV B;  2QF7 A;  5KIX A;  1LM0 A;  5LMN W;  1PH6 A;  4RHS A;  4DPG A;  3H9B A;  2Z6K C;  1U0L A;  1YHB A;  1ILP A;  1B2T A;  2K5V A;  3I73 A;  1S5F D;  3KDF A;  1UUP A;  3C1F A;  2I5L X;  1M8A A;  2UUC Q;  4ZAI A;  4HAE A;  1NCV A;  1DVB A;  2RDF A;  2CKZ B;  3GV6 A;  3PF4 A;  2VXW A;  1X6O A;  1LT6 D;  4DUZ Q;  4PMB A;  3K59 A;  2NVQ L;  4IPD A;  3U4Z A;  3CCU A;  3N6R A;  2JA5 G;  1HZA A;  4JOI C;  2CWA A;  4NXN Q;  4B9W A;  2HUG A;  3GTJ H;  4RKL A;  1UEA B;  2XWJ B;  5LL6 X;  1BCP C;  2B2Y A;  1CA6 A;  3GTQ B;  1RDV A;  2GVA A;  1F2M A;  2RKS A;  4X62 L;  4XXE A;  2B63 L;  4KJO A;  3RN2 A;  3HOV B;  2L1B A;  2JA7 H;  3PO3 B;  3D6C A;  5G3L D;  1A63 A;  4WJ4 A;  3HG9 A;  1SFO B;  1MKH A;  1PFW A;  4RA8 A;  1D8L A;  5EIN C;  2NYZ D;  1JR0 D;  5LMU Q;  3QVD A;  4DU9 A;  3FPU B;  2IW3 A;  3BVM A;  1JCK B;  1VQA A;  2UXC L;  4ZUJ A;  2PO4 A;  2F0W A;  1PZX A;  4Y7N H;  2WB1 P;  4N8X 1;  2HHH L;  2VZA A;  1Z6H A;  3RLO A;  1JJ2 A;  1MJC A;  5E4X A;  2MHV A;  2AQ2 B;  3JC6 2;  3MAQ A;  1JJG A;  2PVE A;  1F9R A;  4AI1 A;  5DM7 3;  2R3Z A;  5E7N A;  1EY6 A;  4G6B A;  1EIH A;  1O80 A;  1N32 Q;  1Q3L A;  2SOB A;  2UUC L;  1CSP A;  1EZ6 A;  2EYJ A;  5LMN Q;  1Y1W B;  1EFI D;  5EPJ A;  1S40 A;  1HXY D;  4DUZ L;  4Z9C B;  2M4Y A;  2C6A A;  3P75 A;  4ODG A;  3MEF A;  3R93 A;  2EQS A;  1JOK A;  3EQL C;  2EYO A;  4NXN L;  1SE2 A;  1UE7 A;  5J1Z A;  1AP0 A;  3W1B A;  4QIW P;  1G6P A;  1L0X B;  2F0P A;  2L5T A;  1U9R A;  3I70 A;  3NP8 A;  4OWW B;  2XJP A;  1STG A;  3PIO 3;  2R93 B;  3A54 A;  3H99 A;  1HQM C;  5MF6 A;  2E2J L;  1O7Y A;  2NVT B;  1S3O A;  2YU9 B;  2JA7 G;  1KRS A;  5EPL A;  3U50 C;  2YTY A;  2N88 A;  1STH A;  3RZD B;  2VQE Q;  1I50 H;  1HPC A;  4A3M L;  3P20 A;  2V4D A;  5IYC L;  1Y14 B;  3I91 A;  3I4N H;  3K5O A;  2N49 A;  2A69 D;  1OTC A;  3P8B A;  5I6Y A;  1VQ5 A;  3OW7 A;  1FNV A;  1SMW A;  1F9P A;  2JE6 I;  3SXH A;  2L11 A;  1I3Q L;  1TWF H;  1WI5 A;  4A3I B;  5GAH c;  4L5S A;  1XTC D;  2AQ1 B;  4NPS A;  5EIO C;  4DAY A;  2VUM G;  3G6J B;  1BO0 A;  4B9X A;  2K2D A;  5IOD A;  4KHV A;  2MGS A;  2I46 A;  5IP9 L;  2GA4 B;  4NP5 A;  1S24 A;  1EU3 A;  1N32 L;  3LNL A;  1RHP A;  5LMN L;  5JJK A;  1VCX A;  1G2S A;  3J81 j;  5ELB A;  3L2P A;  3I4O A;  1SNP A;  3OMG A;  1EY9 A;  4DR5 Q;  4IQZ A;  5EQ0 A;  1Q8K A;  3OPO A;  3KLW A;  3PV0 A;  2WAQ E;  1B50 A;  4GLV B;  2ATW A;  5M5X H;  1TT2 A;  5IY0 A;  5M5Y B;  4F87 A;  1A15 A;  2F0L A;  1TY2 A;  2NVY B;  4GKK Q;  2VS1 A;  4R8N A;  4DK0 A;  2QEJ C;  5T1I A;  2JK8 A;  3S17 L;  5GAE c;  4LF4 Q;  2HQE A;  2IWH A;  4DR1 Q;  4P74 A;  4KD4 A;  2DY8 A;  4CDE C;  1XNR L;  3AB9 A;  2F4V L;  1X3G A;  1DYQ A;  2UXB Q;  1X3Q A;  3SVM A;  3M3Y B;  4IFD H;  2BA1 A;  2OT2 A;  5IP7 L;  2CH4 A;  2RBM A;  1SND A;  5AI3 A;  2R6G A;  1JOO A;  1OXU A;  4QL5 A;  2VQE L;  2ASB A;  1ML0 D;  5ISR A;  1VQK A;  3I4M H;  3CXC A;  4LNQ A;  3VA7 A;  4S3S A;  2EYH A;  3MXN A;  2LXK A;  3I4N G;  4IUQ A;  3K5M A;  2E2I L;  2APO B;  3DUZ A;  4AYB P;  4OHJ A;  1NUC A;  2A73 B;  3S15 L;  2ZTD A;  3S14 B;  1T9Q A;  4JBW A;  1I4R A;  2XNA C;  1DD2 A;  1VDZ A;  4YCU A;  1HJP A;  2L0C A;  4HID A;  2E2H H;  1E0B A;  2XJU A;  4DAV A;  5CV9 A;  3B0A B;  1SMX A;  1Y69 U;  4K0K Q;  4UY8 1;  2EOT A;  1TU2 B;  1BE7 A;  1R9T L;  4IN3 A;  4GKJ Q;  4G7Z C;  1O7Z A;  2JA5 B;  4J6H A;  5ELD A;  2OF1 A;  4DR5 L;  3GTL B;  1B4O A;  3SR1 A;  4LFC Q;  1SEB D;  1KNA A;  3LWU A;  3GTP H;  3ERQ A;  2LKV A;  4FNF A;  3D4D A;  2HIX A;  3QJY A;  1RDG A;  2PQA B;  4UP8 A;  4XT3 B;  1Y1V H;  4A3J H;  2A6E C;  3ULP A;  4GKK L;  4CDC C;  3HEJ A;  3S2D H;  1SYF A;  4X65 L;  3I56 A;  1XYI A;  4DV6 Q;  4LF4 L;  4JI6 Q;  4DR1 L;  1PRT F;  2MUY A;  3S1N L;  4V0B A;  3C3L A;  3KYX A;  5M3M L;  3R8B A;  4BBS L;  1RYQ A;  3M4O L;  2DGY A;  1K0S A;  1BCP D;  3A7A B;  4EGV A;  4IFD G;  4LF7 Q;  5KRU A;  3I4M G;  3PL5 A;  3PO2 L;  1PLF A;  2EJG C;  2DJF C;  2ICI A;  2QGQ A;  3T4A C;  1EY7 A;  4DV2 L;  3NK9 A;  2OQK A;  1Z92 B;  3T53 B;  2QDB A;  1JOQ A;  1NMF A;  1YI2 A;  1H9S A;  5ELC A;  1FNW A;  3T16 A;  4DNT B;  5C4J H;  3W3A A;  2F0U A;  5FLM L;  2UXD Q;  3GP7 A;  4O0A A;  3KFU A;  2X69 A;  1WJJ A;  1RWD A;  1RYT A;  2VUM L;  2J7Z A;  3I4L A;  5FO8 B;  3QR8 A;  1PH7 A;  4GKJ L;  3J7Y W;  1PH3 A;  5T1G A;  3M4P A;  4PMC A;  1QYB A;  2R7D A;  6RXN A;  3OW2 A;  2K05 A;  3GTJ B;  4HR7 B;  2KEE A;  3BDC A;  1VQ6 A;  1IZ6 A;  4X6A L;  4C3I L;  5IE8 A;  5KNB A;  1TKW B;  1EYG A;  2OQ0 A;  1P7P A;  4MNO A;  2YV5 A;  4ABN A;  4DV6 L;  4JI6 L;  2JA7 B;  1STN A;  5IGG A;  5JVH 1;  3MXP A;  4LK1 C;  4RWS C;  1BBW A;  1GHK A;  4QIW E;  2EE1 A;  1B44 D;  1OXS C;  4UP9 A;  3SK8 A;  1ZXT A;  2KUM A;  1PYS B;  2AQC A;  4LF7 L;  3K7A H;  4QIW B;  2AUK A;  2XTI A;  4A3D H;  4DR7 Q;  3K57 A;  4JI1 Q;  3ZYY X;  3LGJ A;  1HUN A;  1H9J A;  4TVM A;  2JA8 L;  4Y7N B;  1LKO A;  1LYL A;  1SAP A;  2KVM A;  3EJI A;  5IGC A;  2VUM B;  1HFN A;  4HN7 A;  3ULL A;  5C0X J;  1AW7 A;  1KDA A;  3J7A F;  4DNR B;  1KXL A;  1GVP A;  1I94 Q;  2CKA A;  1WTO A;  3RUZ A;  4OX9 Q;  1I6H H;  1YZ6 A;  2UXD L;  1BKB A;  2F0S A;  4TKO B;  3G6E A;  2N8N A;  1B13 A;  4PQX A;  3W1G A;  1X9N A;  3CF5 A;  2AKW B;  3BYY B;  4DV5 Q;  1Q82 C;  5JJI A;  3GQB A;  1K8O A;  1EOV A;  1Q7Y C;  1Y8O B;  1Y8P B;  3OSO A;  1Z47 A;  1V1P A;  4K6L A;  5FK9 C;  2UUA L;  1SJH D;  4IUT A;  2K5D A;  1H9R A; 
#chains in the Genus database with same CATH homology
 2RF4 A;  1J5E L;  4QJF A;  2AWO A;  4BA1 I;  1K73 C;  1W2B A;  3GTK H;  1KAW A;  1A62 A;  1PV4 A;  1OXV A;  2JA6 H;  2ES2 A;  2OTL A;  3RZ6 A;  2KBN A;  4DR7 L;  4JI1 L;  1B71 A;  2ZTE A;  2V3B B;  4A3D G;  4AI2 A;  4K9F A;  1YUZ A;  1VZG A;  1WCM H;  4LF8 L;  1I94 L;  4OX9 L;  4IPH A;  4JC0 A;  4A3E H;  2V0E A;  4QQB X;  2XGT A;  2PVX A;  1R0G A;  1YIT A;  5GAD c;  3HOY H;  3RLN A;  3KJP A;  1C9O A;  2UU9 Q;  3WWV A;  1NE3 A;  2LXJ A;  4P72 A;  4DV4 Q;  4A3B H;  3RZO H;  4X66 Q;  1JE5 A;  4YCV A;  4YCW A;  3T1Y L;  2H5X A;  5FJ8 H;  1HNX L;  3M7N A;  4DKA C;  1HZB A;  4DR2 L;  2A6E D;  3M85 A;  2PI2 E;  1Y1W G;  3CCV A;  1YIJ A;  2JA6 G;  4KI0 A;  2ID0 A;  1HNZ Q;  1X56 A;  3E0E A;  2YTX A;  1CKN B;  3PSI A;  1SRO A;  5M5W H;  3RYG A;  2E8G A;  2VW9 A;  1XTD A;  1WCM G;  4ME3 A;  3HOU H;  3SGI A;  4C2M H;  1X55 A;  5DM7 1;  1ASY A;  4B8C D;  4DR4 Q;  4AQY L;  4DK6 C;  3HOZ H;  4X64 Q;  1IYJ B;  2UU9 L;  3HOY G;  1O7I A;  4AR6 A;  4DV4 L;  5GAG c;  3S16 H;  4HJ5 A;  4X66 L;  4A3B G;  1X65 A;  1A8V A;  1IRO A;  1HR0 Q;  3KF8 B;  1KIX A;  1EUJ A;  3HOX H;  5FJ8 G;  3PIO 1;  4UY8 C;  4GS7 D;  2IX1 A;  1YEZ A;  3E9H A;  4R4T A;  4A3L H;  3EBE A;  1BQ8 A;  1HNZ L;  2CQO A;  5RXN A;  1XNQ Q;  1S30 A;  2Z3R B;  2K75 A;  1QZG A;  3H3V H;  5ELO A;  4TQU S;  1IU5 A;  3B6Y A;  1G29 1;  3EN2 A;  4ZN3 B;  3CPF A;  4JBJ A;  4C3J H;  2MS3 A;  4POG A;  5IYB H;  3HOU G;  3I2Z A;  4A3C H;  1LKP A;  5MFP A;  3CP0 A;  4DR4 L;  2MO1 A;  1E22 A;  2EXD A;  4X64 L;  2V0F A;  3HOZ G;  2CR8 A;  1OWB A;  4HIK A;  4RG1 A;  2M6P A;  3CME A;  4GOP C;  4R1J A;  1HH2 P;  1HR0 L;  1SLJ A;  1IBM L;  3RZT A;  2VY3 A;  3CAM A;  1D7Q A;  3HOX G;  4Y52 H;  1E8J A;  2XJT A;  1Q81 C;  2QL0 A;  1L2F A;  2ZTC A;  3GDE A;  3NFP I;  1SE8 A;  3VPB E;  1LTL A;  1XNQ L;  3FP9 A;  3WWL A;  1X3E A;  4NB3 A;  2B5I D;  3PIP A;  1YK4 A;  1YK5 A;  4A3K H;  4YWK A;  5AJ3 Q;  1V1Q A;  1VZI A;  3A5U A;  1CAD A;  2R7F A;  3CCR A;  5IYB G;  3GTM H;  4A3C G;  4LHL A;  2IHE A;  3KYY A;  3K81 C;  3ICE A;  4O2D A;  2ZM6 Q;  2ERS A;  3CQZ H;  1ASZ A;  2RDV A;  2NVX H;  3GO5 A;  1PHJ A;  5MGN A;  5K2M E;  4BBR H;  3CCQ A;  5C0X I;  4UP7 A;  3IU3 I;  3GTG H;  5C44 H;  1AH9 A;  4AR3 A;  1VQC A;  2NZO A;  1VQB A;  2NYD A;  1KC8 C;  3AEV A;  4WJ3 M;  4BXX H;  2A68 D;  2KKD A;  1XNR Q;  1IBK L;  2F4V Q;  2A1A A;  2I5H A;  4LUZ A;  3TS2 A;  2AWN A;  1K83 H;  4QY7 A;  2N3S A;  2R92 H;  4OO1 G;  5AJ3 L;  1UWV A;  4A3K G;  1YHA A;  2BH2 A;  4JI0 Q;  1TWG H;  1R0J A;  4IO9 A;  2K50 A;  4B3S L;  2ZM6 L;  2PYA A;  2KHI A;  4XGH A;  3F2B A;  2Y0S G;  1MIU A;  2LCQ A;  2RCN A;  3PUX A;  2ALY B;  4BBR G;  3RN5 A;  4A75 A;  5C44 G;  1NMG A;  2GN5 A;  1QUQ B;  4JI3 Q;  4P75 A;  4R4C A;  3ERS X;  3PUV A;  2B3G A;  4X65 Q;  4BY7 H;  2JQO A;  2R7Z H;  1XJV A;  3HFZ B;  4BXX G;  3GTO H;  4AR5 A;  4DV0 Q;  3CPW A;  1TWA H;  1BQ9 A;  5DLQ E;  1E1O A;  2IX0 A;  2R92 G;  2JI2 A;  4JI0 L;  2I5M X;  1C7Y A;  4DV2 Q;  2CCZ A;  1QVF A;  4GNX C;  3U4V A;  3KF6 B;  3IRB A;  8RXN A;  3D31 A;  4GLX A;  4LFB Q;  1R0I A;  3P2A A;  1L0W A;  4IJH A;  1A0I A;  3S24 A;  1VQJ A;  2A19 A;  4JI8 L;  2A6H D;  4JI3 L;  4TPU A;  4TVA B;  3F1Z A;  5HGQ A;  3CD6 A;  3S2H H;  4BY7 G;  1PH5 A;  4KHZ A;  1G51 A;  1KL9 A;  4DV0 L;  4GOP B;  2PSM C;  2O5J D;  1TWC H;  2KCT A;  1L1O B;  2Q2T A;  3UDF A;  2JEA I;  4XIG S;  5ELN A;  4EQ5 A;  4KHP Q;  1QCV A;  3JC6 6;  1T9P A;  3FKI H;  4PZ7 A;  2VL6 A;  2CKC A;  1JYB A;  3PUW A;  1JMC A;  2N78 A;  2OWO A;  3S1R H;  4LFB L;  3MSU A;  3AFP A;  4JV5 Q;  2VNU D;  3CC2 A;  4AHW A;  1HZC A;  4IOA A;  3VDY A;  2UUA Q;  1VQL A;  1J5E Q;  2GVB A;  3L0O A;  1Y1V G;  4A3J G;  2UUB Q;  2PQA A;  1P8L A;  5C3E H;  2QA4 A;  3NEL A;  1DX8 A;  3I7F A;  3PGZ A;  5AI2 A;  4LF9 Q;  4B3T Q;  2RHS B;  3M9B A;  1GKH A;  2Z6K A;  3K0X A;  4APV A;  3UDI A;  1RIP A;  2Y0S E;  1KD1 C;  1SR3 A;  2ZJP A;  4KHP L;  2ZJR A;  4IFD J;  4A3F H;  1XMQ Q;  4JOI A;  4LF8 Q;  3FKI G;  3HOW H;  3A0J A;  4JV5 L;  1BBU A;  3S1M H;  2CFM A;  1NXG A;  2NN6 I;  4A3G H;  4JI2 Q;  3H0G H;  1SN8 A;  1JJC B;  2K52 A;  4JI7 Q;  1RL2 A;  4GN3 B;  2XJV A;  2UUB L;  2H12 A;  3T1Y Q;  1VQ9 A;  1HNX Q;  2J9U B;  5C3E G;  4DR2 Q;  4MZ9 A;  1V43 A;  4AIM A;  1Q86 C;  4LF9 L;  4B3T L;  2M6O A;  3HKZ G;  4H02 A;  1H7V A;  1YUX A;  1E3P A;  2NVQ H;  1VQM A;  1WFQ A;  1VQI A;  1XMQ L;  4HJ8 A;  4DNI A;  3K7U C;  4A3F G;  1N8R C;  1LKM A;  2B63 H;  1XPU A;  3HOW G;  1KQS A;  4E6Y A;  1CSQ A;  3J80 i;  1VS0 A;  4JI2 L;  2K5N A;  4AI3 A;  4AQY Q;  4YHH L;  3KYU A;  3RNU A;  3OTO Q;  3H0G G;  4JI7 L;  1FHH A;  2AHO B;  1EIY B;  3H3V I;  4GNX B;  1C0A A;  2Z3Q B;  1X3F A;  3A44 A;  3J7Z 1;  5H1S E;  1LUZ A;  4AR4 A;  3HKS A;  1IRN A;  1PVO A;  2IY5 B;  1PYB A;  4LUV A;  2IHF A;  2FXQ A;  2JI1 A;  2XJS A;  4L5T A;  2ERJ A;  1YJ9 A;  2LSS A;  2GMG A;  1RB9 A;  1W3S A;  4ZN1 B;  3U58 A;  4A3E G;  2E2J H;  4KLK A;  4AHX A;  4U67 1;  1P16 A;  2C6B A;  1UE5 A;  4A3M H;  2PMZ E;  5IYC H;  3ULJ A;  3OTO L;  3SS2 A;  1VCI A;  1UE6 A;  3J81 c;  4QGU A;  1NNQ A;  1I3Q H;  1XPO A;  2BE5 D;  3G4S A;  1IBM Q;  1YNX A;  1CUK A;  5IP9 H;  2Z0S A;  3KDF B;  1UEB A;  3W5O A;  1FVI A;  2PI2 A;  1EQR A;  1CKN A;  1SMU A;  2JA9 A;  3S17 H;  2DUD A;  5IWA Q;  1H95 A;  5IP7 H;  4RXN A;  2KCM A;  1GD7 A;  5J3B A;  4A76 A;  1IL2 A;  2WAQ G;  1PH4 A;  4A3M G;  5IYC G;  3PIO A;  3FHW A;  2E2I H;  2VQF Q;  4LWC A;  1IW7 D;  3HKZ E;  3S15 H;  1T9O A;  4FDB A;  1BRF A;  1IBL Q;  1L1O C;  1PFS A;  1PH2 A;  4OON A;  1OXX K;  2IT1 A;  1R9T H;  5IP9 G;  1NJI C;  4B3R Q;  2A8V A;  1N33 Q;  4A3L G;  3T1H L;  1IBK Q;  2JEB I;  1PH9 A;  1TWH H;  1N9W A;  4GN4 B;  1HNW Q;  4AHZ A;  3S1N H;  1KRT A;  5IWA L;  5M3M H;  4BBS H;  3PUY A;  1I5F A;  3M4O H;  1B2J A;  1U5K A;  3PUZ A;  4MTN A;  5IP7 G;  3KYW A;  1BVS A;  4B3S Q;  4JI5 L;  3PO2 H;  3CCS A;  2M4V A;  2HQL A;  1IXR A;  1VQO A;  3JAM i;  1X54 A;  2VQF L;  1WYD A;  3WWN B;  4IFD I;  2Q2U A;  4WFN 1;  4R4I A;  5GAH C;  2MNA A;  1IBL L;  5K36 G;  4IOC A;  5FLM H;  2HT1 A;  2RHQ B;  4DAY B;  3J81 i;  3CCE A;  2VUM H;  1K9M C;  1FGU A;  4B3R L;  1N33 L;  4IJL A;  4JCV E;  1K8A C;  2QEX A;  4JAD A;  3PWF A;  4X6A H;  1DGS A;  2CWP A;  3RLF A;  4C3I H;  2JJQ A;  1PA6 A;  3S1Q H;  4HIO A;  4L5Q A;  4YWL A;  1R0H A;  2WB1 G;  2OTJ A;  1VQG A;  1HNW L;  2D62 A;  3K8A A;  1MJE A;  5GAE C;  2WP8 J;  1VQN A;  1N34 Q;  5M3M G;  2HR5 A;  3M4Q A;  4JAE A;  5GQO A;  4LHN A;  3RR5 A;  4BBS G;  4DR6 Q;  3LPE B;  3F8T A;  3PZA A;  4DAM A;  5JEA G;  2JA8 H;  2MO0 A;  4PZ8 A;  3PO2 G;  1PH8 A;  4HJ9 A;  1E7Z A;  3MXN B;  5LMU L;  2NZH A;  3BJU A;  1R0F A;  3TRZ A;  4V19 6;  5HY6 A;  1M90 C;  4B3M Q;  1B8A A;  2V1C C;  3Q8D A;  3ZG6 A;  2EIF A;  2F3I A;  3PF5 A;  1K8G A;  5FLM G;  3EIV A;  4JI8 Q;  3AFQ A;  4JAG A;  3GD7 A;  1VQ8 A;  2I0Q A;  4P71 A;  3STB C;  2JI3 A;  2AYJ A;  3J7Z C;  2BA0 A;  1SRU A;  1N34 L;  1CAA A;  1C09 A;  1CKO A;  1E24 A;  4DR6 L;  4JYA Q;  1Q46 A;  4NXM Q;  3JC6 3;  1Q12 A;  3K80 C;  4AH6 A;  2ZJQ A;  2WFW A;  2JA8 G;  1WJV A;  1YJW A;  5BR8 Q;  1VZH A;  3PKI A;  1QZH A;  4B3M L;  4BY1 H;  5JEA J;  4J15 A;  3ZJY C;  2AMC B;  4JG2 A;  4GLA C;  1TXY A;  3CMA A;  1B2O A;  5C4X H;  2MFI A;  3TQY A;  1QUQ A;  3AYH B;  4XTC S;  2R7Z G;  5DM6 1;  2B29 A;  3B08 B;  3CC4 A;  4C3H H;  4AYB G;  1B70 B;  4OWT B;  1AE2 A;  1YHQ A;  2BH8 A;  1VQH A;  4IPG A;  4DV3 Q;  3K35 A;  1T9H A;  1K0R A;  4JYA L;  2UXB L;  1YV1 A;  2XJR A;  2YYZ A;  1IU6 A;  4NXM L;  4JBM A;  1QVC A;  3J80 c;  1EFW A;  4R4Q A;  2ZIX A;  5C0X G;  4OXP A;  3NEM A;  3KF6 A;  5BR8 L;  4A93 H;  1CKM A;  4JAF A;  3H15 A;  4BY1 G;  3DM3 A;  1K3R A;  5H1S c;  1SMM A;  2WB1 E;  4LFA Q;  4K0K L;  3UE1 A;  5M3F H;  5JJL A;  3NEN A;  4XXB B;  5C4X G;  3UDG A;  2C35 B;  4JI4 Q;  4LFC L;  3A5Z B;  1HZ9 A;  3PCO B;  3UDX A;  5IYD H;  3CCM A;  4GOP A;  3G48 A;  4A4I A;  4DV3 L;  2L0Z A;  1Q1B A;  3BZK A;  2E5L Q;  3TS0 A;  4DV1 Q;  1L1O A;  1YVC A;  1XPR A;  2F52 A;  1NXE A;  5FLX c;  2YTV A;  2KEN A;  1NTG A;  4HJ7 A;  2KN9 A;  4LW1 A;  4YY3 Q;  1N36 Q;  1FHM A;  4A93 G;  5MFZ A;  3J7A 5;  5AN9 H;  3GTQ H;  4GS3 A;  3DLL A;  4JBK A;  4YHH Q;  3HOV H;  4PZ6 A;  1YJN A;  3CCL A;  5IT9 c;  3D0F A;  3PO3 H;  1B7Y B;  1M1K C;  2PPT A;  1EWI A;  1SFO H;  4LF6 Q;  4LFA L;  1ODH A;  4LF5 Q;  5MLC 3;  1NY4 A;  4AHY A;  2Q2H A;  5GAD C;  2MQH A;  5M3F G;  4UPA A;  3KJO A;  1UE1 A;  2Q2I A;  3G71 A;  4JI4 L;  4IPC A;  4L5R C;  1Q1E A;  1XMO Q;  1KHI A;  2KHJ A;  4PMW A;  1NBW A;  3STB D;  1JB7 A;  4HJA A;  3F2D A;  5IYD G;  1QVG A;  2E5L L;  4DV1 L;  1VQ7 A;  3KOJ A;  5JVG 1;  1Y1W H;  2XJQ A;  1OWC A;  4EX5 A;  1S72 A;  4LUO A;  4OWX B;  4PG3 A;  4YY3 L;  2K14 A;  1N36 L;  3BZC A;  1AE3 A;  3E9I A;  1VQE A;  2R93 H;  4A3G G;  3I55 A;  4POF A;  2NVT H;  2YU9 H;  3HOV G;  3PO3 G;  4LF6 L;  4AYB E;  4DK3 C;  3RZD H;  4LF5 L;  3CC7 A;  5GRO A;  4DV5 L;  1OXT A;  4DUY Q;  1BFY A;  4GN5 A;  3MPS A;  5GAG C;  2OCE A;  1GO3 E;  1FJG Q;  1XMO L;  1WOC A;  1HR0 W;  4P73 A;  4A3I H;  3CCJ A;  1S2Z A;  4ALP A;  1YBY A;  4HIM A;  4DR3 Q;  3NBH B;  3UE0 A;  3JAM c;  2B63 G;  5M5Y H;  2D0O A;  2NVY H;  7RXN A;  3L7Z C;  2K4K A;  3PKJ A;  4YWM A;  1E1T A;  2R93 G;  3ER0 A;  3M3Y H;  2DSX A;  1JT8 A;  1PH1 A;  1VQ4 A;  2L15 A;  4DUY L;  4OO1 I;  4GNX A;  1ZRP A;  4RMF A;  5EAY A;  1FJG L;  3KYH C;  4DV7 Q;  3S14 H;  3QQC E;  4A3I G;  1VQD A;  3J7Y 1;  2HIV A;  4BA2 I;  1VQP A;  3T1H Q;  2K5H A;  1EIF A;  2JA5 H;  3GTL H;  4DR3 L;  4AI0 A;  3A74 A;  3BU2 A;  2NN6 G;  2PNH A;  1J6Q A;  4R4O A;  3F2C A;  4X62 Q;  1EQQ A;  4JI5 Q;  3OYY A;  1FL0 A;  1GM5 A;  1Z9F A;  3TEH B;  3KYV A;  1VQF A;  3PIP 1;  3CW2 C;  2UXC Q;  3TRE A;  3AQQ A;  2HHH Q;  1V9P A;  2D0P A;  4DV7 L;  1LM0 A;  5LMN W;  1PH6 A;  4DPG A;  2Z6K C;  1U0L A;  1YHB A;  2K5V A;  3KDF A;  2I5L X;  2UUC Q;  1DVB A;  2CKZ B;  3PF4 A;  1X6O A;  4DUZ Q;  4IPD A;  3U4Z A;  3CCU A;  2JA5 G;  1HZA A;  4JOI C;  2CWA A;  4NXN Q;  3GTJ H;  1RDV A;  2GVA A;  4X62 L;  3RN2 A;  2JA7 H;  1A63 A;  4WJ4 A;  1MKH A;  1D8L A;  5EIN C;  5LMU Q;  3QVD A;  1VQA A;  2UXC L;  4Y7N H;  2HHH L;  2VZA A;  1JJ2 A;  3RLO A;  1MJC A;  3JC6 2;  1JJG A;  2PVE A;  4AI1 A;  5E7N A;  4G6B A;  1N32 Q;  2UUC L;  1CSP A;  5LMN Q;  1S40 A;  4DUZ L;  2M4Y A;  2C6A A;  3MEF A;  2EQS A;  4NXN L;  1UE7 A;  3W1B A;  1G6P A;  4OWW B;  2XJP A;  5MF6 A;  1S3O A;  2JA7 G;  1KRS A;  3U50 C;  2YTY A;  2VQE Q;  1I50 H;  1Y14 B;  3I4N H;  2N49 A;  2A69 D;  1OTC A;  3P8B A;  1VQ5 A;  1SMW A;  2JE6 I;  1TWF H;  1WI5 A;  5GAH c;  4L5S A;  4NPS A;  5EIO C;  2VUM G;  2K2D A;  1N32 L;  1S24 A;  3LNL A;  5LMN L;  5JJK A;  1VCX A;  3J81 j;  3L2P A;  3I4O A;  4DR5 Q;  1Q8K A;  3KLW A;  3PV0 A;  2WAQ E;  4GLV B;  2ATW A;  5M5X H;  5IY0 A;  4GKK Q;  2VS1 A;  2JK8 A;  5GAE c;  4LF4 Q;  4DR1 Q;  1XNR L;  4P74 A;  2F4V L;  1X3G A;  2UXB Q;  2BA1 A;  2R6G A;  5AI3 A;  1OXU A;  4QL5 A;  2VQE L;  2ASB A;  3I4M H;  1VQK A;  3CXC A;  4LNQ A;  2LXK A;  3I4N G;  2ZTD A;  1T9Q A;  4JBW A;  4YCU A;  1HJP A;  4HID A;  2E2H H;  2XJU A;  3B0A B;  1SMX A;  4K0K Q;  4UY8 1;  1BE7 A;  4GKJ Q;  4DR5 L;  4LFC Q;  3GTP H;  4UP8 A;  2HIX A;  1RDG A;  2PQA B;  1Y1V H;  4A3J H;  3ULP A;  4GKK L;  3S2D H;  4X65 L;  3I56 A;  4DV6 Q;  4LF4 L;  4JI6 Q;  4DR1 L;  3KYX A;  1RYQ A;  2DGY A;  4IFD G;  4LF7 Q;  3I4M G;  2QGQ A;  4DV2 L;  2OQK A;  1Z92 B;  1NMF A;  1YI2 A;  5C4J H;  2UXD Q;  4O0A A;  3KFU A;  1WJJ A;  1RWD A;  1RYT A;  1PH7 A;  4GKJ L;  1PH3 A;  3M4P A;  1QYB A;  2R7D A;  6RXN A;  3OW2 A;  1VQ6 A;  1IZ6 A;  5IE8 A;  1EYG A;  2OQ0 A;  4MNO A;  2YV5 A;  4DV6 L;  4JI6 L;  5JVH 1;  1BBW A;  4QIW E;  1OXS C;  4UP9 A;  1PYS B;  4LF7 L;  3K7A H;  2XTI A;  4A3D H;  4DR7 Q;  4JI1 Q;  3LGJ A;  4TVM A;  1LKO A;  1LYL A;  3ULL A;  5C0X J;  1KXL A;  1GVP A;  1I94 Q;  2CKA A;  4OX9 Q;  1I6H H;  1YZ6 A;  2UXD L;  1BKB A;  3G6E A;  2N8N A;  1B13 A;  3W1G A;  1X9N A;  3CF5 A;  2AKW B;  4DV5 Q;  1Q82 C;  5JJI A;  1EOV A;  1Q7Y C;  1Z47 A;  2UUA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...