4POFA

Pfmcm n-terminal domain without dna
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
255
Chain Sequence
SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved MCM single-stranded DNA binding element is essential for replication initiation.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication, dna binding protein
molecule keywords Cell division control protein 21
total genus 60
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4pofA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4pofA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 4pofA01
4GS3A 4HJAA 2QEXA 3K80C 3BU2A 1ASYA 1B70B 5IWAQ 4UP9A 4QIWE 4NXNL 1IBML 4DPGA 4LF9Q 2RCNA 3KYUA 1V1QA 1FL0A 1UE7A 3K0XA 2JA6H 1X6OA 1YVCA 3CXCA 1N33L 1XMOQ 4GLXA 2A8VA 1S24A 3HOZH 1KQSA 4BXXH 1PVOA 4LF4Q 5BR8L 2A1AA 1XMQL 1S3OA 4BBSG 3H3VI 1UEBA 1Y1WH 4A3GH 1LKOA 3I7FA 4GLVB 2K5VA 4BA2I 2JE6I 1R0JA 4KLKA 1BQ9A 4DV6Q 3UDGA 3OYYA 2HR5A 4LF5Q 1RIPA 3EN2A 2AKWB 4DR6L 1AH9A 1P8LA 1C9OA 3J81j 3CMEA 1A8VA 2BA0A 2JEAI 1HZBA 4XTCS 4ALPA 1XTDA 2F3IA 3RZ6A 1YHAA 4OO1G 1DX8A 4JI3L 1YK4A 2OWOA 1O7IA 4DV3Q 4A3CG 3W5OA 3KDFA 3PCOB 3AQQA 4P74A 1N34L 1B13A 4C3HH 1Z9FA 2YU9H 1PH4A 1YBYA 3A74A 1GO3E 4HIDA 1CKNB 1IBKQ 3S14H 1T9OA 1I3QH 4LNQA 4BBRH 2CWAA 1GVPA 4A3DG 3CCQA 2KENA 4JBJA 4DR7Q 1IZ6A 2WAQG 3GO5A 1YJNA 4LF5L 1NMGA 3S1RH 1KAWA 4DV6L 3IRBA 2E5LQ 1PH9A 4BBSH 3CCLA 4OWTB 2YTYA 1HNZQ 4IJHA 5C44G 1X65A 1KRTA 2QA4A 4A3LH 5FJ8H 4JI1Q 4X64Q 5LMNW 1N32L 4O2DA 2F4VQ 1CKOA 2KHJA 2K52A 5IE8A 1K73C 4JC0A 1E8JA 1T9HA 5IWAL 4JI4L 4LF9L 3BZCA 4A93G 3CC2A 2VNUD 1K3RA 2PQAA 4BY7G 4UP8A 4A3KG 1K0RA 1R0FA 1X9NA 5JJLA 3PUWA 4YY3Q 1RDVA 3FP9A 1QVFA 1BFYA 1UWVA 2PNHA 2JA8G 3K81C 3EBEA 3HOVH 3JC63 5EAYA 4P72A 4DV7Q 1E22A 3HKSA 1XPOA 4MZ9A 4GKKL 4J15A 2OTJA 2KHIA 3U50C 1DVBA 4NXNQ 2UXDL 2MQHA 3GTKH 2PQAB 3F8TA 1QCVA 5LMUL 3I55A 1XNRQ 2IX0A 4YY3L 3PWFA 1L1OB 1NE3A 4PZ6A 4NB3A 2E8GA 4HJ9A 4LFBQ 1QUQB 3PO2G 1BRFA 4QL5A 3KFUA 4HJ7A 3KJPA 2YV5A 1GD7A 3E9IA 1EIYB 3HOWH 1FJGL 5J3BA 2F4VL 5AI2A 2Y0SG 4JI1L 1N32Q 1A0IA 3L2PA 3CC7A 1PH1A 1YHQA 1VQKA 2I0QA 2UUAL 4IPHA 4P73A 1X3FA 1KL9A 1Q1BA 1QVGA 1E3PA 1IXRA 1HH2P 3T1YQ 1S40A 1EFWA 1EQQA 4YCUA 4OONA 5GQOA 1JYBA 4AR6A 1NJIC 1HR0Q 4B3SL 4X6AH 1MIUA 5AI3A 1LTLA 4X62Q 3PIOA 1FGUA 2R93G 1J6QA 4B3ML 4DR7L 1IL2A 3F1ZA 3RNUA 5IYBG 1A62A 3ERSX 2NVXH 1KD1C 2UXBQ 3KDFB 4OWWB 2Z6KC 4X64L 1EIFA 5M5XH 1R0IA 2LSSA 2DSXA 3G48A 3CCEA 4HIOA 2OTLA 5JJIA 3PZAA 1IYJB 2AHOB 3I56A 4BXXG 4K0KQ 2JA6G 3RLNA 2I5MX 4A3JG 4FDBA 1QVCA 4JI8Q 4B3TL 3CD6A 4O0AA 4A3GG 1QZGA 4JOIA 3F2CA 1VQLA 3M7NA 5LMNQ 1YUXA 3CCJA 2YYZA 2MO0A 2KKDA 5M3MG 4A3JH 2UUCQ 4A3FG 4YHHQ 3HFZB 3CCSA 1SN8A 2RF4A 2ZJQA 4R4OA 2LXKA 3RYGA 3RR5A 2R93H 3LGJA 5LMNL 4KI0A 1TWHH 3AFPA 4TQUS 4AIMA 1N34Q 4WJ4A 1X3EA 4HIKA 3RZDH 1OXXK 1OXVA 1SMXA 4IPGA 1K83H 4NXMQ 3PIPA 5IP9H 3H0GG 4DV4Q 3W1GA 4LF7Q 5C4XG 7RXNA 5IYCH 1WYDA 1VQ5A 2UXBL 4RXNA 3KF6B 4A3BH 1YEZA 3F2DA 3STBC 1HZAA 5IP9G 4GOPB 3KYXA 1U5KA 3ER0A 4GKJQ 4A3MG 1L2FA 4R4TA 5FLMH 1FJGQ 4TPUA 3WWVA 1N36Q 3HOXG 1BQ8A 2MS3A 2ES2A 4LUVA 4L5SA 4LF4L 2WAQE 4R1JA 1VQ8A 3PUZA 4LUZA 3MXNB 3L7ZC 3T1HQ 4B3SQ 5FLMG 1N33Q 3GTGH 2UXDQ 1RL2A 4OO1I 3B6YA 3GD7A 4KHPQ 2K5NA 1NMFA 2RHSB 1X55A 4X65Q 4B3MQ 1D8LA 2HIXA 3HOUH 2ID0A 1WOCA 3PGZA 1QZHA 4LFBL 1G291 1IBMQ 4QY7A 4EQ5A 4APVA 3CMAA 1VQIA 5C3EH 3PF4A 1J5EL 4DR1L 1RB9A 3QVDA 3CCUA 1Y1VG 3I4OA 2RHQB 4AYBE 3OW2A 4DR3L 1VQCA 3FKIG 1JJGA 2PYAA 1DGSA 3E9HA 5IYBH 4JI7L 2VY3A 3OTOQ 1L0WA 4JBWA 4DV0Q 3HOYG 4JOIC 4JI6Q 1Y1VH 2CCZA 4LWCA 5JJKA 1LKPA 1GKHA 1Y14B 2D0PA 4PZ8A 1I94Q 2V1CC 2VUMG 4R4CA 4LF6L 1PH2A 2I5LX 2JQOA 1JJCB 2JEBI 2GMGA 1BKBA 3KF8B 3PF5A 2PVEA 1QUQA 1VCIA 3G4SA 2BH8A 4BBRG 1LM0A 2R7FA 1Q82C 5M5YH 2E2HH 4LF7L 2HHHQ 4OX9L 1VQOA 4JI0L 4MTNA 4X65L 1JT8A 1QYBA 8RXNA 3PO2H 1YUZA 4TVAB 3I2ZA 3F2BA 5GROA 4BY7H 1BE7A 4DV5Q 4A3BG 1I5FA 4UY8C 2Q2IA 2YTVA 4LW1A 1A63A 2C35B 1RYTA 5C0XG 3CQZH 4JI5Q 5C4XH 1BBWA 3D31A 2NVTH 2ZTCA 4B3RL 3JAMc 1HNXL 3A0JA 1SR3A 3PUYA 5C0XI 1VQGA 3J81i 1YNXA 5GADC 1IU5A 5IYCG 3M4OH 1U0LA 1B2OA 1E1OA 3H0GH 1Q7YC 1XNQQ 5IYDG 3DM3A 4JI5L 1WFQA 4K0KL 2K14A 2WB1E 3NENA 2AWNA 3RN2A 4A3FH 1HNXQ 4JI8L 3ULJA 4B3TQ 1FVIA 3GTLH 2R7ZG 1XMQQ 1Y1WG 2K5HA 1WCMH 1IBLL 5M5WH 4QGUA 4GOPC 3M4QA 4POGA 4JI0Q 2HHHL 4OX9Q 5C3EG 6RXNA 1KXLA 1SMUA 2D0OA 2OQ0A 1NBWA 2JJQA 3G6EA 1S30A 2K75A 2NZOA 3UE1A 2DGYA 2Z0SA 5IP7G 3SS2A 1EUJA 4YCWA 2KCMA 3CC4A 3NELA 2XTIA 2ZM6L 1YI2A 3HOZG 2UU9Q 1GM5A 1UE5A 1Z47A 2CKZB 1CKNA 5GAGC 1VQ7A 2ALYB 4L5TA 3KJOA 3S17H 2E2JH 2PI2E 1WJJA 1SFOH 1UE1A 4DK6C 3T1YL 4DR2L 1JMCA 3MEFA 3MPSA 5GAHC 4LF6Q 1CKMA 3I4MH 4KHPL 1R9TH 2VQFQ 3PSIA 3CPWA 1XPUA 1R0GA 4JYAL 1ASZA 1B8AA 4LFCL 1CSPA 3KYVA 2F52A 1R0HA 2Y0SE 4IO9A 4A3IG 1XPRA 3S1NH 4DR3Q 1Q46A 3ICEA 1VQNA 3S15H 1XJVA 2PVXA 4IPCA 4YWMA 3STBD 1B71A 4JI6L 4OWXB 4DR4Q 4GKKQ 4LFCQ 4JYAQ 1E24A 2IT1A 1X56A 2FXQA 3J80i 3S2DH 2UUAQ 4PMWA 3PUXA 5M3FG 4RMFA 2N8NA 1CUKA 2VS1A 3M9BA 4LF8L 3K7UC 1B7YB 4JI2Q 2VW9A 1FHMA 4DR4L 1VQBA 2JK8A 4HJ8A 2UU9L 3TS0A 1YZ6A 3UDFA 5ELOA 1D7QA 1T9QA 1UE6A 1IU6A 1VQJA 5IP7H 1OXTA 3KYHC 4DUZL 1LUZA 4DK3C 4H02A 4DV2L 3ULPA 4X66Q 3DLLA 1YHBA 1RWDA 2JA5G 4UPAA 3M4PA 3PUVA 1FHHA 1VQMA 2ZJPA 3M3YH 1WCMG 3UDIA 1MJEA 3H3VH 3TEHB 1V9PA 1S72A 3U58A 1I6HH 5C4JH 3A5ZB 1WI5A 2D62A 3SGIA 1YIJA 1HNWQ 3TREA 2IY5B 1K8AC 1M90C 1N9WA 5JEAG 1CADA 1K9MC 5FJ8G 4A3LG 4A3KH 3J7ZC 2ATWA 1HZ9A 1V43A 3K7AH 2MNAA 3BZKA 4GKJL 1IBKL 4A93H 3U4ZA 2IX1A 4YHHL 2K50A 1VQPA 3HKZG 3TQYA 1X3GA 2K4KA 2MFIA 1VQ4A 3Q8DA 4NXML 4IFDJ 3L0OA 1CSQA 2CFMA 5HGQA 4P75A 4AYBG 3RN5A 1TWCH 3CW2C 4A4IA 3AEVA 1W3SA 2NN6I 3HOUG 4L5RC 3A5UA 1YK5A 3AFQA 4IOAA 3ZJYC 1TXYA 4LFAQ 1KIXA 5IYDH 2B29A 1MKHA 1VS0A 2NN6G 4QJFA 5HY6A 2VQEQ 2WP8J 4C3IH 5IT9c 1HR0W 1XNQL 3J7A5 2IHFA 3RZTA 3NEMA 1LYLA 4L5QA 4BY1G 4DR6Q 4A3CH 2ZTEA 4JCVE 2PI2A 4DNIA 3S16H 3W1BA 2ZJRA 2EIFA 1VQHA 2PMZE 3UDXA 3GTMH 2K2DA 3RZOH 3M85A 1OTCA 3I4MG 4GN4B 1BVSA 4BY1H 3H15A 1VQAA 2UUBQ 1SE8A 1AE2A 2NZHA 1YV1A 1AE3A 2WB1G 4R4IA 4JBKA 1Q1EA 3HOWG 4DV3L 4A3EH 1I94L 3CPFA 1SLJA 2VL6A 2HIVA 2Z6KA 4DUZQ 3CCMA 4R4QA 4DUYQ 4IFDG 2KN9A 4JG2A 4X66L 1PV4A 4AQYQ 3CF5A 1IROA 3ULLA 1G51A 3AYHB 4GNXC 1W2BA 1TWFH 4IFDI 1E1TA 1BBUA 3KLWA 4MNOA 4GN3B 3I4NG 2UXCL 5RXNA 4YWLA 5ELNA 1XNRL 2H5XA 5C44H 2JA7H 2BA1A 4QQBX 1CAAA 1PFSA 4LF8Q 2XGTA 2VUMH 2GVBA 4NPSA 4UP7A 3EIVA 5E7NA 3PV0A 3OTOL 4DV0L 4GNXB 3KYWA 4AQYL 4JI2L 4JI7Q 3HOYH 2VQFL 3D0FA 4YWKA 3JC66 2N78A 2E2IH 3RLFA 5FLXc 3S2HH 2R7DA 1Q86C 2NVYH 1B2JA 4IPDA 2NVQH 1S2ZA 1TWAH 2UXCQ 2CWPA 4DAMA 2ASBA 1T9PA 1P16A 1PHJA 3GTPH 4GLAC 3NBHB 1J5EQ 4A3MH 3PO3G 3HKZE 5LMUQ 3GDEA 4DR5Q 1N36L 2BH2A 4IJLA 3BJUA 2YTXA 1E7ZA 2N49A 1G6PA 1VQEA 1L1OA 2CQOA 4DR2Q 2V3BB 1VCXA 1H95A 1N8RC 1EOVA 4RG1A 1RDGA 4PZ7A 2VQEL 2B3GA 2GVAA 4DUYL 4DV7L 3T1HL 2Q2TA 1SRUA 4LFAL 3GTOH 3A44A 1ZRPA 3PO3H 4Y52H 1PA6A 4LUOA 2KCTA 1IRNA 4DV4L 2HT1A 1HNZL 5K36G 5M3FH 2E5LL 2M4YA 1VQDA 3HOXH 1JB7A 1OXSC 2UUBL 4K9FA 2KBNA 1VQ9A 3JC62 3GTQH 2LCQA 1PYSB 4JI4Q 4XIGS 1KC8C 4AR5A 3JAMi 3GTJH 2QL0A 1HZCA 1M1KC 4AH6A 3J81c 4C3JH 1X54A 4YCVA 3E0EA 4JV5L 1SMMA 4KHZA 3TRZA 4A3IH 3G71A 2I5HA 5C0XJ 4PG3A 1IBLQ 5GAEC 2A19A 1NY4A 2WFWA 1PH7A 2OQKA 1JE5A 2R92H 3CCVA 1MJCA 1K8GA 1LKMA 4DV5L 4HIMA 3FKIH 3S24A 1YITA 2B63G 4A76A 2VZAA 4JI3Q 4DV1Q 1PH3A 2R7ZH 4B3RQ 3U4VA 2HQLA 4ME3A 2GN5A 4AR3A 2DUDA 3KOJA 4DV2Q 3VDYA 4AR4A 2B63H 1PH8A 2R92G 2MO1A 5M3MH 1Q81C 2EXDA 4A3EG 2AMCB 2OCEA 4X62L 4Y7NH 3CAMA 2UUCL 2RDVA 4JBMA 4DV1L 3FHWA 1KHIA 2LXJA 1EQRA 1SMWA 4DAYB 2JA5H 2JA7G 1HNWL 3S1QH 2L15A 3TS2A 4EX5A 1Q12A 3I4NH 1OXUA 4GNXA 2N3SA 1VQ6A 2Q2UA 4GN5A 4P71A 3K8AA 4JV5Q 5H1SE 5BR8Q 2JA9A 1NNQA 5JEAJ 2EQSA 4A75A 1XMOL 1EWIA 4C2MH 2R6GA 2Q2HA 4A3DH 1H7VA 1TWGH 1JJ2A 1HR0L 3S1MH 4OXPA 3UE0A 4DKAC 1KRSA 4HJ5A 4DR1Q 1PH6A 1YJWA 2QGQA 3KYYA 2IHEA 5AJ3Q 1Q8KA 3RLOA 3CP0A 1HJPA 1EYGA 1SROA 1C09A 1I50H 4IOCA 4WJ3M 1VQFA 3J80c 1PYBA 1L1OC 1NTGA 3CCRA 5IY0A 4BA1I 4POFA 5AJ3L 4GOPA 4DR5L 2JA8H 2AWOA 2ZTDA 1PH5A 5DLQE 1YJ9A 1C7YA 3HOVG 1C0AA 2ZM6Q 3KF6A
chains in the Genus database with same CATH superfamily
3H97A 3K80C 1ASYA 4UP9A 1F9SA 4LF9Q 3S1NL 4K5WA 1CK1A 4O1NA 3CXCA 4BXXH 1EYAA 1D5MC 1GUOA 1KQSA 3HOZH 2A1AA 1JQYD 3K57A 1XMQL 3H3VI 1UEBA 5CORA 4NKLA 2Q8RE 1S5ED 5JAVA 4DV6Q 4FXKC 1PZID 3UDGA 1GXDC 1RIPA 3EN2A 5IYBL 2JYOA 4DR6L 1AH9A 1C9OA 3QIAA 4NP5A 2Z6BA 1XTDA 2F3IA 3RZ6A 3GTJL 3PIP1 2VB3X 4A3CG 5MFPA 3VPBE 2HCIA 4OL7A 1HFGA 4R8IA 2YU9H 3QOJA 2L0ZA 2L11A 3A74A 3VA7A 5CBAE 4HIDA 4EQPA 3S14H 4BBRH 1GVPA 4A3DG 4JPBW 2ENBA 4DR7Q 4X3SA 3X3NA 2WAQG 5IGBA 2R93L 2D9UA 1PH9A 4K5XA 1BQQT 3MWYW 1OWCA 2QA4A 2LY7A 5FJ8H 5IODA 4DFAA 4KD3A 2K52A 4U671 1E8JA 2KECA 5IWAL 3BZCA 4HSVA 1A2UA 5M5YL 2PQAA 3VR6A 2RDGA 5FK9C 1PZJD 1CHPD 1K0RA 3PO2B 1RD9D 4V0BA 4E6YA 2PNHA 5EAYA 3GTML 5M3FB 3HKSA 2EYMA 2K03A 3DWAA 4GKKL 3CQZB 4J15A 5M5XL 2YU9L 2B2WC 3U50C 2G5DA 3F8TA 3HOZB 3OMGA 5LMUL 3P1HA 1QCBD 1S5CD 1NE3A 1ENCA 4NB3A 3VYSA 3PO2G 4H13C 4JW0A 1I4HA 3KJPA 3HOWH 1PYWD 2UUAL 1HRJA 4A3EB 4P73A 5L37A 1X3FA 1Q1BA 1PRTB 3K0YA 1JYBA 4AR6A 4CDFC 3H9CA 1ESFA 5AI3A 4ULLA 4X62Q 4Z9CB 4IUVA 1SYDA 1WTQA 1QB5D 4ZAIA 2O5IC 1B50A 5E4XA 1DZ1A 4RFBA 4OWWB 2Z6KC 5ISRA 2XJQA 2LKVA 5JJIA 3PZAA 2AHOB 4BXXG 4K0KQ 5EPLA 2OXPA 4FDBA 2K32A 1F77A 3GTKB 5C4HA 3MVVA 3M7NA 2BCOA 3BYTB 2UUCQ 5LL6S 1VZHA 4A3JH 5CV6A 1JOQA 3D8GA 4A3MB 1X3QA 1JWMD 3RR5A 2F0DA 3PO3L 1N34Q 3RZDH 1SE4A 4QCLA 1SMXA 5M9OA 3KLSA 5IP9H 3H0GG 1VMPA 3W1GA 5C4XG 2WAQP 1WYDA 3KF6B 3F2DA 4GOPB 1PLFA 4A3MG 4R4TA 3LPEB 2F0QA 1KABA 4DN4M 2ES2A 2PPTA 5CV8A 4R1JA 1A15A 1CZGA 4LUZA 3MXNB 4ODGA 4B3SQ 1N33Q 3TN2A 2FMMA 3GD7A 3VR2A 1XTCD 2RHSB 3QO2A 4X65Q 4B3MQ 3HOUH 5CBEE 2PW5A 3N6RA 2FHTA 2JN4A 4K6LA 4CJ1B 1S5FD 1QZHA 3P20A 3S15L 1PFYA 3RZOL 4WFN3 3PF4A 1W6KA 4N9PA 3X3MA 1RB9A 4LJZC 1IHZA 3CCUA 4DU9A 3I4OA 3Q0AA 3OW2A 4DA2A 3HS0C 4C2MB 3E9HA 4DV0Q 3NE5B 4CJ0B 5JJKA 1LKPA 1GKHA 2D0PA 2VUMG 4DGZA 3HGBA 5FO8B 3T56B 2F0JA 1GHJA 1SYEA 3IFTA 3OOCA 4A3DB 1Q82C 1LM0A 2HUGA 2X6LA 2HHHQ 1ODHA 5DAUA 1QYBA 8RXNA 5ELBA 4TVAB 3OSOA 4BY7H 3R3OA 2SNSA 4DV5Q 1I6HL 3PO2L 3D31A 2NVTH 2B2YA 2Z3QB 2Q8TA 1VQGA 1I4QA 2RVLA 1YNXA 1EY9A 1B9NA 3DWPA 3HJYB 5IYCG 3LWPB 3JR7A 4LK1C 1MSHA 2K14A 3GTQL 2ZT9C 3RN2A 4A3FH 4JI8L 1LTSD 1SDFA 2R7ZG 1XMQQ 2K5HA 1IBLL 2XRSD 3J7AF 4JI0Q 3OIPA 4OX9Q 1SMUA 4F8MA 2MUYA 1S30A 3UE1A 3HOUB 4JAFA 3V2TA 3OW7A 1STYA 2B63L 2MGSA 1R4PB 2WIIB 3URYA 4C3JG 2XTIA 2R7ZL 1YI2A 1GM5A 3GTGL 2AQ1B 4BBRL 2P5ZX 4L5TA 3KJOA 3NQTA 2PI2E 1SFOH 2E2JH 1UE1A 2F0WA 5J22A 2R61A 1F2LA 4LF6Q 5GAHC 2BOSA 5C4JL 1EY6A 5K36H 1A3TA 2EYHA 1BCPB 1ASZA 1B8AA 1CSPA 4IO9A 3K7AL 4G6BA 1VQNA 3S15H 1J8IA 4KY7A 2PVXA 3GTLL 3NK9A 1B3AA 2L9HA 3STBD 1B71A 4DR4Q 4RKLA 2DY8A 2UUAQ 2F0GA 4PMWA 3PUXA 1HA5A 3M9BA 2M4VA 5CV4A 2WAQB 2VW9A 1FHMA 3NHHA 1HUNA 2O4XA 1I4RA 2JK8A 1YZ6A 2OEOA 3HAXC 2Z4HA 4FP5D 4OIJA 1RKNA 1VQJA 5IP7H 5A2QL 1OXTA 3KYHC 4DUZL 1EYDA 1LUZA 4DV2L 2PNRC 1FNVA 1RCVD 5G3LF 1YHBA 3A7AB 2NB0A 2A69D 1WCMG 3UDIA 3H3VH 1KLUD 3U58A 3I70A 5C4JH 2D62A 1TWHL 1EIGA 1HNWQ 2IY5B 1N9WA 3I72A 2N88A 1V43A 2NTTA 3K7AH 1DM0B 2NVTL 2K50A 3HKZG 3TBIB 3C46A 1I4GA 1X3GA 3MHBA 1HQRD 2HVYC 2CFMA 4A3DL 3N52A 3RN5A 3HOUG 1AP0A 3HOXB 2EOTA 3A5UA 3AFQA 1YK5A 2XJRA 1TXYA 1KIXA 5IYDH 4WORA 4KN7C 5HY6A 3J7A5 2A5HA 2I46A 4IZ8A 4JCVE 4DNIA 3S16H 3NPPA 2R92B 2Z4IA 3M85A 3H15A 1AE2A 4R4IA 4JBKA 1EL0A 2DN8A 4DV3L 2NYDA 3GTOB 3LWQB 1JORA 2XJSA 2TMPA 4K8JA 1PV4A 3ULLA 4MNOA 1V1PA 2OF1A 5RXNA 4YWLA 3S1RL 4K2LA 2BA1A 2EDGA 3RZDL 1TS4A 3TMEA 4DV0L 5E7NA 3EIVA 3PV0A 4GNXB 4JI2L 3G6JB 2EJFC 2EZVA 2FFKB 3JC66 3QWNA 2N78A 1NSNS 5JEAH 4KKUA 5C3XA 4A3FB 5FLXc 3HOVL 4XXBB 3LX0A 1B2JA 3BS1A 1TWAH 5KGUA 1QG7A 4DAMA 2KOLA 2MP1A 3BVMA 1R4QB 1I3QL 1BO0A 1I50B 3BJUA 2N49A 4BY1B 5TSSA 4DR2Q 1MSGA 2NZ1D 4BBSB 4CDDC 1RDGA 2F0FA 2GVAA 4DV7L 4BXXL 1FR3A 4Y52H 1ZRPA 1GUGA 2HT1A 1IRNA 2PPBC 4LHLA 4X3TA 1VQDA 4ZN1B 2NN6H 1CM9A 3TP6A 5D3IB 4C56C 1VQ9A 2KVMA 2LCQA 3HOVB 2RQXA 4AH6A 1X54A 3IL8A 1SMMA 4KHZA 1MHWC 4PG3A 1IBLQ 2A19A 5M5WL 2OQKA 1JE5A 1TVXA 4A3KB 3FKIH 1SE3A 3ZG6A 4UAIA 3D6WA 1O7ZA 3KF8A 1HTLD 3U4VA 2HQLA 2DUDA 3VDYA 3K5OA 3CAMA 2RDVA 4DV1L 3PIP3 2JA5H 1Q3LA 3S1QH 1GUTA 3I4NH 1OXUA 3JAME 1JOKA 2ICEC 5H1SE 5BR8Q 1STEA 2K33A 1XMOL 1KDAA 1PRTC 1JJ2A 4N9TA 4M1UB 1KRSA 2XJTA 4ZUIA 5E1FA 4JAEA 3HP3A 2GA4B 1YJWA 1U4RA 5AJ3Q 1B1ZA 1MGSA 1Q8KA 1TS5A 1HJPA 4TSSA 5M3MB 1I50H 3OWEB 2BE5D 1H9MA 2X69A 5CC4A 3AMUA 4POFA 3NP8A 4EQOA 1Y8OB 2JA8H 1SE2A 2AWOA 3SK4A 1C0AA 1PZKD 2SDFA 2QEXA 1B70B 2IL8A 4QIWE 3OMCA 4V196 4ID6A 1LTTD 2X6GA 2JA6H 1X6OA 3K5MA 3Q24A 1XMOQ 4GLXA 2A8VA 4FF2A 2M00A 4LF4Q 2NVYB 1NAPA 1Y1WH 1LKOA 3I7FA 4GLVB 4CBVA 2K5VA 2JE6I 1R0JA 4RH6A 1O78A 2A73B 1EFID 2LFNA 3J81j 2NTSA 4S3SA 3P7JA 2JEAI 3IKJA 3A8KE 3QR8A 4ALPA 4H7BA 1GUSA 3S2HL 4OO1G 4JI3L 2OWOA 1O7IA 3W5OA 3KDFA 1JE4A 5MFZA 3A56A 4P74A 4C3HH 1N34L 3LWEA 1B9MA 1KDCA 3MEHA 2XSCA 3FRPB 4XXEA 4JVZA 2NVYL 3GTJB 3P8BA 4PNYA 1CFMA 1T9OA 4XT3B 2CWAA 3CU7A 2KENA 3FMCA 3I91A 2J7ZA 5BN3A 3GO5A 4LF5L 1G2TA 1K3BC 4QMGA 4DV6L 3IRBA 4BBSH 5CV5A 3CCLA 3AB9A 3I3CA 1HNZQ 4IJHA 1X65A 1KRTA 4A3LH 4X64Q 4JI1Q 5LMNW 1N32L 1AFPA 4O2DA 2F4VQ 4JI4L 5IE8A 2IW3A 5EBDA 1V8QA 4LF9L 1FJGQ 4KKTA 1JWSD 2VNUD 3CC2A 3HOYL 4CKCA 1STHA 2APOB 4ZYSA 2J4XA 4IFDH 1X9NA 4YY3Q 1RDVA 3LNNA 1UWVA 3FDTA 3EBEA 3JC63 1MI2A 2E2IL 3F2UA 4DV7Q 2OTJA 2WB1P 2KHIA 1GUWA 1DVBA 4QUFA 2MQHA 3GTKH 2XJPA 1TWGB 2H4OA 2IX0A 4YY3L 5M5WB 2AQCA 4BBRB 1EU3A 4MN3A 4PZ6A 2E8GA 1ENFA 2K7VA 4KN4C 1BCPC 1BRFA 1NXEA 5FLXL 2IWHA 1FJGL 5J3BA 2F4VL 5AI2A 1STBA 1A0IA 1PH1A 2ICIA 1KL9A 1E3PA 5JVG3 1EQQA 1SAPA 5GQOA 4UY81 2PSMC 4FO2A 4XT1B 4A3IL 2M9VA 2QILA 5CV9A 1A62A 2NVXH 1QNUA 3MXPA 1KD1C 4C3IB 3SEBA 1B3QA 4X64L 3VR5A 4HSPA 5M5XH 2LSSA 5FOBB 3VYRA 3W3AA 2OTLA 2RFKB 5EKIA 2MHVA 3H99A 4JI8Q 2M2LA 4F87A 4F7XA 3TP7A 4A3GG 4HEDA 4JOIA 1NR4A 3F2CA 2F0EA 3CCJA 1TR5A 2YYZA 2MO0A 2KKDA 4A3FG 4YHHQ 4ZLTF 5A35A 3CCSA 2BE5C 2PCFB 1SJHD 2CR8A 1K28A 4R9WA 5LMNL 3D4DA 4TVMA 1F2ZA 4KI0A 4TQUS 5CV7A 4WJ4A 1X3EA 3MXGA 4HIKA 2VUML 2KEDA 4FXGC 1K83H 4NXMQ 3DXJC 4DV4Q 5IYCH 1JC7A 3KK7A 3U9SA 2F1MA 1YEZA 4A3BH 1SYCA 5IIFA 4HN7A 1HZAA 4GKJQ 1L2FA 2F0LA 2XIWA 5FLMH 1N36Q 5T1GA 3J7Z1 1BQ8A 4KTAA 4L5SA 4LF4L 2WINB 5NUCA 3S15B 3PUZA 3GTGH 3TSSA 3VR4A 1U4MA 2UXDQ 5FLMG 4N8X1 3MZ5A 1NMFA 2XJUA 2HIXA 3BDCA 2B2YC 2ID0A 2EXZA 1WOCA 2G9HD 3S17L 3GTPL 5EKLA 5I6WA 5KNDA 4QUCA 4XYOA 1G291 1EZ8A 3CHBD 3MTSA 5C3EH 3HEJA 4ZRZA 3H9BA 4A3JL 4AYBE 3H0GB 3H6MA 3K35A 1H9KA 1VQCA 4RGNA 4DR3L 1DGSA 1ET9A 1E0BA 4JI7L 4K5VA 1L0WA 2QKIC 4JI6Q 2CCZA 2V4DA 4LWCA 4A93L 4PZ8A 4R4CA 1S5DD 4AI3A 2JQOA 2JEBI 2GMGA 1HPCA 3G4SA 4DK0A 3NSWA 2R7FA 2E2HH 1TWFB 1VZIA 1TT2A 3ZYYX 4GS7D 2N55A 4MTNA 2EPBA 4BY1L 3V96A 3F2BA 1CA6A 4A3BG 1I5FA 3NXWA 2Q2IA 1A63A 5C0XG 1BBWA 1U9RA 2CW0D 2PW7A 1BCPF 4RA8A 2O5JC 3JAMc 5C3EL 1PRTD 5C0XI 5I6YA 3PIO1 4M8AA 1IU5A 4A3GB 1U0LA 1TWCL 3KLRA 1EEFD 5IYDG 4K0KL 1IKMA 1QE6A 3NENA 1PTOC 4HAEA 5FO7B 4IALA 2PQEA 1STGA 3T53B 1SXTA 4POGA 1ENAA 1EWHA 3NBHA 2D0OA 2K75A 2NZOA 4BY7B 4AYBB 5KYLA 2Z0SA 2NWGA 3CC4A 1SEBD 3NELA 1XX8A 1Z47A 2CKZB 4B8CD 5GAGC 3TZUA 2ALYB 5ELDA 2ZIXA 3S17H 1WJJA 2XWBB 4DK6C 2J9UB 4DR2L 3MPSA 1KTKA 3HOWL 1CKMA 2KA7A 5J1ZA 3I4MH 1TQOA 1NXGA 3HJWB 5K2ME 1XPUA 3D3RA 5BN5A 1WTHA 5M3FL 3GTMB 4LFCL 1EQVA 2F52A 2Y0SE 3VYUA 5C4ZA 4A3IG 4K6DA 4DR3Q 4ME5A 3ICEA 4OIKA 5IGCA 3GQBA 5FO9B 3MAQA 4JI6L 4JYAQ 4PMBA 1Y1VL 4RMFA 1B7YB 4JI2Q 5KRUA 1VQBA 3K58A 3NWSA 3T13A 2VUMB 2R93B 2XVSA 1TWHB 4A3BB 1PFVA 1F4LA 4H02A 3ULPA 5D65A 1G2SA 1RWDA 1B53A 2JA5G 2DNEA 5I9OA 3PUVA 1VQMA 2JI3A 2KHSA 4A3IB 1VMCA 1V9PA 2HDLA 2L0CA 1S72A 1MJEA 3SGIA 4Y52L 1ML0D 4RKBA 3I4LA 3PMFA 5EPKA 1RTOA 2EJMA 4A3LG 1P7PA 4ZKBB 3J7ZC 4FXDA 2NUCA 3WOEA 5LHY1 4GKJL 1V1OA 1DYQA 3BZKA 2TSSA 4YHHL 2A74C 3LWUA 1VQPA 3H0GL 4IQZA 3ONAB 5C44B 1AZQA 3D4RA 4B08A 4NXML 1XYIA 4KKSA 4AYBG 2LS01 1TWCH 3CW2C 2FJ2A 4A4IA 3J7AV 3ND8A 4FYDA 4TKOB 1OO9B 2B29A 1MKHA 2VQEQ 4KHPL 4QJFA 5JPMC 1HR0W 1XNQL 5G3LD 2NVXL 3RZTA 2XN9C 1A6XA 4DR6Q 4XGHA 1BCPD 5C4JB 1SYBA 2B2UA 2PMZE 3UDXA 2K2DA 3RZOH 1OTCA 1BVSA 1WVLA 1SE8A 5M5YB 1AE3A 5C4XL 4CDEC 1Q1EA 4EVOA 4RGMA 3HOUL 1I94L 2XWJB 2B63B 4DUZQ 3CCMA 2L4NA 3A55A 2KN9A 4X66L 1Y69U 3CF5A 3AYHB 3GV6A 4IFDI 4PMCA 3I4NG 4GN3B 1YNNC 2UXCL 1XNRL 5ELNA 1QNKA 2EJGC 2JA7H 2DY7A 1CAAA 1PFSA 3FVQA 2VUMH 4C3JB 2GVBA 2EYJA 4NPSA 3H3VM 4AQYL 1RDPD 3PIO3 4YWKA 2Z1CA 3A8JE 3C1EA 4DXFA 3S2HH 2R7DA 2NVYH 2EY4E 1RJTA 4RHSA 3R93A 1Y1WB 2F0IA 2UXCQ 1DD2A 3SDZA 3GTPH 1SMYD 2L5TA 3NBHB 5LMUQ 3GDEA 3RMHA 2BH2A 5HURA 2ERSA 5DNFA 4A3ML 1H95A 1N8RC 1EOVA 4PZ7A 4LFAL 1K8MA 1PA6A 1ILPA 1HNZL 5K36G 1EY8A 4NMZA 1JB7A 1OXSC 4JI4Q 4XIGS 5E4WC 3OPOA 3J81c 5MLC3 3E0EA 2B2TA 4HMIA 5DM73 1IW7C 5C0XJ 1PTOF 1PH7A 2IPKD 3RZOB 3CCVA 1LKMA 2F0PA 1TKWB 2NBFA 3KOJA 4ME3A 2B63H 4IURA 4AR4A 1HA6A 1PH8A 2RA4A 5M3MH 1Q81C 4A3EG 4JBMA 2AMCB 4X62L 3Q23A 1EOTA 3FHWA 5KYIA 1PFMA 2LXJA 2H12A 3LWOB 4DAYB 2JA7G 1F9PA 2L15A 4HTHA 4ABNA 1GJXA 3MSUA 4GNXA 2N3SA 1QOHA 1LV9A 1QJOA 3M3YB 2JP1A 4KJOA 1NNQA 3TDQA 1HCZA 1YNJC 5JEAJ 1EWIA 4C2MH 1UAPA 1HR0L 3S1MH 3UE0A 5DM63 1B44D 2QGQA 4KD4A 3FKIL 1EEID 4DXGA 1PFNA 3CP0A 5EKKA 4HCSA 3EFXD 1FNWA 1SROA 2RDFA 2Z9HA 2Z8LA 4WJ3M 4F88A 3OWFA 3J80c 3R8BA 3CCRA 5AJ3L 1IYUA 2ZTDA 3ITPA 5KEEA 1PH5A 1C7YA 3G7LA 4CKEA 3V05A 3K59A 5IWAQ 3BVZA 2AUKA 4DPGA 3KYUA 2XNAC 2EYLA 3K0XA 1PVOA 4FF1A 1N33L 1S24A 1S5BD 5BR8L 4BBSG 1S3OA 1SNMA 1LO5D 3MFYA 3QJYA 1KNEA 4KLKA 1BQ9A 5JJZA 3OYYA 3U9OA 1EQTA 2E75C 1VF5C 1UEAB 1VDZA 1AN8A 3CMEA 1A8VA 2BA0A 1HZBA 4XTCS 3E5SA 5I9PA 1YHAA 3BG3A 2E2JB 2OT2A 3PCOB 3TP5A 1Q90A 1Z9FA 1WTVA 1PH4A 1GO3E 2PO4A 5C0XH 1CKNB 2RSNA 4Y7NL 2M6OA 1I4XA 2Y0SP 3DWQA 1WD0A 3M4YA 1WTXA 1NMGA 1F9QA 5K5PA 3S1RH 1KAWA 2E5LQ 4G57A 2R7ZB 4OWTB 2YTYA 2RKSA 5C44G 4XQNA 1LTRD 2KHJA 5ELEA 4JC0A 1T9HA 1PDQA 2QDBA 2E2HL 4CGYB 5EJWA 3VR3A 3PUWA 3FP9A 2JA8G 3K81C 5EGTA 1E22A 4QF4A 1XPOA 1C8CA 1H9JA 4OHJA 2LMCB 4NXNQ 1X32A 3I55A 4J1MA 1XNRQ 3PWFA 1L1OB 1MBYA 1EY7A 2L1BA 4LFBQ 1E2ZA 1JR0D 4Q5VA 3KFUA 4HJ7A 1GD7A 3E9IA 1EIYB 2HD3A 1HXYD 1Y8PB 2Y0SG 2J0TD 3I8ZA 4FVMA 4JI1L 3L2PA 1N32Q 1QWYA 1VQKA 3WOFA 4IPHA 4KY6A 1PZXA 2EE1A 1QVGA 3T1YQ 1IXRA 1HH2P 3SR1A 1J9OA 1F2MA 1SYFA 1EFWA 4OONA 2Q2UA 1NJIC 1ET6A 4B3SL 1MIUA 5GAEc 1LTLA 3PIOA 3SK8A 2K04A 4DR7L 2AQ3B 2YU9B 1PFUA 3ERSX 4C1NI 1CA5A 2UXBQ 3KDFB 2WB1B 2EY2A 4B9XA 1R0IA 1SMYC 4I65A 3G48A 4AI0A 3MC0B 3I56A 1IYJB 1TS3A 5C5LA 2ZXPA 3CD6A 4A3JG 4B3TL 3I4NL 4O0AA 3S1MB 1QZGA 4AYBP 3E3XA 5LMNQ 4KK7A 3C2PA 1LTBD 2F0MA 5C3EB 1SN8A 3CQZL 2RF4A 2ZJQA 4R4OA 3DEOA 3AFPA 3NTHA 5I2XA 1OXXK 4PV1C 3VYTA 5JPNC 4KMUC 7RXNA 3Q22A 3Q6SA 2UXBL 4RXNA 4A3GL 1AEXA 4C3IG 3STBC 1FGBD 5IP9G 3KYXA 1U5KA 2HQEA 4ILWA 3HOXG 2L55A 2MS3A 1CTMA 3L3OC 3MQKB 5EIOC 2SEBD 3L7ZC 3T1HQ 1RL2A 3B6YA 5GAHc 2K5NA 4C2M1 2FMCA 4K14A 3ERQA 2KCCA 3PGZA 3I4ML 4DAVA 4LFBL 4WFN1 4QY7A 4EQ5A 4APVA 3FPUB 4IUUA 3HOXL 3EROA 4UHVA 1BDOA 1JCKB 3S14B 3PQIA 4DNTB 1XWEA 1JJGA 2PYAA 4DAYA 5IYBH 4A3BL 3OTOQ 3FKIB 4JBWA 4JADA 2C5CA 1Y1VH 2EVBA 2HCCA 4JOIC 1Y14B 3OHXC 1HHVA 2V1CC 4LF6L 1K83L 1JOOA 2KQ3A 4KY5A 2JI1A 1BKBA 3PF5A 1G8ZD 1MD2D 3KLSX 3PL5A 4BBRG 1L0XB 4OX9L 1VQOA 4JI0L 2HDMA 3QG1A 1CZWA 4RGTA 3LNLA 3PO2H 1R9TL 1TS2A 4C3HG 1Q8IA 1BE7A 2KEEA 4UY8C 4LW1A 5ELCA 3CQZH 5C4XH 3S1QB 4MHEA 2ZTCA 4P2CB 1LT3D 1SR3A 2F0VA 2PMZB 3M7GA 5M5XB 1BNZA 1B2OA 1E1OA 3H0GH 1Q7YC 1XNQQ 3DM3A 1WFQA 2RDHA 4ZUJA 2WB1E 1HNXQ 2WKDA 3ULJA 2F0KA 3K7AB 1Y1WG 1WCMH 3M4QA 2I07B 5KNBA 1JB3A 2HHHL 6RXNA 1KXLA 2OQ0A 1NBWA 2JJQA 5CGKA 4B9WA 3HOWB 3SS2A 2K05A 4YCWA 3HOZG 2ZM6L 1LTAD 4XYQA 2UU9Q 1VQ7A 1K83B 3T1YL 1PFBA 1JMCA 3MEFA 4IUNA 4I7AA 2E76C 3CPWA 1R0GA 2F3VA 3E0JA 1K0SA 1XPRA 3AU7A 3SK5A 1R0HA 2B2WA 1Q46A 4A3KL 1XJVA 4IPCA 4YWMA 5KNCA 4OWXB 4GKKQ 4L63B 4LFCQ 3R2IA 2FXQA 1KAAA 5IP9L 4LF8L 2CW0C 4RAUC 1WCML 1CUKA 2WV6D 4L8JA 2EY1A 2K5QA 4HJ8A 2UU9L 3NWTA 1CQVA 1LT5D 4KHVA 4WJWA 5AFWA 5ELOA 1T9QA 3UDFA 3TS0A 1IU6A 5FKAC 3DMUA 5J39A 2JA5B 1DJRD 3S9WA 5I2YA 1STNA 5IP7L 2CKAA 4UPAA 4GZYC 1FHHA 1NNXA 3TEHB 5C5MA 3EA6A 1RTNA 3DHQA 1YIJA 1M90C 1IYVA 5JEAG 1CADA 1E2WA 5FJ8G 4DNRB 1K9MC 1II3A 1GOZA 1HZ9A 1HTPA 3IFDA 4QIWP 1WD1A 2C6AA 2MNAA 1RHPA 1WCMB 4ZKCB 1NR2A 3U4ZA 2IX1A 2CVRA 4N8FA 3TQYA 2B8FA 3HZXA 1D1IA 2K4KA 3BDLA 5IGFA 1SNCA 4IFDJ 3L0OA 1CSQA 5IYDL 4P75A 3AEVA 2NN6I 2SOBA 3PKJA 3ZJYC 1S4ZA 1VS0A 2NN6G 4LAAA 1LT4D 2WP8J 4FNFA 4BY7L 2AUSB 2IHFA 4L5QA 4K8IA 3D6CA 4A3CH 3W1BA 2ZJRA 2EIFA 4Q0FA 1DOKA 3LWRB 2EYOA 4IUQA 1O80A 3BDOA 4GN4B 4RHRA 1JICA 1M4VA 3HOWG 3GTPB 2M6PA 3CPFA 1SLJA 2VL6A 2HIVA 3NQIA 3B08B 1WTOA 1CHQD 3C1FA 4DUYQ 3M4OL 4KJNA 5FJ8L 1G51A 4EQNA 2CHBD 4OGQC 3KLWA 4A3JB 1M8AA 1F9RA 3PO3B 1B4OA 2H5XA 5C44H 1WTRA 4QQBX 4RWSC 5T1IA 2XGTA 2E2DC 3D4WA 2F3WA 4UP7A 4WRDA 3OTOL 4JI7Q 3KYWA 4NW2A 1T5XD 3HOYH 2VQFL 3D0FA 3T4AC 2XRQD 4AHYA 2CH4A 1XXGA 3NTIA 1G91A 4XQQA 1DCZA 2ASBA 2IX3A 1T9PA 1EIHA 4X3UA 4GLAC 1VZGA 3TZDA 3PO3G 2XJVA 3HKZE 5KIXA 2YTXA 1VQEA 2Y0SB 1L1OA 2CQOA 1VCXA 1IL8A 1DOLA 1F2YA 4RG1A 2VQEL 3T1HL 4B3ML 2B3GA 4KHPQ 1SRUA 4LUOA 2KCTA 4DV4L 1VF7A 5EBCA 2M4YA 3EVQA 3HOXH 2KBNA 3HKZP 1CT1D 3GTQH 2FINB 2A6HC 1HZCA 1D6EC 1NUCA 4C3JH 3MFGA 2K1BA 1EYCA 4A3IH 2I5HA 3IU3I 4RCOA 1A2TA 5ELFA 1NY4A 4AHWA 2R92H 1K8GA 1H9SB 4DV5L 1YITA 1KNAA 2VZAA 4JI3Q 3KUPA 1PH3A 1SNQA 2R7ZH 2F03A 1IKLA 2GN5A 4AR3A 4CHTB 3FDJA 1FYCA 3S1QL 2OCEA 4Y7NH 2UUCL 4G4KA 1SMWA 3WWLA 1HNWL 1PMRA 3TS2A 1SNPA 4EX5A 1Q12A 3UI2A 2VB2X 4X3KA 4GN5A 2WKCA 3SVMA 5GADc 2NVTB 4BS9A 2R6GA 1H7VA 4DKAC 2F0TA 4C1NK 3KYYA 2A6EC 2K28A 1QILA 3MXNA 3RLOA 4C3IL 1EYGA 1C09A 5IGEA 1G6ZA 1HFNA 3SE0A 1L1OC 1PYBA 5IY0A 3S14L 4BA1I 4U673 5DLQE 1YJ9A 2E74C 1LT6D 3KF6A 2ZM6Q 1SFOB 1O7YA 4GS3A 4HJAA 1ICFB 3BU2A 3NTKA 1I4PA 1IBML 4NXNL 2F0HA 2RCNA 1V1QA 1FL0A 1UE7A 1LABA 4O42A 3QOLA 1YVCA 3GTOL 4AHZA 3SXHA 2RSOA 1JWUD 2NVQB 4A3GH 3GTGB 4BA2I 4G7OC 5COYA 2HR5A 4LF5Q 2CQAA 2AKWB 1Z7TA 5JVH1 4J6HA 4RGOS 1P8LA 1TWAL 1CI3M 2B2UC 2F0UA 1O7LA 5IGDA 1DX8A 1U4LA 1YK4A 5IYCL 3HG9A 4DV3Q 1U4PA 1W6JA 4OELB 3AQQA 3HOYB 5EQ0A 1B13A 1R9TB 2QW7A 1BOSA 1SNDA 1YBYA 1IBKQ 3HRZC 1I3QH 4LNQA 3QB3A 2CH4W 4H44C 3R2TA 1IW7D 3CCQA 4JBJA 1NCVA 1IZ6A 4J8QA 5LL6X 1YJNA 2JA7L 5MF6A 2AQ2B 3O13A 4AI1A 4LHNA 3KBXA 1H9SA 1WJVA 1CKOA 4BBSL 1TU2B 1K73C 3S2DB 4A93G 2K5WA 1STAA 1K3RA 2L12A 3PKIA 3OIQA 4UP8A 4A3KG 2ERJA 1R0FA 5JJLA 2PZTA 1LACA 1QVFA 3HOVH 1BFYA 1ONLA 4P72A 1OWBA 5DEHA 4MZ9A 3S16B 1Y8NB 3J7YW 2UXDL 3H91A 2PQAB 1QCVA 2B8GA 4IUTA 4FF4A 5GAGc 4V190 3DUZA 4HJ9A 1QUQB 4QL5A 2F4IA 2YV5A 2EYFA 3CC7A 1YHQA 2I0QA 2B39A 1DONA 1LTID 1FNUA 1S40A 4YCUA 2PYKA 1HR0Q 4X6AH 1FGUA 1TWCB 2R93G 5C44L 1J6QA 1ZEQX 1IL2A 3F1ZA 3SHLA 3RNUA 2KJXA 5IYBG 5H1Sc 2A68C 3S17B 3CRKC 2AYJA 1EIFA 5M3ML 2QEJC 4ZK9B 4ZQ3A 2DSXA 4HIOA 3CCEA 4QIWB 2BDOA 2JA6G 3RLNA 2I5MX 1KLGD 1QVCA 1VQLA 1Z92B 1YUXA 2WACA 4LMQD 5M3MG 4JAGA 3WWNB 3HFZB 5D3DA 5IT9L 4E6IA 1AZPA 1C4QA 2LXKA 3RYGA 1TIID 2R93H 3LGJA 3S1ML 3GP7A 1TWHH 3W2DA 4L6TB 4AIMA 1BUVT 1OXVA 2B2VA 2NYZD 3I73A 4IPGA 2JA6B 3GTQB 3S2HB 3PIPA 4LF7Q 1Y1VB 1TWFL 1VQ5A 1ICWA 5FLML 4EGVA 2H1EA 2F0NA 4DF7A 4C3HL 1PXUA 3ER0A 4C3JL 2Q8IB 4TPUA 3WWVA 3MA2B 2JI2A 4LUVA 2WAQE 3SK6A 1VQ8A 4A93B 2DJGC 3VA5A 4OO1I 2G9DA 1X55A 5DM71 1D8LA 1SSOA 3K6OA 1IBMQ 2JXMB 3CMAA 1D5ZC 1VQIA 4A3LL 3GV3A 1J5EL 4DR1L 3QVDA 1L0YB 4A3FL 3S2DL 1T5EA 1Y1VG 2D2CC 1HUMA 2RHQB 3CRLC 3FKIG 4C3HB 5MGNA 4HMJA 3I4MB 2NVXB 2PZWA 2VY3A 3HOYG 4DAPA 3A8IE 2A6HD 3J81E 3S1NB 1I3QB 5EPJA 1I94Q 1PH2A 2I5LX 1JJCB 1PTOB 5C6AA 3KF8B 3QQCE 2PVEA 3B0AB 1QUQA 1VCIA 3JAML 3J80E 1ZYRC 2BH8A 2QF7A 5M5YH 4LF7L 3M3YL 4XDXA 4X65L 1JT8A 1YUZA 3I2ZA 1BXTA 5GROA 2A6ED 2SNMA 2YTVA 2EYPA 1SFOL 2C35B 1RYTA 4JI5Q 2B2VC 4ZCKA 4B3RL 1HNXL 3A0JA 2B2TC 1FD7D 2EY5A 3PUYA 1GHKA 3J81i 5D14A 5GADC 1TY2A 3A7LA 3M4OH 1ESRA 3P75A 3NFPI 4JI5L 2C6BA 2AWNA 2IJ0A 4B3TQ 3KBGA 5BN4A 5DM61 1FVIA 3RD4A 4G7HC 3GTLH 1LLRD 1YNND 5M5WH 4QGUA 4GOPC 1K8OA 5C3EG 5JOBA 2DJFC 4NDXA 3G6EA 4YIJA 2DGYA 5IP7G 2KUMA 1EUJA 2KCMA 4BWGB 2EY6A 1UE5A 1GUNA 1CKNA 5EINC 4OEMB 3J80L 3H94A 1SNOA 1ZKOA 1R9TH 1V1PB 2VQFQ 3PSIA 4JYAL 1Z6HA 3KYVA 3J81L 1D2BA 2CKCA 3S1NH 1YNJD 5HGTA 3WDNA 3FEWX 4RCNA 4XQJA 1WTWA 2B5ID 3HOZL 1B2TA 5CYUA 1I6VC 1E24A 2IT1A 1X56A 3J80i 3S2DH 5M3FG 2K6AA 1WTPA 2N8NA 2VS1A 3K7UC 1I50L 3ND9A 4AI2A 3DEPA 5IT9E 4DR4L 5FLXE 2JA7B 1SJED 3LWVB 1UE6A 5F2DA 4CDCC 3RUZA 2NVQL 4DK3C 4JK1C 2RBMA 4X66Q 3K5NA 3DLLA 1DOMA 3S16L 3M4PA 4IN3A 2V0EA 2ZJPA 3M3YH 2F0SA 4CKBA 1I6HH 2JA8L 3A5ZB 1WI5A 3TREA 1K8AC 1UNSA 1BF4A 4A3KH 2ATWA 2F0OA 4FF3A 2C9OA 1IBKL 4A93H 2A68D 2QCPX 3NBIA 3MXUA 3P2AA 3I90A 1SYGA 2MFIA 1VQ4A 1LTGD 3Q8DA 3HKZB 1H9RA 5HGQA 1W3SA 1HQMC 5AN9H 4IUPA 1C48A 5JVH3 4L5RC 3BYYB 4X6AL 2R92L 1D5XC 5E3FA 4IOAA 1AW7A 4LFAQ 3DM1A 1D7QA 5IT9c 3FPPA 4C3IH 1EZ6A 2D5DA 1EWCA 3NEMA 3T51B 1LYLA 4BY1G 2ZTEA 2PI2A 3E6ZX 4QB4A 1VQHA 1EY4A 3GTMH 2A69C 1EY0A 3I4MG 2AUJD 4BY1H 2UUBQ 1VQAA 2K01A 2NZHA 1YV1A 3EJIA 2WB1G 2E2HB 2PZUA 5A2QE 4A3EH 1CQFA 1PTOH 2Z6KA 1E2VA 2K5DA 4ZN3B 4R4QA 2JSOA 4IFDG 4JG2A 4AQYQ 1D1KA 2MJ8A 4TRDA 1IROA 1QQTA 4GNXC 1TY0A 1W2BA 1TWFH 1E1TA 1BBUA 4LF8Q 4H0LC 3TRZA 5IGGA 3M4OB 1TWGL 2R3ZA 3J7Y1 1RODA 3K5LA 2E2IH 4I7ZC 3RLFA 4U68A 4A3CL 1Q86C 4K2KA 3GTLB 3S1RB 4IPDA 2NVQH 1S2ZA 2CWPA 4G7ZC 5CR3A 3GTKL 5C3WA 2V0FA 1P16A 1SBBB 1PHJA 1BBXC 2E2JL 1J5EQ 4A3MH 1EU4A 4DR5Q 1N36L 3CKIB 1EY5A 2ZXOA 4IJLA 4CJ2C 3BVGA 1E7ZA 2QDLA 4Y7NB 4PQXA 1G6PA 3NUCA 3TP8A 2V3BB 1UUPA 1BR9A 4BY7G 2Q2TA 5I4DA 4DUYL 3GTOH 3PO3H 3A44A 2JA5L 1RF2D 5M3FH 2E5LL 2UUBL 4AHXA 4K9FA 3JC62 1X3PA 1PYSB 1RYQA 2O2LD 1KC8C 4AR5A 3JAMi 3GTJH 2QL0A 1M1KC 1DXMA 4YCVA 3L9AX 4JV5L 1PTOD 1TWAB 4HCEA 3IAYA 3G71A 3BZDB 5GAEC 5JVG1 2WFWA 4MIUA 5CMDA 2B63G 1MJCA 4DK1A 4HIMA 3S24A 3H3VC 4A76A 4DV1Q 5IOCA 2O5JD 4B3RQ 2R92G 4DV2Q 1A3VA 2MO1A 4UDUC 2EXDA 2JA6L 4R8NA 2VXWA 1ILQA 3EQLC 1KHIA 3A54A 1EQRA 2ZXRA 1Y1WL 2JA8B 1PRTF 1VQ6A 4P71A 1ZXTA 4A3EL 3K8AA 4JV5Q 2JA9A 4KV6A 2E2IB 2EQSA 2PMZP 2KCNA 3T16A 4A75A 3C3LA 2Q2HA 4A3DH 1TWGH 4OXPA 4HJ5A 4DR1Q 2DNCA 1PH6A 1I6HB 1A3UA 2IHEA 1PFWA 2Z3RB 4OO1H 4HR7B 2RCFA 3H09A 4IOCA 1VQFA 4MTKA 1KDBA 1NTGA 5C4XB 3RZDB 4GOPA 4DR5L 3HOVG 1ZYRD 3I4NB 2MPMA 2BDNA
chains in the Genus database with same CATH topology
4GS3A 4HJAA 2QEXA 3K80C 3BU2A 1ASYA 1B70B 5IWAQ 4UP9A 4QIWE 4NXNL 1IBML 4DPGA 4LF9Q 2RCNA 3KYUA 1V1QA 1FL0A 4V196 1UE7A 3K0XA 2JA6H 1X6OA 1YVCA 3CXCA 1N33L 1XMOQ 4GLXA 2A8VA 1S24A 3HOZH 1KQSA 4BXXH 1PVOA 4LF4Q 5BR8L 4AHZA 2A1AA 1XMQL 1S3OA 4BBSG 3H3VI 1UEBA 1Y1WH 4A3GH 1LKOA 3I7FA 4GLVB 2K5VA 4BA2I 2JE6I 1R0JA 4KLKA 1BQ9A 4DV6Q 3UDGA 3OYYA 2HR5A 4LF5Q 1RIPA 3EN2A 2AKWB 4DR6L 1AH9A 5JVH1 4A3LH 1P8LA 1C9OA 3J81j 3CMEA 1A8VA 2BA0A 2JEAI 1HZBA 4XTCS 4ALPA 1XTDA 2F3IA 3RZ6A 1YHAA 4OO1G 3PIP1 1DX8A 4JI3L 1YK4A 2OWOA 1O7IA 4DV3Q 4A3CG 3W5OA 5MFPA 3VPBE 3KDFA 3PCOB 3AQQA 5MFZA 4P74A 1B13A 4C3HH 1N34L 1Z9FA 2YU9H 2L0ZA 1PH4A 1YBYA 3A74A 1GO3E 4HIDA 1CKNB 1IBKQ 3P8BA 3S14H 1T9OA 1I3QH 4LNQA 4BBRH 2CWAA 2M6OA 1IW7D 1GVPA 4A3DG 3CCQA 2KENA 4JBJA 4DR7Q 1IZ6A 2WAQG 3GO5A 1YJNA 4LF5L 1NMGA 3S1RH 1KAWA 5MF6A 4DV6L 3IRBA 2E5LQ 1PH9A 4BBSH 3CCLA 4OWTB 2YTYA 1HNZQ 1OWCA 4AI1A 1X65A 4IJHA 4LHNA 1KRTA 5C44G 5FJ8H 4JI1Q 1WJVA 4X64Q 2QA4A 5LMNW 1N32L 4O2DA 2F4VQ 1CKOA 2KHJA 2K52A 5IE8A 1K73C 4U671 1E8JA 1T9HA 4JC0A 5IWAL 4LF9L 3BZCA 4A93G 3CC2A 2VNUD 1K3RA 2PQAA 4BY7G 3PKIA 4UP8A 4A3KG 1K0RA 2ERJA 1R0FA 1X9NA 5JJLA 3PUWA 4YY3Q 1RDVA 3FP9A 4E6YA 1BFYA 1UWVA 2PNHA 1QVFA 3K81C 3EBEA 2JA8G 3HOVH 3JC63 5EAYA 4P72A 1OWBA 4DV7Q 1E22A 3HKSA 1XPOA 4MZ9A 4GKKL 4J15A 2OTJA 2KHIA 3U50C 1DVBA 4NXNQ 2UXDL 2MQHA 3GTKH 2PQAB 3F8TA 1QCVA 2XJPA 5LMUL 5GAGc 3I55A 1XNRQ 2IX0A 4YY3L 3PWFA 1L1OB 1NE3A 4PZ6A 4NB3A 3M3YH 2E8GA 4HJ9A 4LFBQ 1QUQB 3PO2G 1BRFA 4QL5A 3KFUA 4HJ7A 3KJPA 1NXEA 1GD7A 2YV5A 3E9IA 1EIYB 3HOWH 1FJGL 5J3BA 2F4VL 5AI2A 2Y0SG 4JI1L 1N32Q 1A0IA 3L2PA 3CC7A 1PH1A 1YHQA 1VQKA 2I0QA 2UUAL 4IPHA 4P73A 1X3FA 1KL9A 1Q1BA 1QVGA 1E3PA 1IXRA 1HH2P 3T1YQ 1S40A 1EFWA 1EQQA 4YCUA 4OONA 5GQOA 1JYBA 2PSMC 4AR6A 4UY81 1NJIC 1HR0Q 1MIUA 4B3SL 5AI3A 1LTLA 5GAEc 4X62Q 1FGUA 3PIOA 2R93G 1J6QA 4B3ML 4DR7L 1IL2A 3F1ZA 3RNUA 5IYBG 1A62A 3ERSX 2NVXH 5H1Sc 1KD1C 2UXBQ 3KDFB 4OWWB 2Z6KC 2AYJA 4X64L 1EIFA 5M5XH 1R0IA 2LSSA 2DSXA 3G48A 4AI0A 2XJQA 3CCEA 4HIOA 2OTLA 5JJIA 3PZAA 1IYJB 2AHOB 3I56A 4BXXG 4K0KQ 2JA6G 3RLNA 2I5MX 4A3JG 4FDBA 1QVCA 4JI8Q 4B3TL 3CD6A 4O0AA 4A3GG 1QZGA 4JOIA 3F2CA 1VQLA 3M7NA 1Z92B 5LMNQ 1YUXA 3CCJA 2YYZA 2MO0A 1VZHA 2KKDA 4JAGA 5M3MG 4A3JH 3WWNB 4A3FG 4YHHQ 3HFZB 3CCSA 1SN8A 2RF4A 2ZJQA 4R4OA 2LXKA 3RYGA 3RR5A 2CR8A 2UUCQ 2R93H 3LGJA 5LMNL 4KI0A 4TVMA 1TWHH 3AFPA 4TQUS 4AIMA 1N34Q 1X3EA 4HIKA 4WJ4A 3RZDH 1OXXK 1OXVA 1SMXA 4IPGA 1K83H 4NXMQ 3PIPA 5IP9H 3H0GG 4DV4Q 3W1GA 4LF7Q 5C4XG 7RXNA 5IYCH 1WYDA 1VQ5A 2UXBL 4RXNA 3KF6B 4A3BH 1YEZA 3F2DA 3STBC 1HZAA 5IP9G 4GOPB 3KYXA 1U5KA 3ER0A 4GKJQ 4A3MG 1L2FA 4R4TA 5FLMH 1FJGQ 3LPEB 4TPUA 3WWVA 3HOXG 1N36Q 3J7Z1 1BQ8A 2JI2A 2MS3A 2ES2A 4LUVA 4L5SA 2PPTA 4LF4L 2WAQE 4R1JA 1VQ8A 3PUZA 5EIOC 4LUZA 3MXNB 3L7ZC 3T1HQ 4B3SQ 5FLMG 1N33Q 3GTGH 2UXDQ 1RL2A 4OO1I 3B6YA 5GAHc 3GD7A 2K5NA 1NMFA 4KHPQ 2RHSB 1X55A 5DM71 2XJUA 4X65Q 1D8LA 2HIXA 4B3MQ 2ID0A 3HOUH 1WOCA 3PGZA 1QZHA 4LFBL 4WFN1 1G291 1IBMQ 4QY7A 4EQ5A 4APVA 3CMAA 1VQIA 5C3EH 3PF4A 1J5EL 4DR1L 1RB9A 3QVDA 3CCUA 1Y1VG 3I4OA 2RHQB 4AYBE 3OW2A 4DR3L 3K35A 1VQCA 3FKIG 2PYAA 5MGNA 1JJGA 1DGSA 3E9HA 5IYBH 4JI7L 2VY3A 3OTOQ 1L0WA 4JBWA 4DV0Q 3HOYG 2A6HD 4JADA 1Y1VH 4JOIC 4LWCA 2CCZA 4JI6Q 1LKPA 1GKHA 1Y14B 5JJKA 2D0PA 4PZ8A 1I94Q 2V1CC 2VUMG 4R4CA 4LF6L 1PH2A 2I5LX 4AI3A 2JQOA 1JJCB 2JEBI 2GMGA 2JI1A 1BKBA 3KF8B 3QQCE 2PVEA 3B0AB 1QUQA 1VCIA 3PF5A 3G4SA 2BH8A 4BBRG 1LM0A 2R7FA 1Q82C 5M5YH 2E2HH 4LF7L 2HHHQ 4OX9L 1VQOA 1VZIA 4JI0L 1ODHA 4GS7D 4MTNA 4X65L 1JT8A 1QYBA 8RXNA 3LNLA 3PO2H 1YUZA 4TVAB 3I2ZA 3F2BA 5GROA 4BY7H 1BE7A 4DV5Q 2A6ED 4A3BG 1I5FA 4UY8C 2Q2IA 2YTVA 4LW1A 1A63A 2C35B 1RYTA 5C0XG 3CQZH 4JI5Q 5C4XH 1BBWA 3D31A 2NVTH 2ZTCA 4B3RL 3JAMc 2Z3QB 1HNXL 3A0JA 1SR3A 3PUYA 5C0XI 1VQGA 3J81i 3PIO1 1YNXA 5GADC 1IU5A 5IYCG 3M4OH 1U0LA 1B2OA 1E1OA 3H0GH 1Q7YC 1XNQQ 5IYDG 3NFPI 3DM3A 1WFQA 4JI5L 4K0KL 2C6BA 2K14A 2WB1E 3NENA 2AWNA 3RN2A 4A3FH 1HNXQ 4JI8L 3ULJA 4B3TQ 5DM61 1FVIA 3GTLH 2R7ZG 1XMQQ 1Y1WG 2K5HA 1WCMH 1IBLL 5M5WH 4QGUA 4GOPC 3M4QA 4POGA 4JI0Q 2HHHL 4OX9Q 5C3EG 6RXNA 1KXLA 1SMUA 2D0OA 2OQ0A 1NBWA 2JJQA 3G6EA 1S30A 2K75A 2NZOA 3UE1A 4JAFA 2DGYA 2Z0SA 5IP7G 3SS2A 1EUJA 4YCWA 2KCMA 3CC4A 3NELA 2XTIA 2ZM6L 1YI2A 3HOZG 2UU9Q 1XPRA 1UE5A 1Z47A 1GM5A 2CKZB 4B8CD 1CKNA 5EINC 5GAGC 2ALYB 4L5TA 1VQ7A 2ZIXA 3KJOA 2E2JH 2PI2E 1WJJA 1SFOH 1UE1A 4DK6C 3T1YL 3S17H 2J9UB 4DR2L 1JMCA 3MEFA 3MPSA 5GAHC 4LF6Q 1CKMA 3I4MH 4KHPL 1R9TH 2VQFQ 1NXGA 3PSIA 3CPWA 5K2ME 1XPUA 1R0GA 4JYAL 1ASZA 1B8AA 4LFCL 1CSPA 3KYVA 2F52A 1R0HA 2Y0SE 2CKCA 4IO9A 4A3IG 3S1NH 4G6BA 1Q46A 4DR3Q 3ICEA 1VQNA 3S15H 1XJVA 2PVXA 4IPCA 4YWMA 2B5ID 3STBD 1B71A 4JI6L 4OWXB 4DR4Q 4GKKQ 4LFCQ 4JYAQ 1E24A 2IT1A 1X56A 2FXQA 3J80i 3S2DH 2UUAQ 4PMWA 3PUXA 5M3FG 4RMFA 2N8NA 1CUKA 2VS1A 3M9BA 4LF8L 3K7UC 2M4VA 1B7YB 4JI2Q 2VW9A 1FHMA 4AI2A 4DR4L 1VQBA 2JK8A 4HJ8A 2UU9L 3TS0A 1YZ6A 3UDFA 5ELOA 1D7QA 1T9QA 1UE6A 1IU6A 1VQJA 5IP7H 1OXTA 3KYHC 4DUZL 4X6AH 1LUZA 4DK3C 4H02A 4DV2L 3ULPA 4X66Q 3DLLA 1YHBA 1RWDA 2JA5G 2CKAA 4UPAA 3M4PA 3PUVA 1FHHA 1VQMA 2V0EA 2ZJPA 2A69D 2JI3A 1WCMG 3UDIA 3TEHB 1V9PA 1S72A 3U58A 1MJEA 3H3VH 5C4JH 3A5ZB 1WI5A 2D62A 3SGIA 1YIJA 1I6HH 3TREA 1HNWQ 1K8AC 1M90C 2IY5B 1N9WA 5JEAG 1CADA 1K9MC 5FJ8G 4A3LG 4A3KH 3J7ZC 2ATWA 1HZ9A 1V43A 2C6AA 3K7AH 3BZKA 2MNAA 4GKJL 1IBKL 4A93H 2A68D 3U4ZA 4YHHL 2K50A 2IX1A 1VQPA 3HKZG 3P2AA 3TQYA 1X3GA 2K4KA 2MFIA 1VQ4A 3Q8DA 4NXML 4IFDJ 3L0OA 1CSQA 2CFMA 5HGQA 4P75A 4AYBG 3RN5A 1TWCH 3CW2C 4A4IA 3AEVA 1W3SA 2NN6I 3HOUG 5AN9H 4L5RC 3A5UA 1YK5A 3PKJA 3AFQA 4IOAA 2XJRA 3ZJYC 1TXYA 4LFAQ 1KIXA 5IYDH 2B29A 1MKHA 1VS0A 2NN6G 4QJFA 5HY6A 2VQEQ 2WP8J 4C3IH 5IT9c 1HR0W 1XNQL 3J7A5 2IHFA 3RZTA 3NEMA 1LYLA 4L5QA 4BY1G 4XGHA 4DR6Q 2ZTEA 4A3CH 4JCVE 2PI2A 4DNIA 3S16H 3W1BA 2ZJRA 2EIFA 1VQHA 2PMZE 3UDXA 3GTMH 2K2DA 3RZOH 3M85A 1OTCA 3I4MG 4GN4B 1BVSA 4BY1H 3H15A 1VQAA 2UUBQ 1SE8A 1AE2A 2NZHA 1YV1A 1AE3A 2WB1G 4R4IA 4JBKA 1Q1EA 3HOWG 4DV3L 4A3EH 1I94L 2NYDA 2M6PA 3CPFA 1SLJA 2VL6A 2HIVA 2Z6KA 4DUZQ 3CCMA 3B08B 4ZN3B 4R4QA 2XJSA 4DUYQ 4IFDG 2KN9A 4JG2A 4X66L 1PV4A 4AQYQ 3CF5A 1IROA 3ULLA 1G51A 3AYHB 4GNXC 1W2BA 1TWFH 4IFDI 1E1TA 1BBUA 3KLWA 4MNOA 4GN3B 3I4NG 2UXCL 5RXNA 4YWLA 5ELNA 1XNRL 2H5XA 5C44H 2JA7H 2BA1A 4QQBX 1CAAA 1PFSA 4LF8Q 2XGTA 2VUMH 2GVBA 4NPSA 4UP7A 3EIVA 5E7NA 3PV0A 3OTOL 4DV0L 4GNXB 3KYWA 4AQYL 4JI2L 4JI7Q 3HOYH 2VQFL 3D0FA 4YWKA 3J7Y1 3JC66 2N78A 2E2IH 4AHYA 3RLFA 5FLXc 3S2HH 2R7DA 1Q86C 4XXBB 2NVYH 1B2JA 4IPDA 2NVQH 1S2ZA 1TWAH 2UXCQ 2CWPA 4DAMA 2ASBA 2V0FA 1T9PA 1P16A 1PHJA 3GTPH 4GLAC 1VZGA 3NBHB 1J5EQ 4A3MH 3PO3G 2XJVA 3HKZE 5LMUQ 3GDEA 4DR5Q 1N36L 2BH2A 4IJLA 3BJUA 2YTXA 1E7ZA 2N49A 2ERSA 1G6PA 1VQEA 1L1OA 2CQOA 4DR2Q 2V3BB 1VCXA 1H95A 1N8RC 1EOVA 4RG1A 1RDGA 4PZ7A 2VQEL 2B3GA 2GVAA 4DUYL 4DV7L 3T1HL 2Q2TA 1SRUA 4LFAL 3GTOH 3A44A 1ZRPA 3PO3H 4Y52H 1PA6A 4LUOA 2KCTA 1IRNA 4DV4L 2HT1A 4LHLA 1HNZL 5K36G 5M3FH 2E5LL 2M4YA 1VQDA 3HOXH 4ZN1B 1OXSC 1JB7A 2UUBL 4AHXA 4K9FA 2KBNA 1VQ9A 3JC62 3GTQH 2LCQA 1PYSB 1RYQA 4JI4Q 4XIGS 1KC8C 4AR5A 3JAMi 3GTJH 2QL0A 1HZCA 1M1KC 4AH6A 3J81c 4C3JH 1X54A 5MLC3 3E0EA 4YCVA 1SMMA 4KHZA 3TRZA 4JV5L 4A3IH 3G71A 2I5HA 3IU3I 5C0XJ 4PG3A 1IBLQ 5GAEC 5JVG1 2A19A 1NY4A 2WFWA 1PH7A 4AHWA 1JE5A 2OQKA 2R92H 3CCVA 1MJCA 1K8GA 1LKMA 4DV5L 4HIMA 3FKIH 3S24A 1YITA 2B63G 3ZG6A 4A76A 2VZAA 4JI3Q 4DV1Q 2O5JD 1PH3A 2R7ZH 4B3RQ 3U4VA 2HQLA 4ME3A 2GN5A 4AR3A 2DUDA 3KOJA 4DV2Q 3VDYA 4AR4A 2B63H 1PH8A 2R92G 2MO1A 5M3MH 1Q81C 2EXDA 4A3EG 2AMCB 2OCEA 4X62L 4Y7NH 3CAMA 2UUCL 2RDVA 4JBMA 4DV1L 3FHWA 1KHIA 2H12A 1EQRA 1SMWA 3WWLA 2LXJA 4DAYB 2JA5H 2JA7G 2L15A 3TS2A 3S1QH 1HNWL 4EX5A 1Q12A 3I4NH 3MSUA 1OXUA 4GNXA 2N3SA 1VQ6A 2Q2UA 4GN5A 4P71A 3K8AA 4JV5Q 5H1SE 5BR8Q 2JA9A 1NNQA 5GADc 5JEAJ 2EQSA 4A75A 1XMOL 1EWIA 4C2MH 2R6GA 2Q2HA 4A3DH 1H7VA 1TWGH 1JJ2A 1HR0L 3S1MH 4OXPA 3UE0A 4DKAC 1KRSA 4HJ5A 4DR1Q 2XJTA 4JI4L 4JAEA 1PH6A 1YJWA 2QGQA 3KYYA 2IHEA 5AJ3Q 2Z3RB 1Q8KA 3RLOA 3CP0A 1HJPA 1EYGA 1SROA 1C09A 1I50H 4IOCA 4WJ3M 1VQFA 2BE5D 3J80c 1L1OC 1PYBA 1NTGA 3CCRA 5IY0A 4BA1I 4POFA 5AJ3L 4GOPA 4DR5L 2JA8H 2AWOA 2ZTDA 1PH5A 5DLQE 1YJ9A 1C7YA 3HOVG 1C0AA 2ZM6Q 3KF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GS3 A;  4HJA A;  2QEX A;  3K80 C;  3BU2 A;  1ASY A;  1B70 B;  5IWA Q;  4UP9 A;  4QIW E;  4NXN L;  1IBM L;  4DPG A;  4LF9 Q;  2RCN A;  3KYU A;  1V1Q A;  1FL0 A;  1UE7 A;  3K0X A;  2JA6 H;  1X6O A;  1YVC A;  3CXC A;  1N33 L;  1XMO Q;  4GLX A;  2A8V A;  1S24 A;  3HOZ H;  1KQS A;  4BXX H;  1PVO A;  4LF4 Q;  5BR8 L;  2A1A A;  1XMQ L;  1S3O A;  4BBS G;  3H3V I;  1UEB A;  1Y1W H;  4A3G H;  1LKO A;  3I7F A;  4GLV B;  2K5V A;  4BA2 I;  2JE6 I;  1R0J A;  4KLK A;  1BQ9 A;  4DV6 Q;  3UDG A;  3OYY A;  2HR5 A;  4LF5 Q;  1RIP A;  3EN2 A;  2AKW B;  4DR6 L;  1AH9 A;  1P8L A;  1C9O A;  3J81 j;  3CME A;  1A8V A;  2BA0 A;  2JEA I;  1HZB A;  4XTC S;  4ALP A;  1XTD A;  2F3I A;  3RZ6 A;  1YHA A;  4OO1 G;  1DX8 A;  4JI3 L;  1YK4 A;  2OWO A;  1O7I A;  4DV3 Q;  4A3C G;  3W5O A;  3KDF A;  3PCO B;  3AQQ A;  4P74 A;  1N34 L;  1B13 A;  4C3H H;  1Z9F A;  2YU9 H;  1PH4 A;  1YBY A;  3A74 A;  1GO3 E;  4HID A;  1CKN B;  1IBK Q;  3S14 H;  1T9O A;  1I3Q H;  4LNQ A;  4BBR H;  2CWA A;  1GVP A;  4A3D G;  3CCQ A;  2KEN A;  4JBJ A;  4DR7 Q;  1IZ6 A;  2WAQ G;  3GO5 A;  1YJN A;  4LF5 L;  1NMG A;  3S1R H;  1KAW A;  4DV6 L;  3IRB A;  2E5L Q;  1PH9 A;  4BBS H;  3CCL A;  4OWT B;  2YTY A;  1HNZ Q;  4IJH A;  5C44 G;  1X65 A;  1KRT A;  2QA4 A;  4A3L H;  5FJ8 H;  4JI1 Q;  4X64 Q;  5LMN W;  1N32 L;  4O2D A;  2F4V Q;  1CKO A;  2KHJ A;  2K52 A;  5IE8 A;  1K73 C;  4JC0 A;  1E8J A;  1T9H A;  5IWA L;  4JI4 L;  4LF9 L;  3BZC A;  4A93 G;  3CC2 A;  2VNU D;  1K3R A;  2PQA A;  4BY7 G;  4UP8 A;  4A3K G;  1K0R A;  1R0F A;  1X9N A;  5JJL A;  3PUW A;  4YY3 Q;  1RDV A;  3FP9 A;  1QVF A;  1BFY A;  1UWV A;  2PNH A;  2JA8 G;  3K81 C;  3EBE A;  3HOV H;  3JC6 3;  5EAY A;  4P72 A;  4DV7 Q;  1E22 A;  3HKS A;  1XPO A;  4MZ9 A;  4GKK L;  4J15 A;  2OTJ A;  2KHI A;  3U50 C;  1DVB A;  4NXN Q;  2UXD L;  2MQH A;  3GTK H;  2PQA B;  3F8T A;  1QCV A;  5LMU L;  3I55 A;  1XNR Q;  2IX0 A;  4YY3 L;  3PWF A;  1L1O B;  1NE3 A;  4PZ6 A;  4NB3 A;  2E8G A;  4HJ9 A;  4LFB Q;  1QUQ B;  3PO2 G;  1BRF A;  4QL5 A;  3KFU A;  4HJ7 A;  3KJP A;  2YV5 A;  1GD7 A;  3E9I A;  1EIY B;  3HOW H;  1FJG L;  5J3B A;  2F4V L;  5AI2 A;  2Y0S G;  4JI1 L;  1N32 Q;  1A0I A;  3L2P A;  3CC7 A;  1PH1 A;  1YHQ A;  1VQK A;  2I0Q A;  2UUA L;  4IPH A;  4P73 A;  1X3F A;  1KL9 A;  1Q1B A;  1QVG A;  1E3P A;  1IXR A;  1HH2 P;  3T1Y Q;  1S40 A;  1EFW A;  1EQQ A;  4YCU A;  4OON A;  5GQO A;  1JYB A;  4AR6 A;  1NJI C;  1HR0 Q;  4B3S L;  4X6A H;  1MIU A;  5AI3 A;  1LTL A;  4X62 Q;  3PIO A;  1FGU A;  2R93 G;  1J6Q A;  4B3M L;  4DR7 L;  1IL2 A;  3F1Z A;  3RNU A;  5IYB G;  1A62 A;  3ERS X;  2NVX H;  1KD1 C;  2UXB Q;  3KDF B;  4OWW B;  2Z6K C;  4X64 L;  1EIF A;  5M5X H;  1R0I A;  2LSS A;  2DSX A;  3G48 A;  3CCE A;  4HIO A;  2OTL A;  5JJI A;  3PZA A;  1IYJ B;  2AHO B;  3I56 A;  4BXX G;  4K0K Q;  2JA6 G;  3RLN A;  2I5M X;  4A3J G;  4FDB A;  1QVC A;  4JI8 Q;  4B3T L;  3CD6 A;  4O0A A;  4A3G G;  1QZG A;  4JOI A;  3F2C A;  1VQL A;  3M7N A;  5LMN Q;  1YUX A;  3CCJ A;  2YYZ A;  2MO0 A;  2KKD A;  5M3M G;  4A3J H;  2UUC Q;  4A3F G;  4YHH Q;  3HFZ B;  3CCS A;  1SN8 A;  2RF4 A;  2ZJQ A;  4R4O A;  2LXK A;  3RYG A;  3RR5 A;  2R93 H;  3LGJ A;  5LMN L;  4KI0 A;  1TWH H;  3AFP A;  4TQU S;  4AIM A;  1N34 Q;  4WJ4 A;  1X3E A;  4HIK A;  3RZD H;  1OXX K;  1OXV A;  1SMX A;  4IPG A;  1K83 H;  4NXM Q;  3PIP A;  5IP9 H;  3H0G G;  4DV4 Q;  3W1G A;  4LF7 Q;  5C4X G;  7RXN A;  5IYC H;  1WYD A;  1VQ5 A;  2UXB L;  4RXN A;  3KF6 B;  4A3B H;  1YEZ A;  3F2D A;  3STB C;  1HZA A;  5IP9 G;  4GOP B;  3KYX A;  1U5K A;  3ER0 A;  4GKJ Q;  4A3M G;  1L2F A;  4R4T A;  5FLM H;  1FJG Q;  4TPU A;  3WWV A;  1N36 Q;  3HOX G;  1BQ8 A;  2MS3 A;  2ES2 A;  4LUV A;  4L5S A;  4LF4 L;  2WAQ E;  4R1J A;  1VQ8 A;  3PUZ A;  4LUZ A;  3MXN B;  3L7Z C;  3T1H Q;  4B3S Q;  5FLM G;  1N33 Q;  3GTG H;  2UXD Q;  1RL2 A;  4OO1 I;  3B6Y A;  3GD7 A;  4KHP Q;  2K5N A;  1NMF A;  2RHS B;  1X55 A;  4X65 Q;  4B3M Q;  1D8L A;  2HIX A;  3HOU H;  2ID0 A;  1WOC A;  3PGZ A;  1QZH A;  4LFB L;  1G29 1;  1IBM Q;  4QY7 A;  4EQ5 A;  4APV A;  3CMA A;  1VQI A;  5C3E H;  3PF4 A;  1J5E L;  4DR1 L;  1RB9 A;  3QVD A;  3CCU A;  1Y1V G;  3I4O A;  2RHQ B;  4AYB E;  3OW2 A;  4DR3 L;  1VQC A;  3FKI G;  1JJG A;  2PYA A;  1DGS A;  3E9H A;  5IYB H;  4JI7 L;  2VY3 A;  3OTO Q;  1L0W A;  4JBW A;  4DV0 Q;  3HOY G;  4JOI C;  4JI6 Q;  1Y1V H;  2CCZ A;  4LWC A;  5JJK A;  1LKP A;  1GKH A;  1Y14 B;  2D0P A;  4PZ8 A;  1I94 Q;  2V1C C;  2VUM G;  4R4C A;  4LF6 L;  1PH2 A;  2I5L X;  2JQO A;  1JJC B;  2JEB I;  2GMG A;  1BKB A;  3KF8 B;  3PF5 A;  2PVE A;  1QUQ A;  1VCI A;  3G4S A;  2BH8 A;  4BBR G;  1LM0 A;  2R7F A;  1Q82 C;  5M5Y H;  2E2H H;  4LF7 L;  2HHH Q;  4OX9 L;  1VQO A;  4JI0 L;  4MTN A;  4X65 L;  1JT8 A;  1QYB A;  8RXN A;  3PO2 H;  1YUZ A;  4TVA B;  3I2Z A;  3F2B A;  5GRO A;  4BY7 H;  1BE7 A;  4DV5 Q;  4A3B G;  1I5F A;  4UY8 C;  2Q2I A;  2YTV A;  4LW1 A;  1A63 A;  2C35 B;  1RYT A;  5C0X G;  3CQZ H;  4JI5 Q;  5C4X H;  1BBW A;  3D31 A;  2NVT H;  2ZTC A;  4B3R L;  3JAM c;  1HNX L;  3A0J A;  1SR3 A;  3PUY A;  5C0X I;  1VQG A;  3J81 i;  1YNX A;  5GAD C;  1IU5 A;  5IYC G;  3M4O H;  1U0L A;  1B2O A;  1E1O A;  3H0G H;  1Q7Y C;  1XNQ Q;  5IYD G;  3DM3 A;  4JI5 L;  1WFQ A;  4K0K L;  2K14 A;  2WB1 E;  3NEN A;  2AWN A;  3RN2 A;  4A3F H;  1HNX Q;  4JI8 L;  3ULJ A;  4B3T Q;  1FVI A;  3GTL H;  2R7Z G;  1XMQ Q;  1Y1W G;  2K5H A;  1WCM H;  1IBL L;  5M5W H;  4QGU A;  4GOP C;  3M4Q A;  4POG A;  4JI0 Q;  2HHH L;  4OX9 Q;  5C3E G;  6RXN A;  1KXL A;  1SMU A;  2D0O A;  2OQ0 A;  1NBW A;  2JJQ A;  3G6E A;  1S30 A;  2K75 A;  2NZO A;  3UE1 A;  2DGY A;  2Z0S A;  5IP7 G;  3SS2 A;  1EUJ A;  4YCW A;  2KCM A;  3CC4 A;  3NEL A;  2XTI A;  2ZM6 L;  1YI2 A;  3HOZ G;  2UU9 Q;  1GM5 A;  1UE5 A;  1Z47 A;  2CKZ B;  1CKN A;  5GAG C;  1VQ7 A;  2ALY B;  4L5T A;  3KJO A;  3S17 H;  2E2J H;  2PI2 E;  1WJJ A;  1SFO H;  1UE1 A;  4DK6 C;  3T1Y L;  4DR2 L;  1JMC A;  3MEF A;  3MPS A;  5GAH C;  4LF6 Q;  1CKM A;  3I4M H;  4KHP L;  1R9T H;  2VQF Q;  3PSI A;  3CPW A;  1XPU A;  1R0G A;  4JYA L;  1ASZ A;  1B8A A;  4LFC L;  1CSP A;  3KYV A;  2F52 A;  1R0H A;  2Y0S E;  4IO9 A;  4A3I G;  1XPR A;  3S1N H;  4DR3 Q;  1Q46 A;  3ICE A;  1VQN A;  3S15 H;  1XJV A;  2PVX A;  4IPC A;  4YWM A;  3STB D;  1B71 A;  4JI6 L;  4OWX B;  4DR4 Q;  4GKK Q;  4LFC Q;  4JYA Q;  1E24 A;  2IT1 A;  1X56 A;  2FXQ A;  3J80 i;  3S2D H;  2UUA Q;  4PMW A;  3PUX A;  5M3F G;  4RMF A;  2N8N A;  1CUK A;  2VS1 A;  3M9B A;  4LF8 L;  3K7U C;  1B7Y B;  4JI2 Q;  2VW9 A;  1FHM A;  4DR4 L;  1VQB A;  2JK8 A;  4HJ8 A;  2UU9 L;  3TS0 A;  1YZ6 A;  3UDF A;  5ELO A;  1D7Q A;  1T9Q A;  1UE6 A;  1IU6 A;  1VQJ A;  5IP7 H;  1OXT A;  3KYH C;  4DUZ L;  1LUZ A;  4DK3 C;  4H02 A;  4DV2 L;  3ULP A;  4X66 Q;  3DLL A;  1YHB A;  1RWD A;  2JA5 G;  4UPA A;  3M4P A;  3PUV A;  1FHH A;  1VQM A;  2ZJP A;  3M3Y H;  1WCM G;  3UDI A;  1MJE A;  3H3V H;  3TEH B;  1V9P A;  1S72 A;  3U58 A;  1I6H H;  5C4J H;  3A5Z B;  1WI5 A;  2D62 A;  3SGI A;  1YIJ A;  1HNW Q;  3TRE A;  2IY5 B;  1K8A C;  1M90 C;  1N9W A;  5JEA G;  1CAD A;  1K9M C;  5FJ8 G;  4A3L G;  4A3K H;  3J7Z C;  2ATW A;  1HZ9 A;  1V43 A;  3K7A H;  2MNA A;  3BZK A;  4GKJ L;  1IBK L;  4A93 H;  3U4Z A;  2IX1 A;  4YHH L;  2K50 A;  1VQP A;  3HKZ G;  3TQY A;  1X3G A;  2K4K A;  2MFI A;  1VQ4 A;  3Q8D A;  4NXM L;  4IFD J;  3L0O A;  1CSQ A;  2CFM A;  5HGQ A;  4P75 A;  4AYB G;  3RN5 A;  1TWC H;  3CW2 C;  4A4I A;  3AEV A;  1W3S A;  2NN6 I;  3HOU G;  4L5R C;  3A5U A;  1YK5 A;  3AFQ A;  4IOA A;  3ZJY C;  1TXY A;  4LFA Q;  1KIX A;  5IYD H;  2B29 A;  1MKH A;  1VS0 A;  2NN6 G;  4QJF A;  5HY6 A;  2VQE Q;  2WP8 J;  4C3I H;  5IT9 c;  1HR0 W;  1XNQ L;  3J7A 5;  2IHF A;  3RZT A;  3NEM A;  1LYL A;  4L5Q A;  4BY1 G;  4DR6 Q;  4A3C H;  2ZTE A;  4JCV E;  2PI2 A;  4DNI A;  3S16 H;  3W1B A;  2ZJR A;  2EIF A;  1VQH A;  2PMZ E;  3UDX A;  3GTM H;  2K2D A;  3RZO H;  3M85 A;  1OTC A;  3I4M G;  4GN4 B;  1BVS A;  4BY1 H;  3H15 A;  1VQA A;  2UUB Q;  1SE8 A;  1AE2 A;  2NZH A;  1YV1 A;  1AE3 A;  2WB1 G;  4R4I A;  4JBK A;  1Q1E A;  3HOW G;  4DV3 L;  4A3E H;  1I94 L;  3CPF A;  1SLJ A;  2VL6 A;  2HIV A;  2Z6K A;  4DUZ Q;  3CCM A;  4R4Q A;  4DUY Q;  4IFD G;  2KN9 A;  4JG2 A;  4X66 L;  1PV4 A;  4AQY Q;  3CF5 A;  1IRO A;  3ULL A;  1G51 A;  3AYH B;  4GNX C;  1W2B A;  1TWF H;  4IFD I;  1E1T A;  1BBU A;  3KLW A;  4MNO A;  4GN3 B;  3I4N G;  2UXC L;  5RXN A;  4YWL A;  5ELN A;  1XNR L;  2H5X A;  5C44 H;  2JA7 H;  2BA1 A;  4QQB X;  1CAA A;  1PFS A;  4LF8 Q;  2XGT A;  2VUM H;  2GVB A;  4NPS A;  4UP7 A;  3EIV A;  5E7N A;  3PV0 A;  3OTO L;  4DV0 L;  4GNX B;  3KYW A;  4AQY L;  4JI2 L;  4JI7 Q;  3HOY H;  2VQF L;  3D0F A;  4YWK A;  3JC6 6;  2N78 A;  2E2I H;  3RLF A;  5FLX c;  3S2H H;  2R7D A;  1Q86 C;  2NVY H;  1B2J A;  4IPD A;  2NVQ H;  1S2Z A;  1TWA H;  2UXC Q;  2CWP A;  4DAM A;  2ASB A;  1T9P A;  1P16 A;  1PHJ A;  3GTP H;  4GLA C;  3NBH B;  1J5E Q;  4A3M H;  3PO3 G;  3HKZ E;  5LMU Q;  3GDE A;  4DR5 Q;  1N36 L;  2BH2 A;  4IJL A;  3BJU A;  2YTX A;  1E7Z A;  2N49 A;  1G6P A;  1VQE A;  1L1O A;  2CQO A;  4DR2 Q;  2V3B B;  1VCX A;  1H95 A;  1N8R C;  1EOV A;  4RG1 A;  1RDG A;  4PZ7 A;  2VQE L;  2B3G A;  2GVA A;  4DUY L;  4DV7 L;  3T1H L;  2Q2T A;  1SRU A;  4LFA L;  3GTO H;  3A44 A;  1ZRP A;  3PO3 H;  4Y52 H;  1PA6 A;  4LUO A;  2KCT A;  1IRN A;  4DV4 L;  2HT1 A;  1HNZ L;  5K36 G;  5M3F H;  2E5L L;  2M4Y A;  1VQD A;  3HOX H;  1JB7 A;  1OXS C;  2UUB L;  4K9F A;  2KBN A;  1VQ9 A;  3JC6 2;  3GTQ H;  2LCQ A;  1PYS B;  4JI4 Q;  4XIG S;  1KC8 C;  4AR5 A;  3JAM i;  3GTJ H;  2QL0 A;  1HZC A;  1M1K C;  4AH6 A;  3J81 c;  4C3J H;  1X54 A;  4YCV A;  3E0E A;  4JV5 L;  1SMM A;  4KHZ A;  3TRZ A;  4A3I H;  3G71 A;  2I5H A;  5C0X J;  4PG3 A;  1IBL Q;  5GAE C;  2A19 A;  1NY4 A;  2WFW A;  1PH7 A;  2OQK A;  1JE5 A;  2R92 H;  3CCV A;  1MJC A;  1K8G A;  1LKM A;  4DV5 L;  4HIM A;  3FKI H;  3S24 A;  1YIT A;  2B63 G;  4A76 A;  2VZA A;  4JI3 Q;  4DV1 Q;  1PH3 A;  2R7Z H;  4B3R Q;  3U4V A;  2HQL A;  4ME3 A;  2GN5 A;  4AR3 A;  2DUD A;  3KOJ A;  4DV2 Q;  3VDY A;  4AR4 A;  2B63 H;  1PH8 A;  2R92 G;  2MO1 A;  5M3M H;  1Q81 C;  2EXD A;  4A3E G;  2AMC B;  2OCE A;  4X62 L;  4Y7N H;  3CAM A;  2UUC L;  2RDV A;  4JBM A;  4DV1 L;  3FHW A;  1KHI A;  2LXJ A;  1EQR A;  1SMW A;  4DAY B;  2JA5 H;  2JA7 G;  1HNW L;  3S1Q H;  2L15 A;  3TS2 A;  4EX5 A;  1Q12 A;  3I4N H;  1OXU A;  4GNX A;  2N3S A;  1VQ6 A;  2Q2U A;  4GN5 A;  4P71 A;  3K8A A;  4JV5 Q;  5H1S E;  5BR8 Q;  2JA9 A;  1NNQ A;  5JEA J;  2EQS A;  4A75 A;  1XMO L;  1EWI A;  4C2M H;  2R6G A;  2Q2H A;  4A3D H;  1H7V A;  1TWG H;  1JJ2 A;  1HR0 L;  3S1M H;  4OXP A;  3UE0 A;  4DKA C;  1KRS A;  4HJ5 A;  4DR1 Q;  1PH6 A;  1YJW A;  2QGQ A;  3KYY A;  2IHE A;  5AJ3 Q;  1Q8K A;  3RLO A;  3CP0 A;  1HJP A;  1EYG A;  1SRO A;  1C09 A;  1I50 H;  4IOC A;  4WJ3 M;  1VQF A;  3J80 c;  1PYB A;  1L1O C;  1NTG A;  3CCR A;  5IY0 A;  4BA1 I;  4POF A;  5AJ3 L;  4GOP A;  4DR5 L;  2JA8 H;  2AWO A;  2ZTD A;  1PH5 A;  5DLQ E;  1YJ9 A;  1C7Y A;  3HOV G;  1C0A A;  2ZM6 Q;  3KF6 A; 
#chains in the Genus database with same CATH topology
 3H97 A;  3K80 C;  1ASY A;  4UP9 A;  1F9S A;  4LF9 Q;  3S1N L;  4K5W A;  1CK1 A;  4O1N A;  3CXC A;  4BXX H;  1EYA A;  1D5M C;  1GUO A;  1KQS A;  3HOZ H;  2A1A A;  1JQY D;  3K57 A;  1XMQ L;  3H3V I;  1UEB A;  5COR A;  4NKL A;  2Q8R E;  1S5E D;  5JAV A;  4DV6 Q;  4FXK C;  1PZI D;  3UDG A;  1GXD C;  1RIP A;  3EN2 A;  5IYB L;  2JYO A;  4DR6 L;  1AH9 A;  1C9O A;  3QIA A;  4NP5 A;  2Z6B A;  1XTD A;  2F3I A;  3RZ6 A;  3GTJ L;  3PIP 1;  2VB3 X;  4A3C G;  5MFP A;  3VPB E;  2HCI A;  4OL7 A;  1HFG A;  4R8I A;  2YU9 H;  3QOJ A;  2L0Z A;  2L11 A;  3A74 A;  3VA7 A;  5CBA E;  4HID A;  4EQP A;  3S14 H;  4BBR H;  1GVP A;  4A3D G;  4JPB W;  2ENB A;  4DR7 Q;  4X3S A;  3X3N A;  2WAQ G;  5IGB A;  2R93 L;  2D9U A;  1PH9 A;  4K5X A;  1BQQ T;  3MWY W;  1OWC A;  2QA4 A;  2LY7 A;  5FJ8 H;  5IOD A;  4DFA A;  4KD3 A;  2K52 A;  4U67 1;  1E8J A;  2KEC A;  5IWA L;  3BZC A;  4HSV A;  1A2U A;  5M5Y L;  2PQA A;  3VR6 A;  2RDG A;  5FK9 C;  1PZJ D;  1CHP D;  1K0R A;  3PO2 B;  1RD9 D;  4V0B A;  4E6Y A;  2PNH A;  5EAY A;  3GTM L;  5M3F B;  3HKS A;  2EYM A;  2K03 A;  3DWA A;  4GKK L;  3CQZ B;  4J15 A;  5M5X L;  2YU9 L;  2B2W C;  3U50 C;  2G5D A;  3F8T A;  3HOZ B;  3OMG A;  5LMU L;  3P1H A;  1QCB D;  1S5C D;  1NE3 A;  1ENC A;  4NB3 A;  3VYS A;  3PO2 G;  4H13 C;  4JW0 A;  1I4H A;  3KJP A;  3HOW H;  1PYW D;  2UUA L;  1HRJ A;  4A3E B;  4P73 A;  5L37 A;  1X3F A;  1Q1B A;  1PRT B;  3K0Y A;  1JYB A;  4AR6 A;  4CDF C;  3H9C A;  1ESF A;  5AI3 A;  4ULL A;  4X62 Q;  4Z9C B;  4IUV A;  1SYD A;  1WTQ A;  1QB5 D;  4ZAI A;  2O5I C;  1B50 A;  5E4X A;  1DZ1 A;  4RFB A;  4OWW B;  2Z6K C;  5ISR A;  2XJQ A;  2LKV A;  5JJI A;  3PZA A;  2AHO B;  4BXX G;  4K0K Q;  5EPL A;  2OXP A;  4FDB A;  2K32 A;  1F77 A;  3GTK B;  5C4H A;  3MVV A;  3M7N A;  2BCO A;  3BYT B;  2UUC Q;  5LL6 S;  1VZH A;  4A3J H;  5CV6 A;  1JOQ A;  3D8G A;  4A3M B;  1X3Q A;  1JWM D;  3RR5 A;  2F0D A;  3PO3 L;  1N34 Q;  3RZD H;  1SE4 A;  4QCL A;  1SMX A;  5M9O A;  3KLS A;  5IP9 H;  3H0G G;  1VMP A;  3W1G A;  5C4X G;  2WAQ P;  1WYD A;  3KF6 B;  3F2D A;  4GOP B;  1PLF A;  4A3M G;  4R4T A;  3LPE B;  2F0Q A;  1KAB A;  4DN4 M;  2ES2 A;  2PPT A;  5CV8 A;  4R1J A;  1A15 A;  1CZG A;  4LUZ A;  3MXN B;  4ODG A;  4B3S Q;  1N33 Q;  3TN2 A;  2FMM A;  3GD7 A;  3VR2 A;  1XTC D;  2RHS B;  3QO2 A;  4X65 Q;  4B3M Q;  3HOU H;  5CBE E;  2PW5 A;  3N6R A;  2FHT A;  2JN4 A;  4K6L A;  4CJ1 B;  1S5F D;  1QZH A;  3P20 A;  3S15 L;  1PFY A;  3RZO L;  4WFN 3;  3PF4 A;  1W6K A;  4N9P A;  3X3M A;  1RB9 A;  4LJZ C;  1IHZ A;  3CCU A;  4DU9 A;  3I4O A;  3Q0A A;  3OW2 A;  4DA2 A;  3HS0 C;  4C2M B;  3E9H A;  4DV0 Q;  3NE5 B;  4CJ0 B;  5JJK A;  1LKP A;  1GKH A;  2D0P A;  2VUM G;  4DGZ A;  3HGB A;  5FO8 B;  3T56 B;  2F0J A;  1GHJ A;  1SYE A;  3IFT A;  3OOC A;  4A3D B;  1Q82 C;  1LM0 A;  2HUG A;  2X6L A;  2HHH Q;  1ODH A;  5DAU A;  1QYB A;  8RXN A;  5ELB A;  4TVA B;  3OSO A;  4BY7 H;  3R3O A;  2SNS A;  4DV5 Q;  1I6H L;  3PO2 L;  3D31 A;  2NVT H;  2B2Y A;  2Z3Q B;  2Q8T A;  1VQG A;  1I4Q A;  2RVL A;  1YNX A;  1EY9 A;  1B9N A;  3DWP A;  3HJY B;  5IYC G;  3LWP B;  3JR7 A;  4LK1 C;  1MSH A;  2K14 A;  3GTQ L;  2ZT9 C;  3RN2 A;  4A3F H;  4JI8 L;  1LTS D;  1SDF A;  2R7Z G;  1XMQ Q;  2K5H A;  1IBL L;  2XRS D;  3J7A F;  4JI0 Q;  3OIP A;  4OX9 Q;  1SMU A;  4F8M A;  2MUY A;  1S30 A;  3UE1 A;  3HOU B;  4JAF A;  3V2T A;  3OW7 A;  1STY A;  2B63 L;  2MGS A;  1R4P B;  2WII B;  3URY A;  4C3J G;  2XTI A;  2R7Z L;  1YI2 A;  1GM5 A;  3GTG L;  2AQ1 B;  4BBR L;  2P5Z X;  4L5T A;  3KJO A;  3NQT A;  2PI2 E;  1SFO H;  2E2J H;  1UE1 A;  2F0W A;  5J22 A;  2R61 A;  1F2L A;  4LF6 Q;  5GAH C;  2BOS A;  5C4J L;  1EY6 A;  5K36 H;  1A3T A;  2EYH A;  1BCP B;  1ASZ A;  1B8A A;  1CSP A;  4IO9 A;  3K7A L;  4G6B A;  1VQN A;  3S15 H;  1J8I A;  4KY7 A;  2PVX A;  3GTL L;  3NK9 A;  1B3A A;  2L9H A;  3STB D;  1B71 A;  4DR4 Q;  4RKL A;  2DY8 A;  2UUA Q;  2F0G A;  4PMW A;  3PUX A;  1HA5 A;  3M9B A;  2M4V A;  5CV4 A;  2WAQ B;  2VW9 A;  1FHM A;  3NHH A;  1HUN A;  2O4X A;  1I4R A;  2JK8 A;  1YZ6 A;  2OEO A;  3HAX C;  2Z4H A;  4FP5 D;  4OIJ A;  1RKN A;  1VQJ A;  5IP7 H;  5A2Q L;  1OXT A;  3KYH C;  4DUZ L;  1EYD A;  1LUZ A;  4DV2 L;  2PNR C;  1FNV A;  1RCV D;  5G3L F;  1YHB A;  3A7A B;  2NB0 A;  2A69 D;  1WCM G;  3UDI A;  3H3V H;  1KLU D;  3U58 A;  3I70 A;  5C4J H;  2D62 A;  1TWH L;  1EIG A;  1HNW Q;  2IY5 B;  1N9W A;  3I72 A;  2N88 A;  1V43 A;  2NTT A;  3K7A H;  1DM0 B;  2NVT L;  2K50 A;  3HKZ G;  3TBI B;  3C46 A;  1I4G A;  1X3G A;  3MHB A;  1HQR D;  2HVY C;  2CFM A;  4A3D L;  3N52 A;  3RN5 A;  3HOU G;  1AP0 A;  3HOX B;  2EOT A;  3A5U A;  3AFQ A;  1YK5 A;  2XJR A;  1TXY A;  1KIX A;  5IYD H;  4WOR A;  4KN7 C;  5HY6 A;  3J7A 5;  2A5H A;  2I46 A;  4IZ8 A;  4JCV E;  4DNI A;  3S16 H;  3NPP A;  2R92 B;  2Z4I A;  3M85 A;  3H15 A;  1AE2 A;  4R4I A;  4JBK A;  1EL0 A;  2DN8 A;  4DV3 L;  2NYD A;  3GTO B;  3LWQ B;  1JOR A;  2XJS A;  2TMP A;  4K8J A;  1PV4 A;  3ULL A;  4MNO A;  1V1P A;  2OF1 A;  5RXN A;  4YWL A;  3S1R L;  4K2L A;  2BA1 A;  2EDG A;  3RZD L;  1TS4 A;  3TME A;  4DV0 L;  5E7N A;  3EIV A;  3PV0 A;  4GNX B;  4JI2 L;  3G6J B;  2EJF C;  2EZV A;  2FFK B;  3JC6 6;  3QWN A;  2N78 A;  1NSN S;  5JEA H;  4KKU A;  5C3X A;  4A3F B;  5FLX c;  3HOV L;  4XXB B;  3LX0 A;  1B2J A;  3BS1 A;  1TWA H;  5KGU A;  1QG7 A;  4DAM A;  2KOL A;  2MP1 A;  3BVM A;  1R4Q B;  1I3Q L;  1BO0 A;  1I50 B;  3BJU A;  2N49 A;  4BY1 B;  5TSS A;  4DR2 Q;  1MSG A;  2NZ1 D;  4BBS B;  4CDD C;  1RDG A;  2F0F A;  2GVA A;  4DV7 L;  4BXX L;  1FR3 A;  4Y52 H;  1ZRP A;  1GUG A;  2HT1 A;  1IRN A;  2PPB C;  4LHL A;  4X3T A;  1VQD A;  4ZN1 B;  2NN6 H;  1CM9 A;  3TP6 A;  5D3I B;  4C56 C;  1VQ9 A;  2KVM A;  2LCQ A;  3HOV B;  2RQX A;  4AH6 A;  1X54 A;  3IL8 A;  1SMM A;  4KHZ A;  1MHW C;  4PG3 A;  1IBL Q;  2A19 A;  5M5W L;  2OQK A;  1JE5 A;  1TVX A;  4A3K B;  3FKI H;  1SE3 A;  3ZG6 A;  4UAI A;  3D6W A;  1O7Z A;  3KF8 A;  1HTL D;  3U4V A;  2HQL A;  2DUD A;  3VDY A;  3K5O A;  3CAM A;  2RDV A;  4DV1 L;  3PIP 3;  2JA5 H;  1Q3L A;  3S1Q H;  1GUT A;  3I4N H;  1OXU A;  3JAM E;  1JOK A;  2ICE C;  5H1S E;  5BR8 Q;  1STE A;  2K33 A;  1XMO L;  1KDA A;  1PRT C;  1JJ2 A;  4N9T A;  4M1U B;  1KRS A;  2XJT A;  4ZUI A;  5E1F A;  4JAE A;  3HP3 A;  2GA4 B;  1YJW A;  1U4R A;  5AJ3 Q;  1B1Z A;  1MGS A;  1Q8K A;  1TS5 A;  1HJP A;  4TSS A;  5M3M B;  1I50 H;  3OWE B;  2BE5 D;  1H9M A;  2X69 A;  5CC4 A;  3AMU A;  4POF A;  3NP8 A;  4EQO A;  1Y8O B;  2JA8 H;  1SE2 A;  2AWO A;  3SK4 A;  1C0A A;  1PZK D;  2SDF A;  2QEX A;  1B70 B;  2IL8 A;  4QIW E;  3OMC A;  4V19 6;  4ID6 A;  1LTT D;  2X6G A;  2JA6 H;  1X6O A;  3K5M A;  3Q24 A;  1XMO Q;  4GLX A;  2A8V A;  4FF2 A;  2M00 A;  4LF4 Q;  2NVY B;  1NAP A;  1Y1W H;  1LKO A;  3I7F A;  4GLV B;  4CBV A;  2K5V A;  2JE6 I;  1R0J A;  4RH6 A;  1O78 A;  2A73 B;  1EFI D;  2LFN A;  3J81 j;  2NTS A;  4S3S A;  3P7J A;  2JEA I;  3IKJ A;  3A8K E;  3QR8 A;  4ALP A;  4H7B A;  1GUS A;  3S2H L;  4OO1 G;  4JI3 L;  2OWO A;  1O7I A;  3W5O A;  3KDF A;  1JE4 A;  5MFZ A;  3A56 A;  4P74 A;  4C3H H;  1N34 L;  3LWE A;  1B9M A;  1KDC A;  3MEH A;  2XSC A;  3FRP B;  4XXE A;  4JVZ A;  2NVY L;  3GTJ B;  3P8B A;  4PNY A;  1CFM A;  1T9O A;  4XT3 B;  2CWA A;  3CU7 A;  2KEN A;  3FMC A;  3I91 A;  2J7Z A;  5BN3 A;  3GO5 A;  4LF5 L;  1G2T A;  1K3B C;  4QMG A;  4DV6 L;  3IRB A;  4BBS H;  5CV5 A;  3CCL A;  3AB9 A;  3I3C A;  1HNZ Q;  4IJH A;  1X65 A;  1KRT A;  4A3L H;  4X64 Q;  4JI1 Q;  5LMN W;  1N32 L;  1AFP A;  4O2D A;  2F4V Q;  4JI4 L;  5IE8 A;  2IW3 A;  5EBD A;  1V8Q A;  4LF9 L;  1FJG Q;  4KKT A;  1JWS D;  2VNU D;  3CC2 A;  3HOY L;  4CKC A;  1STH A;  2APO B;  4ZYS A;  2J4X A;  4IFD H;  1X9N A;  4YY3 Q;  1RDV A;  3LNN A;  1UWV A;  3FDT A;  3EBE A;  3JC6 3;  1MI2 A;  2E2I L;  3F2U A;  4DV7 Q;  2OTJ A;  2WB1 P;  2KHI A;  1GUW A;  1DVB A;  4QUF A;  2MQH A;  3GTK H;  2XJP A;  1TWG B;  2H4O A;  2IX0 A;  4YY3 L;  5M5W B;  2AQC A;  4BBR B;  1EU3 A;  4MN3 A;  4PZ6 A;  2E8G A;  1ENF A;  2K7V A;  4KN4 C;  1BCP C;  1BRF A;  1NXE A;  5FLX L;  2IWH A;  1FJG L;  5J3B A;  2F4V L;  5AI2 A;  1STB A;  1A0I A;  1PH1 A;  2ICI A;  1KL9 A;  1E3P A;  5JVG 3;  1EQQ A;  1SAP A;  5GQO A;  4UY8 1;  2PSM C;  4FO2 A;  4XT1 B;  4A3I L;  2M9V A;  2QIL A;  5CV9 A;  1A62 A;  2NVX H;  1QNU A;  3MXP A;  1KD1 C;  4C3I B;  3SEB A;  1B3Q A;  4X64 L;  3VR5 A;  4HSP A;  5M5X H;  2LSS A;  5FOB B;  3VYR A;  3W3A A;  2OTL A;  2RFK B;  5EKI A;  2MHV A;  3H99 A;  4JI8 Q;  2M2L A;  4F87 A;  4F7X A;  3TP7 A;  4A3G G;  4HED A;  4JOI A;  1NR4 A;  3F2C A;  2F0E A;  3CCJ A;  1TR5 A;  2YYZ A;  2MO0 A;  2KKD A;  4A3F G;  4YHH Q;  4ZLT F;  5A35 A;  3CCS A;  2BE5 C;  2PCF B;  1SJH D;  2CR8 A;  1K28 A;  4R9W A;  5LMN L;  3D4D A;  4TVM A;  1F2Z A;  4KI0 A;  4TQU S;  5CV7 A;  4WJ4 A;  1X3E A;  3MXG A;  4HIK A;  2VUM L;  2KED A;  4FXG C;  1K83 H;  4NXM Q;  3DXJ C;  4DV4 Q;  5IYC H;  1JC7 A;  3KK7 A;  3U9S A;  2F1M A;  1YEZ A;  4A3B H;  1SYC A;  5IIF A;  4HN7 A;  1HZA A;  4GKJ Q;  1L2F A;  2F0L A;  2XIW A;  5FLM H;  1N36 Q;  5T1G A;  3J7Z 1;  1BQ8 A;  4KTA A;  4L5S A;  4LF4 L;  2WIN B;  5NUC A;  3S15 B;  3PUZ A;  3GTG H;  3TSS A;  3VR4 A;  1U4M A;  2UXD Q;  5FLM G;  4N8X 1;  3MZ5 A;  1NMF A;  2XJU A;  2HIX A;  3BDC A;  2B2Y C;  2ID0 A;  2EXZ A;  1WOC A;  2G9H D;  3S17 L;  3GTP L;  5EKL A;  5I6W A;  5KND A;  4QUC A;  4XYO A;  1G29 1;  1EZ8 A;  3CHB D;  3MTS A;  5C3E H;  3HEJ A;  4ZRZ A;  3H9B A;  4A3J L;  4AYB E;  3H0G B;  3H6M A;  3K35 A;  1H9K A;  1VQC A;  4RGN A;  4DR3 L;  1DGS A;  1ET9 A;  1E0B A;  4JI7 L;  4K5V A;  1L0W A;  2QKI C;  4JI6 Q;  2CCZ A;  2V4D A;  4LWC A;  4A93 L;  4PZ8 A;  4R4C A;  1S5D D;  4AI3 A;  2JQO A;  2JEB I;  2GMG A;  1HPC A;  3G4S A;  4DK0 A;  3NSW A;  2R7F A;  2E2H H;  1TWF B;  1VZI A;  1TT2 A;  3ZYY X;  4GS7 D;  2N55 A;  4MTN A;  2EPB A;  4BY1 L;  3V96 A;  3F2B A;  1CA6 A;  4A3B G;  1I5F A;  3NXW A;  2Q2I A;  1A63 A;  5C0X G;  1BBW A;  1U9R A;  2CW0 D;  2PW7 A;  1BCP F;  4RA8 A;  2O5J C;  3JAM c;  5C3E L;  1PRT D;  5C0X I;  5I6Y A;  3PIO 1;  4M8A A;  1IU5 A;  4A3G B;  1U0L A;  1TWC L;  3KLR A;  1EEF D;  5IYD G;  4K0K L;  1IKM A;  1QE6 A;  3NEN A;  1PTO C;  4HAE A;  5FO7 B;  4IAL A;  2PQE A;  1STG A;  3T53 B;  1SXT A;  4POG A;  1ENA A;  1EWH A;  3NBH A;  2D0O A;  2K75 A;  2NZO A;  4BY7 B;  4AYB B;  5KYL A;  2Z0S A;  2NWG A;  3CC4 A;  1SEB D;  3NEL A;  1XX8 A;  1Z47 A;  2CKZ B;  4B8C D;  5GAG C;  3TZU A;  2ALY B;  5ELD A;  2ZIX A;  3S17 H;  1WJJ A;  2XWB B;  4DK6 C;  2J9U B;  4DR2 L;  3MPS A;  1KTK A;  3HOW L;  1CKM A;  2KA7 A;  5J1Z A;  3I4M H;  1TQO A;  1NXG A;  3HJW B;  5K2M E;  1XPU A;  3D3R A;  5BN5 A;  1WTH A;  5M3F L;  3GTM B;  4LFC L;  1EQV A;  2F52 A;  2Y0S E;  3VYU A;  5C4Z A;  4A3I G;  4K6D A;  4DR3 Q;  4ME5 A;  3ICE A;  4OIK A;  5IGC A;  3GQB A;  5FO9 B;  3MAQ A;  4JI6 L;  4JYA Q;  4PMB A;  1Y1V L;  4RMF A;  1B7Y B;  4JI2 Q;  5KRU A;  1VQB A;  3K58 A;  3NWS A;  3T13 A;  2VUM B;  2R93 B;  2XVS A;  1TWH B;  4A3B B;  1PFV A;  1F4L A;  4H02 A;  3ULP A;  5D65 A;  1G2S A;  1RWD A;  1B53 A;  2JA5 G;  2DNE A;  5I9O A;  3PUV A;  1VQM A;  2JI3 A;  2KHS A;  4A3I B;  1VMC A;  1V9P A;  2HDL A;  2L0C A;  1S72 A;  1MJE A;  3SGI A;  4Y52 L;  1ML0 D;  4RKB A;  3I4L A;  3PMF A;  5EPK A;  1RTO A;  2EJM A;  4A3L G;  1P7P A;  4ZKB B;  3J7Z C;  4FXD A;  2NUC A;  3WOE A;  5LHY 1;  4GKJ L;  1V1O A;  1DYQ A;  3BZK A;  2TSS A;  4YHH L;  2A74 C;  3LWU A;  1VQP A;  3H0G L;  4IQZ A;  3ONA B;  5C44 B;  1AZQ A;  3D4R A;  4B08 A;  4NXM L;  1XYI A;  4KKS A;  4AYB G;  2LS0 1;  1TWC H;  3CW2 C;  2FJ2 A;  4A4I A;  3J7A V;  3ND8 A;  4FYD A;  4TKO B;  1OO9 B;  2B29 A;  1MKH A;  2VQE Q;  4KHP L;  4QJF A;  5JPM C;  1HR0 W;  1XNQ L;  5G3L D;  2NVX L;  3RZT A;  2XN9 C;  1A6X A;  4DR6 Q;  4XGH A;  1BCP D;  5C4J B;  1SYB A;  2B2U A;  2PMZ E;  3UDX A;  2K2D A;  3RZO H;  1OTC A;  1BVS A;  1WVL A;  1SE8 A;  5M5Y B;  1AE3 A;  5C4X L;  4CDE C;  1Q1E A;  4EVO A;  4RGM A;  3HOU L;  1I94 L;  2XWJ B;  2B63 B;  4DUZ Q;  3CCM A;  2L4N A;  3A55 A;  2KN9 A;  4X66 L;  1Y69 U;  3CF5 A;  3AYH B;  3GV6 A;  4IFD I;  4PMC A;  3I4N G;  4GN3 B;  1YNN C;  2UXC L;  1XNR L;  5ELN A;  1QNK A;  2EJG C;  2JA7 H;  2DY7 A;  1CAA A;  1PFS A;  3FVQ A;  2VUM H;  4C3J B;  2GVB A;  2EYJ A;  4NPS A;  3H3V M;  4AQY L;  1RDP D;  3PIO 3;  4YWK A;  2Z1C A;  3A8J E;  3C1E A;  4DXF A;  3S2H H;  2R7D A;  2NVY H;  2EY4 E;  1RJT A;  4RHS A;  3R93 A;  1Y1W B;  2F0I A;  2UXC Q;  1DD2 A;  3SDZ A;  3GTP H;  1SMY D;  2L5T A;  3NBH B;  5LMU Q;  3GDE A;  3RMH A;  2BH2 A;  5HUR A;  2ERS A;  5DNF A;  4A3M L;  1H95 A;  1N8R C;  1EOV A;  4PZ7 A;  4LFA L;  1K8M A;  1PA6 A;  1ILP A;  1HNZ L;  5K36 G;  1EY8 A;  4NMZ A;  1JB7 A;  1OXS C;  4JI4 Q;  4XIG S;  5E4W C;  3OPO A;  3J81 c;  5MLC 3;  3E0E A;  2B2T A;  4HMI A;  5DM7 3;  1IW7 C;  5C0X J;  1PTO F;  1PH7 A;  2IPK D;  3RZO B;  3CCV A;  1LKM A;  2F0P A;  1TKW B;  2NBF A;  3KOJ A;  4ME3 A;  2B63 H;  4IUR A;  4AR4 A;  1HA6 A;  1PH8 A;  2RA4 A;  5M3M H;  1Q81 C;  4A3E G;  4JBM A;  2AMC B;  4X62 L;  3Q23 A;  1EOT A;  3FHW A;  5KYI A;  1PFM A;  2LXJ A;  2H12 A;  3LWO B;  4DAY B;  2JA7 G;  1F9P A;  2L15 A;  4HTH A;  4ABN A;  1GJX A;  3MSU A;  4GNX A;  2N3S A;  1QOH A;  1LV9 A;  1QJO A;  3M3Y B;  2JP1 A;  4KJO A;  1NNQ A;  3TDQ A;  1HCZ A;  1YNJ C;  5JEA J;  1EWI A;  4C2M H;  1UAP A;  1HR0 L;  3S1M H;  3UE0 A;  5DM6 3;  1B44 D;  2QGQ A;  4KD4 A;  3FKI L;  1EEI D;  4DXG A;  1PFN A;  3CP0 A;  5EKK A;  4HCS A;  3EFX D;  1FNW A;  1SRO A;  2RDF A;  2Z9H A;  2Z8L A;  4WJ3 M;  4F88 A;  3OWF A;  3J80 c;  3R8B A;  3CCR A;  5AJ3 L;  1IYU A;  2ZTD A;  3ITP A;  5KEE A;  1PH5 A;  1C7Y A;  3G7L A;  4CKE A;  3V05 A;  3K59 A;  5IWA Q;  3BVZ A;  2AUK A;  4DPG A;  3KYU A;  2XNA C;  2EYL A;  3K0X A;  1PVO A;  4FF1 A;  1N33 L;  1S24 A;  1S5B D;  5BR8 L;  4BBS G;  1S3O A;  1SNM A;  1LO5 D;  3MFY A;  3QJY A;  1KNE A;  4KLK A;  1BQ9 A;  5JJZ A;  3OYY A;  3U9O A;  1EQT A;  2E75 C;  1VF5 C;  1UEA B;  1VDZ A;  1AN8 A;  3CME A;  1A8V A;  2BA0 A;  1HZB A;  4XTC S;  3E5S A;  5I9P A;  1YHA A;  3BG3 A;  2E2J B;  2OT2 A;  3PCO B;  3TP5 A;  1Q90 A;  1Z9F A;  1WTV A;  1PH4 A;  1GO3 E;  2PO4 A;  5C0X H;  1CKN B;  2RSN A;  4Y7N L;  2M6O A;  1I4X A;  2Y0S P;  3DWQ A;  1WD0 A;  3M4Y A;  1WTX A;  1NMG A;  1F9Q A;  5K5P A;  3S1R H;  1KAW A;  2E5L Q;  4G57 A;  2R7Z B;  4OWT B;  2YTY A;  2RKS A;  5C44 G;  4XQN A;  1LTR D;  2KHJ A;  5ELE A;  4JC0 A;  1T9H A;  1PDQ A;  2QDB A;  2E2H L;  4CGY B;  5EJW A;  3VR3 A;  3PUW A;  3FP9 A;  2JA8 G;  3K81 C;  5EGT A;  1E22 A;  4QF4 A;  1XPO A;  1C8C A;  1H9J A;  4OHJ A;  2LMC B;  4NXN Q;  1X32 A;  3I55 A;  4J1M A;  1XNR Q;  3PWF A;  1L1O B;  1MBY A;  1EY7 A;  2L1B A;  4LFB Q;  1E2Z A;  1JR0 D;  4Q5V A;  3KFU A;  4HJ7 A;  1GD7 A;  3E9I A;  1EIY B;  2HD3 A;  1HXY D;  1Y8P B;  2Y0S G;  2J0T D;  3I8Z A;  4FVM A;  4JI1 L;  3L2P A;  1N32 Q;  1QWY A;  1VQK A;  3WOF A;  4IPH A;  4KY6 A;  1PZX A;  2EE1 A;  1QVG A;  3T1Y Q;  1IXR A;  1HH2 P;  3SR1 A;  1J9O A;  1F2M A;  1SYF A;  1EFW A;  4OON A;  2Q2U A;  1NJI C;  1ET6 A;  4B3S L;  1MIU A;  5GAE c;  1LTL A;  3PIO A;  3SK8 A;  2K04 A;  4DR7 L;  2AQ3 B;  2YU9 B;  1PFU A;  3ERS X;  4C1N I;  1CA5 A;  2UXB Q;  3KDF B;  2WB1 B;  2EY2 A;  4B9X A;  1R0I A;  1SMY C;  4I65 A;  3G48 A;  4AI0 A;  3MC0 B;  3I56 A;  1IYJ B;  1TS3 A;  5C5L A;  2ZXP A;  3CD6 A;  4A3J G;  4B3T L;  3I4N L;  4O0A A;  3S1M B;  1QZG A;  4AYB P;  3E3X A;  5LMN Q;  4KK7 A;  3C2P A;  1LTB D;  2F0M A;  5C3E B;  1SN8 A;  3CQZ L;  2RF4 A;  2ZJQ A;  4R4O A;  3DEO A;  3AFP A;  3NTH A;  5I2X A;  1OXX K;  4PV1 C;  3VYT A;  5JPN C;  4KMU C;  7RXN A;  3Q22 A;  3Q6S A;  2UXB L;  4RXN A;  4A3G L;  1AEX A;  4C3I G;  3STB C;  1FGB D;  5IP9 G;  3KYX A;  1U5K A;  2HQE A;  4ILW A;  3HOX G;  2L55 A;  2MS3 A;  1CTM A;  3L3O C;  3MQK B;  5EIO C;  2SEB D;  3L7Z C;  3T1H Q;  1RL2 A;  3B6Y A;  5GAH c;  2K5N A;  4C2M 1;  2FMC A;  4K14 A;  3ERQ A;  2KCC A;  3PGZ A;  3I4M L;  4DAV A;  4LFB L;  4WFN 1;  4QY7 A;  4EQ5 A;  4APV A;  3FPU B;  4IUU A;  3HOX L;  3ERO A;  4UHV A;  1BDO A;  1JCK B;  3S14 B;  3PQI A;  4DNT B;  1XWE A;  1JJG A;  2PYA A;  4DAY A;  5IYB H;  4A3B L;  3OTO Q;  3FKI B;  4JBW A;  4JAD A;  2C5C A;  1Y1V H;  2EVB A;  2HCC A;  4JOI C;  1Y14 B;  3OHX C;  1HHV A;  2V1C C;  4LF6 L;  1K83 L;  1JOO A;  2KQ3 A;  4KY5 A;  2JI1 A;  1BKB A;  3PF5 A;  1G8Z D;  1MD2 D;  3KLS X;  3PL5 A;  4BBR G;  1L0X B;  4OX9 L;  1VQO A;  4JI0 L;  2HDM A;  3QG1 A;  1CZW A;  4RGT A;  3LNL A;  3PO2 H;  1R9T L;  1TS2 A;  4C3H G;  1Q8I A;  1BE7 A;  2KEE A;  4UY8 C;  4LW1 A;  5ELC A;  3CQZ H;  5C4X H;  3S1Q B;  4MHE A;  2ZTC A;  4P2C B;  1LT3 D;  1SR3 A;  2F0V A;  2PMZ B;  3M7G A;  5M5X B;  1BNZ A;  1B2O A;  1E1O A;  3H0G H;  1Q7Y C;  1XNQ Q;  3DM3 A;  1WFQ A;  2RDH A;  4ZUJ A;  2WB1 E;  1HNX Q;  2WKD A;  3ULJ A;  2F0K A;  3K7A B;  1Y1W G;  1WCM H;  3M4Q A;  2I07 B;  5KNB A;  1JB3 A;  2HHH L;  6RXN A;  1KXL A;  2OQ0 A;  1NBW A;  2JJQ A;  5CGK A;  4B9W A;  3HOW B;  3SS2 A;  2K05 A;  4YCW A;  3HOZ G;  2ZM6 L;  1LTA D;  4XYQ A;  2UU9 Q;  1VQ7 A;  1K83 B;  3T1Y L;  1PFB A;  1JMC A;  3MEF A;  4IUN A;  4I7A A;  2E76 C;  3CPW A;  1R0G A;  2F3V A;  3E0J A;  1K0S A;  1XPR A;  3AU7 A;  3SK5 A;  1R0H A;  2B2W A;  1Q46 A;  4A3K L;  1XJV A;  4IPC A;  4YWM A;  5KNC A;  4OWX B;  4GKK Q;  4L63 B;  4LFC Q;  3R2I A;  2FXQ A;  1KAA A;  5IP9 L;  4LF8 L;  2CW0 C;  4RAU C;  1WCM L;  1CUK A;  2WV6 D;  4L8J A;  2EY1 A;  2K5Q A;  4HJ8 A;  2UU9 L;  3NWT A;  1CQV A;  1LT5 D;  4KHV A;  4WJW A;  5AFW A;  5ELO A;  1T9Q A;  3UDF A;  3TS0 A;  1IU6 A;  5FKA C;  3DMU A;  5J39 A;  2JA5 B;  1DJR D;  3S9W A;  5I2Y A;  1STN A;  5IP7 L;  2CKA A;  4UPA A;  4GZY C;  1FHH A;  1NNX A;  3TEH B;  5C5M A;  3EA6 A;  1RTN A;  3DHQ A;  1YIJ A;  1M90 C;  1IYV A;  5JEA G;  1CAD A;  1E2W A;  5FJ8 G;  4DNR B;  1K9M C;  1II3 A;  1GOZ A;  1HZ9 A;  1HTP A;  3IFD A;  4QIW P;  1WD1 A;  2C6A A;  2MNA A;  1RHP A;  1WCM B;  4ZKC B;  1NR2 A;  3U4Z A;  2IX1 A;  2CVR A;  4N8F A;  3TQY A;  2B8F A;  3HZX A;  1D1I A;  2K4K A;  3BDL A;  5IGF A;  1SNC A;  4IFD J;  3L0O A;  1CSQ A;  5IYD L;  4P75 A;  3AEV A;  2NN6 I;  2SOB A;  3PKJ A;  3ZJY C;  1S4Z A;  1VS0 A;  2NN6 G;  4LAA A;  1LT4 D;  2WP8 J;  4FNF A;  4BY7 L;  2AUS B;  2IHF A;  4L5Q A;  4K8I A;  3D6C A;  4A3C H;  3W1B A;  2ZJR A;  2EIF A;  4Q0F A;  1DOK A;  3LWR B;  2EYO A;  4IUQ A;  1O80 A;  3BDO A;  4GN4 B;  4RHR A;  1JIC A;  1M4V A;  3HOW G;  3GTP B;  2M6P A;  3CPF A;  1SLJ A;  2VL6 A;  2HIV A;  3NQI A;  3B08 B;  1WTO A;  1CHQ D;  3C1F A;  4DUY Q;  3M4O L;  4KJN A;  5FJ8 L;  1G51 A;  4EQN A;  2CHB D;  4OGQ C;  3KLW A;  4A3J B;  1M8A A;  1F9R A;  3PO3 B;  1B4O A;  2H5X A;  5C44 H;  1WTR A;  4QQB X;  4RWS C;  5T1I A;  2XGT A;  2E2D C;  3D4W A;  2F3W A;  4UP7 A;  4WRD A;  3OTO L;  4JI7 Q;  3KYW A;  4NW2 A;  1T5X D;  3HOY H;  2VQF L;  3D0F A;  3T4A C;  2XRQ D;  4AHY A;  2CH4 A;  1XXG A;  3NTI A;  1G91 A;  4XQQ A;  1DCZ A;  2ASB A;  2IX3 A;  1T9P A;  1EIH A;  4X3U A;  4GLA C;  1VZG A;  3TZD A;  3PO3 G;  2XJV A;  3HKZ E;  5KIX A;  2YTX A;  1VQE A;  2Y0S B;  1L1O A;  2CQO A;  1VCX A;  1IL8 A;  1DOL A;  1F2Y A;  4RG1 A;  2VQE L;  3T1H L;  4B3M L;  2B3G A;  4KHP Q;  1SRU A;  4LUO A;  2KCT A;  4DV4 L;  1VF7 A;  5EBC A;  2M4Y A;  3EVQ A;  3HOX H;  2KBN A;  3HKZ P;  1CT1 D;  3GTQ H;  2FIN B;  2A6H C;  1HZC A;  1D6E C;  1NUC A;  4C3J H;  3MFG A;  2K1B A;  1EYC A;  4A3I H;  2I5H A;  3IU3 I;  4RCO A;  1A2T A;  5ELF A;  1NY4 A;  4AHW A;  2R92 H;  1K8G A;  1H9S B;  4DV5 L;  1YIT A;  1KNA A;  2VZA A;  4JI3 Q;  3KUP A;  1PH3 A;  1SNQ A;  2R7Z H;  2F03 A;  1IKL A;  2GN5 A;  4AR3 A;  4CHT B;  3FDJ A;  1FYC A;  3S1Q L;  2OCE A;  4Y7N H;  2UUC L;  4G4K A;  1SMW A;  3WWL A;  1HNW L;  1PMR A;  3TS2 A;  1SNP A;  4EX5 A;  1Q12 A;  3UI2 A;  2VB2 X;  4X3K A;  4GN5 A;  2WKC A;  3SVM A;  5GAD c;  2NVT B;  4BS9 A;  2R6G A;  1H7V A;  4DKA C;  2F0T A;  4C1N K;  3KYY A;  2A6E C;  2K28 A;  1QIL A;  3MXN A;  3RLO A;  4C3I L;  1EYG A;  1C09 A;  5IGE A;  1G6Z A;  1HFN A;  3SE0 A;  1L1O C;  1PYB A;  5IY0 A;  3S14 L;  4BA1 I;  4U67 3;  5DLQ E;  1YJ9 A;  2E74 C;  1LT6 D;  3KF6 A;  2ZM6 Q;  1SFO B;  1O7Y A;  4GS3 A;  4HJA A;  1ICF B;  3BU2 A;  3NTK A;  1I4P A;  1IBM L;  4NXN L;  2F0H A;  2RCN A;  1V1Q A;  1FL0 A;  1UE7 A;  1LAB A;  4O42 A;  3QOL A;  1YVC A;  3GTO L;  4AHZ A;  3SXH A;  2RSO A;  1JWU D;  2NVQ B;  4A3G H;  3GTG B;  4BA2 I;  4G7O C;  5COY A;  2HR5 A;  4LF5 Q;  2CQA A;  2AKW B;  1Z7T A;  5JVH 1;  4J6H A;  4RGO S;  1P8L A;  1TWA L;  1CI3 M;  2B2U C;  2F0U A;  1O7L A;  5IGD A;  1DX8 A;  1U4L A;  1YK4 A;  5IYC L;  3HG9 A;  4DV3 Q;  1U4P A;  1W6J A;  4OEL B;  3AQQ A;  3HOY B;  5EQ0 A;  1B13 A;  1R9T B;  2QW7 A;  1BOS A;  1SND A;  1YBY A;  1IBK Q;  3HRZ C;  1I3Q H;  4LNQ A;  3QB3 A;  2CH4 W;  4H44 C;  3R2T A;  1IW7 D;  3CCQ A;  4JBJ A;  1NCV A;  1IZ6 A;  4J8Q A;  5LL6 X;  1YJN A;  2JA7 L;  5MF6 A;  2AQ2 B;  3O13 A;  4AI1 A;  4LHN A;  3KBX A;  1H9S A;  1WJV A;  1CKO A;  4BBS L;  1TU2 B;  1K73 C;  3S2D B;  4A93 G;  2K5W A;  1STA A;  1K3R A;  2L12 A;  3PKI A;  3OIQ A;  4UP8 A;  4A3K G;  2ERJ A;  1R0F A;  5JJL A;  2PZT A;  1LAC A;  1QVF A;  3HOV H;  1BFY A;  1ONL A;  4P72 A;  1OWB A;  5DEH A;  4MZ9 A;  3S16 B;  1Y8N B;  3J7Y W;  2UXD L;  3H91 A;  2PQA B;  1QCV A;  2B8G A;  4IUT A;  4FF4 A;  5GAG c;  4V19 0;  3DUZ A;  4HJ9 A;  1QUQ B;  4QL5 A;  2F4I A;  2YV5 A;  2EYF A;  3CC7 A;  1YHQ A;  2I0Q A;  2B39 A;  1DON A;  1LTI D;  1FNU A;  1S40 A;  4YCU A;  2PYK A;  1HR0 Q;  4X6A H;  1FGU A;  1TWC B;  2R93 G;  5C44 L;  1J6Q A;  1ZEQ X;  1IL2 A;  3F1Z A;  3SHL A;  3RNU A;  2KJX A;  5IYB G;  5H1S c;  2A68 C;  3S17 B;  3CRK C;  2AYJ A;  1EIF A;  5M3M L;  2QEJ C;  4ZK9 B;  4ZQ3 A;  2DSX A;  4HIO A;  3CCE A;  4QIW B;  2BDO A;  2JA6 G;  3RLN A;  2I5M X;  1KLG D;  1QVC A;  1VQL A;  1Z92 B;  1YUX A;  2WAC A;  4LMQ D;  5M3M G;  4JAG A;  3WWN B;  3HFZ B;  5D3D A;  5IT9 L;  4E6I A;  1AZP A;  1C4Q A;  2LXK A;  3RYG A;  1TII D;  2R93 H;  3LGJ A;  3S1M L;  3GP7 A;  1TWH H;  3W2D A;  4L6T B;  4AIM A;  1BUV T;  1OXV A;  2B2V A;  2NYZ D;  3I73 A;  4IPG A;  2JA6 B;  3GTQ B;  3S2H B;  3PIP A;  4LF7 Q;  1Y1V B;  1TWF L;  1VQ5 A;  1ICW A;  5FLM L;  4EGV A;  2H1E A;  2F0N A;  4DF7 A;  4C3H L;  1PXU A;  3ER0 A;  4C3J L;  2Q8I B;  4TPU A;  3WWV A;  3MA2 B;  2JI2 A;  4LUV A;  2WAQ E;  3SK6 A;  1VQ8 A;  4A93 B;  2DJG C;  3VA5 A;  4OO1 I;  2G9D A;  1X55 A;  5DM7 1;  1D8L A;  1SSO A;  3K6O A;  1IBM Q;  2JXM B;  3CMA A;  1D5Z C;  1VQI A;  4A3L L;  3GV3 A;  1J5E L;  4DR1 L;  3QVD A;  1L0Y B;  4A3F L;  3S2D L;  1T5E A;  1Y1V G;  2D2C C;  1HUM A;  2RHQ B;  3CRL C;  3FKI G;  4C3H B;  5MGN A;  4HMJ A;  3I4M B;  2NVX B;  2PZW A;  2VY3 A;  3HOY G;  4DAP A;  3A8I E;  2A6H D;  3J81 E;  3S1N B;  1I3Q B;  5EPJ A;  1I94 Q;  1PH2 A;  2I5L X;  1JJC B;  1PTO B;  5C6A A;  3KF8 B;  3QQC E;  2PVE A;  3B0A B;  1QUQ A;  1VCI A;  3JAM L;  3J80 E;  1ZYR C;  2BH8 A;  2QF7 A;  5M5Y H;  4LF7 L;  3M3Y L;  4XDX A;  4X65 L;  1JT8 A;  1YUZ A;  3I2Z A;  1BXT A;  5GRO A;  2A6E D;  2SNM A;  2YTV A;  2EYP A;  1SFO L;  2C35 B;  1RYT A;  4JI5 Q;  2B2V C;  4ZCK A;  4B3R L;  1HNX L;  3A0J A;  2B2T C;  1FD7 D;  2EY5 A;  3PUY A;  1GHK A;  3J81 i;  5D14 A;  5GAD C;  1TY2 A;  3A7L A;  3M4O H;  1ESR A;  3P75 A;  3NFP I;  4JI5 L;  2C6B A;  2AWN A;  2IJ0 A;  4B3T Q;  3KBG A;  5BN4 A;  5DM6 1;  1FVI A;  3RD4 A;  4G7H C;  3GTL H;  1LLR D;  1YNN D;  5M5W H;  4QGU A;  4GOP C;  1K8O A;  5C3E G;  5JOB A;  2DJF C;  4NDX A;  3G6E A;  4YIJ A;  2DGY A;  5IP7 G;  2KUM A;  1EUJ A;  2KCM A;  4BWG B;  2EY6 A;  1UE5 A;  1GUN A;  1CKN A;  5EIN C;  4OEM B;  3J80 L;  3H94 A;  1SNO A;  1ZKO A;  1R9T H;  1V1P B;  2VQF Q;  3PSI A;  4JYA L;  1Z6H A;  3KYV A;  3J81 L;  1D2B A;  2CKC A;  3S1N H;  1YNJ D;  5HGT A;  3WDN A;  3FEW X;  4RCN A;  4XQJ A;  1WTW A;  2B5I D;  3HOZ L;  1B2T A;  5CYU A;  1I6V C;  1E24 A;  2IT1 A;  1X56 A;  3J80 i;  3S2D H;  5M3F G;  2K6A A;  1WTP A;  2N8N A;  2VS1 A;  3K7U C;  1I50 L;  3ND9 A;  4AI2 A;  3DEP A;  5IT9 E;  4DR4 L;  5FLX E;  2JA7 B;  1SJE D;  3LWV B;  1UE6 A;  5F2D A;  4CDC C;  3RUZ A;  2NVQ L;  4DK3 C;  4JK1 C;  2RBM A;  4X66 Q;  3K5N A;  3DLL A;  1DOM A;  3S16 L;  3M4P A;  4IN3 A;  2V0E A;  2ZJP A;  3M3Y H;  2F0S A;  4CKB A;  1I6H H;  2JA8 L;  3A5Z B;  1WI5 A;  3TRE A;  1K8A C;  1UNS A;  1BF4 A;  4A3K H;  2ATW A;  2F0O A;  4FF3 A;  2C9O A;  1IBK L;  4A93 H;  2A68 D;  2QCP X;  3NBI A;  3MXU A;  3P2A A;  3I90 A;  1SYG A;  2MFI A;  1VQ4 A;  1LTG D;  3Q8D A;  3HKZ B;  1H9R A;  5HGQ A;  1W3S A;  1HQM C;  5AN9 H;  4IUP A;  1C48 A;  5JVH 3;  4L5R C;  3BYY B;  4X6A L;  2R92 L;  1D5X C;  5E3F A;  4IOA A;  1AW7 A;  4LFA Q;  3DM1 A;  1D7Q A;  5IT9 c;  3FPP A;  4C3I H;  1EZ6 A;  2D5D A;  1EWC A;  3NEM A;  3T51 B;  1LYL A;  4BY1 G;  2ZTE A;  2PI2 A;  3E6Z X;  4QB4 A;  1VQH A;  1EY4 A;  3GTM H;  2A69 C;  1EY0 A;  3I4M G;  2AUJ D;  4BY1 H;  2UUB Q;  1VQA A;  2K01 A;  2NZH A;  1YV1 A;  3EJI A;  2WB1 G;  2E2H B;  2PZU A;  5A2Q E;  4A3E H;  1CQF A;  1PTO H;  2Z6K A;  1E2V A;  2K5D A;  4ZN3 B;  4R4Q A;  2JSO A;  4IFD G;  4JG2 A;  4AQY Q;  1D1K A;  2MJ8 A;  4TRD A;  1IRO A;  1QQT A;  4GNX C;  1TY0 A;  1W2B A;  1TWF H;  1E1T A;  1BBU A;  4LF8 Q;  4H0L C;  3TRZ A;  5IGG A;  3M4O B;  1TWG L;  2R3Z A;  3J7Y 1;  1ROD A;  3K5L A;  2E2I H;  4I7Z C;  3RLF A;  4U68 A;  4A3C L;  1Q86 C;  4K2K A;  3GTL B;  3S1R B;  4IPD A;  2NVQ H;  1S2Z A;  2CWP A;  4G7Z C;  5CR3 A;  3GTK L;  5C3W A;  2V0F A;  1P16 A;  1SBB B;  1PHJ A;  1BBX C;  2E2J L;  1J5E Q;  4A3M H;  1EU4 A;  4DR5 Q;  1N36 L;  3CKI B;  1EY5 A;  2ZXO A;  4IJL A;  4CJ2 C;  3BVG A;  1E7Z A;  2QDL A;  4Y7N B;  4PQX A;  1G6P A;  3NUC A;  3TP8 A;  2V3B B;  1UUP A;  1BR9 A;  4BY7 G;  2Q2T A;  5I4D A;  4DUY L;  3GTO H;  3PO3 H;  3A44 A;  2JA5 L;  1RF2 D;  5M3F H;  2E5L L;  2UUB L;  4AHX A;  4K9F A;  3JC6 2;  1X3P A;  1PYS B;  1RYQ A;  2O2L D;  1KC8 C;  4AR5 A;  3JAM i;  3GTJ H;  2QL0 A;  1M1K C;  1DXM A;  4YCV A;  3L9A X;  4JV5 L;  1PTO D;  1TWA B;  4HCE A;  3IAY A;  3G71 A;  3BZD B;  5GAE C;  5JVG 1;  2WFW A;  4MIU A;  5CMD A;  2B63 G;  1MJC A;  4DK1 A;  4HIM A;  3S24 A;  3H3V C;  4A76 A;  4DV1 Q;  5IOC A;  2O5J D;  4B3R Q;  2R92 G;  4DV2 Q;  1A3V A;  2MO1 A;  4UDU C;  2EXD A;  2JA6 L;  4R8N A;  2VXW A;  1ILQ A;  3EQL C;  1KHI A;  3A54 A;  1EQR A;  2ZXR A;  1Y1W L;  2JA8 B;  1PRT F;  1VQ6 A;  4P71 A;  1ZXT A;  4A3E L;  3K8A A;  4JV5 Q;  2JA9 A;  4KV6 A;  2E2I B;  2EQS A;  2PMZ P;  2KCN A;  3T16 A;  4A75 A;  3C3L A;  2Q2H A;  4A3D H;  1TWG H;  4OXP A;  4HJ5 A;  4DR1 Q;  2DNC A;  1PH6 A;  1I6H B;  1A3U A;  2IHE A;  1PFW A;  2Z3R B;  4OO1 H;  4HR7 B;  2RCF A;  3H09 A;  4IOC A;  1VQF A;  4MTK A;  1KDB A;  1NTG A;  5C4X B;  3RZD B;  4GOP A;  4DR5 L;  3HOV G;  1ZYR D;  3I4N B;  2MPM A;  2BDN A; 
#chains in the Genus database with same CATH homology
 4GS3 A;  4HJA A;  2QEX A;  3K80 C;  3BU2 A;  1ASY A;  1B70 B;  5IWA Q;  4UP9 A;  4QIW E;  4NXN L;  1IBM L;  4DPG A;  4LF9 Q;  2RCN A;  3KYU A;  1V1Q A;  1FL0 A;  4V19 6;  1UE7 A;  3K0X A;  2JA6 H;  1X6O A;  1YVC A;  3CXC A;  1N33 L;  1XMO Q;  4GLX A;  2A8V A;  1S24 A;  3HOZ H;  1KQS A;  4BXX H;  1PVO A;  4LF4 Q;  5BR8 L;  4AHZ A;  2A1A A;  1XMQ L;  1S3O A;  4BBS G;  3H3V I;  1UEB A;  1Y1W H;  4A3G H;  1LKO A;  3I7F A;  4GLV B;  2K5V A;  4BA2 I;  2JE6 I;  1R0J A;  4KLK A;  1BQ9 A;  4DV6 Q;  3UDG A;  3OYY A;  2HR5 A;  4LF5 Q;  1RIP A;  3EN2 A;  2AKW B;  4DR6 L;  1AH9 A;  5JVH 1;  4A3L H;  1P8L A;  1C9O A;  3J81 j;  3CME A;  1A8V A;  2BA0 A;  2JEA I;  1HZB A;  4XTC S;  4ALP A;  1XTD A;  2F3I A;  3RZ6 A;  1YHA A;  4OO1 G;  3PIP 1;  1DX8 A;  4JI3 L;  1YK4 A;  2OWO A;  1O7I A;  4DV3 Q;  4A3C G;  3W5O A;  5MFP A;  3VPB E;  3KDF A;  3PCO B;  3AQQ A;  5MFZ A;  4P74 A;  1B13 A;  4C3H H;  1N34 L;  1Z9F A;  2YU9 H;  2L0Z A;  1PH4 A;  1YBY A;  3A74 A;  1GO3 E;  4HID A;  1CKN B;  1IBK Q;  3P8B A;  3S14 H;  1T9O A;  1I3Q H;  4LNQ A;  4BBR H;  2CWA A;  2M6O A;  1IW7 D;  1GVP A;  4A3D G;  3CCQ A;  2KEN A;  4JBJ A;  4DR7 Q;  1IZ6 A;  2WAQ G;  3GO5 A;  1YJN A;  4LF5 L;  1NMG A;  3S1R H;  1KAW A;  5MF6 A;  4DV6 L;  3IRB A;  2E5L Q;  1PH9 A;  4BBS H;  3CCL A;  4OWT B;  2YTY A;  1HNZ Q;  1OWC A;  4AI1 A;  1X65 A;  4IJH A;  4LHN A;  1KRT A;  5C44 G;  5FJ8 H;  4JI1 Q;  1WJV A;  4X64 Q;  2QA4 A;  5LMN W;  1N32 L;  4O2D A;  2F4V Q;  1CKO A;  2KHJ A;  2K52 A;  5IE8 A;  1K73 C;  4U67 1;  1E8J A;  1T9H A;  4JC0 A;  5IWA L;  4LF9 L;  3BZC A;  4A93 G;  3CC2 A;  2VNU D;  1K3R A;  2PQA A;  4BY7 G;  3PKI A;  4UP8 A;  4A3K G;  1K0R A;  2ERJ A;  1R0F A;  1X9N A;  5JJL A;  3PUW A;  4YY3 Q;  1RDV A;  3FP9 A;  4E6Y A;  1BFY A;  1UWV A;  2PNH A;  1QVF A;  3K81 C;  3EBE A;  2JA8 G;  3HOV H;  3JC6 3;  5EAY A;  4P72 A;  1OWB A;  4DV7 Q;  1E22 A;  3HKS A;  1XPO A;  4MZ9 A;  4GKK L;  4J15 A;  2OTJ A;  2KHI A;  3U50 C;  1DVB A;  4NXN Q;  2UXD L;  2MQH A;  3GTK H;  2PQA B;  3F8T A;  1QCV A;  2XJP A;  5LMU L;  5GAG c;  3I55 A;  1XNR Q;  2IX0 A;  4YY3 L;  3PWF A;  1L1O B;  1NE3 A;  4PZ6 A;  4NB3 A;  3M3Y H;  2E8G A;  4HJ9 A;  4LFB Q;  1QUQ B;  3PO2 G;  1BRF A;  4QL5 A;  3KFU A;  4HJ7 A;  3KJP A;  1NXE A;  1GD7 A;  2YV5 A;  3E9I A;  1EIY B;  3HOW H;  1FJG L;  5J3B A;  2F4V L;  5AI2 A;  2Y0S G;  4JI1 L;  1N32 Q;  1A0I A;  3L2P A;  3CC7 A;  1PH1 A;  1YHQ A;  1VQK A;  2I0Q A;  2UUA L;  4IPH A;  4P73 A;  1X3F A;  1KL9 A;  1Q1B A;  1QVG A;  1E3P A;  1IXR A;  1HH2 P;  3T1Y Q;  1S40 A;  1EFW A;  1EQQ A;  4YCU A;  4OON A;  5GQO A;  1JYB A;  2PSM C;  4AR6 A;  4UY8 1;  1NJI C;  1HR0 Q;  1MIU A;  4B3S L;  5AI3 A;  1LTL A;  5GAE c;  4X62 Q;  1FGU A;  3PIO A;  2R93 G;  1J6Q A;  4B3M L;  4DR7 L;  1IL2 A;  3F1Z A;  3RNU A;  5IYB G;  1A62 A;  3ERS X;  2NVX H;  5H1S c;  1KD1 C;  2UXB Q;  3KDF B;  4OWW B;  2Z6K C;  2AYJ A;  4X64 L;  1EIF A;  5M5X H;  1R0I A;  2LSS A;  2DSX A;  3G48 A;  4AI0 A;  2XJQ A;  3CCE A;  4HIO A;  2OTL A;  5JJI A;  3PZA A;  1IYJ B;  2AHO B;  3I56 A;  4BXX G;  4K0K Q;  2JA6 G;  3RLN A;  2I5M X;  4A3J G;  4FDB A;  1QVC A;  4JI8 Q;  4B3T L;  3CD6 A;  4O0A A;  4A3G G;  1QZG A;  4JOI A;  3F2C A;  1VQL A;  3M7N A;  1Z92 B;  5LMN Q;  1YUX A;  3CCJ A;  2YYZ A;  2MO0 A;  1VZH A;  2KKD A;  4JAG A;  5M3M G;  4A3J H;  3WWN B;  4A3F G;  4YHH Q;  3HFZ B;  3CCS A;  1SN8 A;  2RF4 A;  2ZJQ A;  4R4O A;  2LXK A;  3RYG A;  3RR5 A;  2CR8 A;  2UUC Q;  2R93 H;  3LGJ A;  5LMN L;  4KI0 A;  4TVM A;  1TWH H;  3AFP A;  4TQU S;  4AIM A;  1N34 Q;  1X3E A;  4HIK A;  4WJ4 A;  3RZD H;  1OXX K;  1OXV A;  1SMX A;  4IPG A;  1K83 H;  4NXM Q;  3PIP A;  5IP9 H;  3H0G G;  4DV4 Q;  3W1G A;  4LF7 Q;  5C4X G;  7RXN A;  5IYC H;  1WYD A;  1VQ5 A;  2UXB L;  4RXN A;  3KF6 B;  4A3B H;  1YEZ A;  3F2D A;  3STB C;  1HZA A;  5IP9 G;  4GOP B;  3KYX A;  1U5K A;  3ER0 A;  4GKJ Q;  4A3M G;  1L2F A;  4R4T A;  5FLM H;  1FJG Q;  3LPE B;  4TPU A;  3WWV A;  3HOX G;  1N36 Q;  3J7Z 1;  1BQ8 A;  2JI2 A;  2MS3 A;  2ES2 A;  4LUV A;  4L5S A;  2PPT A;  4LF4 L;  2WAQ E;  4R1J A;  1VQ8 A;  3PUZ A;  5EIO C;  4LUZ A;  3MXN B;  3L7Z C;  3T1H Q;  4B3S Q;  5FLM G;  1N33 Q;  3GTG H;  2UXD Q;  1RL2 A;  4OO1 I;  3B6Y A;  5GAH c;  3GD7 A;  2K5N A;  1NMF A;  4KHP Q;  2RHS B;  1X55 A;  5DM7 1;  2XJU A;  4X65 Q;  1D8L A;  2HIX A;  4B3M Q;  2ID0 A;  3HOU H;  1WOC A;  3PGZ A;  1QZH A;  4LFB L;  4WFN 1;  1G29 1;  1IBM Q;  4QY7 A;  4EQ5 A;  4APV A;  3CMA A;  1VQI A;  5C3E H;  3PF4 A;  1J5E L;  4DR1 L;  1RB9 A;  3QVD A;  3CCU A;  1Y1V G;  3I4O A;  2RHQ B;  4AYB E;  3OW2 A;  4DR3 L;  3K35 A;  1VQC A;  3FKI G;  2PYA A;  5MGN A;  1JJG A;  1DGS A;  3E9H A;  5IYB H;  4JI7 L;  2VY3 A;  3OTO Q;  1L0W A;  4JBW A;  4DV0 Q;  3HOY G;  2A6H D;  4JAD A;  1Y1V H;  4JOI C;  4LWC A;  2CCZ A;  4JI6 Q;  1LKP A;  1GKH A;  1Y14 B;  5JJK A;  2D0P A;  4PZ8 A;  1I94 Q;  2V1C C;  2VUM G;  4R4C A;  4LF6 L;  1PH2 A;  2I5L X;  4AI3 A;  2JQO A;  1JJC B;  2JEB I;  2GMG A;  2JI1 A;  1BKB A;  3KF8 B;  3QQC E;  2PVE A;  3B0A B;  1QUQ A;  1VCI A;  3PF5 A;  3G4S A;  2BH8 A;  4BBR G;  1LM0 A;  2R7F A;  1Q82 C;  5M5Y H;  2E2H H;  4LF7 L;  2HHH Q;  4OX9 L;  1VQO A;  1VZI A;  4JI0 L;  1ODH A;  4GS7 D;  4MTN A;  4X65 L;  1JT8 A;  1QYB A;  8RXN A;  3LNL A;  3PO2 H;  1YUZ A;  4TVA B;  3I2Z A;  3F2B A;  5GRO A;  4BY7 H;  1BE7 A;  4DV5 Q;  2A6E D;  4A3B G;  1I5F A;  4UY8 C;  2Q2I A;  2YTV A;  4LW1 A;  1A63 A;  2C35 B;  1RYT A;  5C0X G;  3CQZ H;  4JI5 Q;  5C4X H;  1BBW A;  3D31 A;  2NVT H;  2ZTC A;  4B3R L;  3JAM c;  2Z3Q B;  1HNX L;  3A0J A;  1SR3 A;  3PUY A;  5C0X I;  1VQG A;  3J81 i;  3PIO 1;  1YNX A;  5GAD C;  1IU5 A;  5IYC G;  3M4O H;  1U0L A;  1B2O A;  1E1O A;  3H0G H;  1Q7Y C;  1XNQ Q;  5IYD G;  3NFP I;  3DM3 A;  1WFQ A;  4JI5 L;  4K0K L;  2C6B A;  2K14 A;  2WB1 E;  3NEN A;  2AWN A;  3RN2 A;  4A3F H;  1HNX Q;  4JI8 L;  3ULJ A;  4B3T Q;  5DM6 1;  1FVI A;  3GTL H;  2R7Z G;  1XMQ Q;  1Y1W G;  2K5H A;  1WCM H;  1IBL L;  5M5W H;  4QGU A;  4GOP C;  3M4Q A;  4POG A;  4JI0 Q;  2HHH L;  4OX9 Q;  5C3E G;  6RXN A;  1KXL A;  1SMU A;  2D0O A;  2OQ0 A;  1NBW A;  2JJQ A;  3G6E A;  1S30 A;  2K75 A;  2NZO A;  3UE1 A;  4JAF A;  2DGY A;  2Z0S A;  5IP7 G;  3SS2 A;  1EUJ A;  4YCW A;  2KCM A;  3CC4 A;  3NEL A;  2XTI A;  2ZM6 L;  1YI2 A;  3HOZ G;  2UU9 Q;  1XPR A;  1UE5 A;  1Z47 A;  1GM5 A;  2CKZ B;  4B8C D;  1CKN A;  5EIN C;  5GAG C;  2ALY B;  4L5T A;  1VQ7 A;  2ZIX A;  3KJO A;  2E2J H;  2PI2 E;  1WJJ A;  1SFO H;  1UE1 A;  4DK6 C;  3T1Y L;  3S17 H;  2J9U B;  4DR2 L;  1JMC A;  3MEF A;  3MPS A;  5GAH C;  4LF6 Q;  1CKM A;  3I4M H;  4KHP L;  1R9T H;  2VQF Q;  1NXG A;  3PSI A;  3CPW A;  5K2M E;  1XPU A;  1R0G A;  4JYA L;  1ASZ A;  1B8A A;  4LFC L;  1CSP A;  3KYV A;  2F52 A;  1R0H A;  2Y0S E;  2CKC A;  4IO9 A;  4A3I G;  3S1N H;  4G6B A;  1Q46 A;  4DR3 Q;  3ICE A;  1VQN A;  3S15 H;  1XJV A;  2PVX A;  4IPC A;  4YWM A;  2B5I D;  3STB D;  1B71 A;  4JI6 L;  4OWX B;  4DR4 Q;  4GKK Q;  4LFC Q;  4JYA Q;  1E24 A;  2IT1 A;  1X56 A;  2FXQ A;  3J80 i;  3S2D H;  2UUA Q;  4PMW A;  3PUX A;  5M3F G;  4RMF A;  2N8N A;  1CUK A;  2VS1 A;  3M9B A;  4LF8 L;  3K7U C;  2M4V A;  1B7Y B;  4JI2 Q;  2VW9 A;  1FHM A;  4AI2 A;  4DR4 L;  1VQB A;  2JK8 A;  4HJ8 A;  2UU9 L;  3TS0 A;  1YZ6 A;  3UDF A;  5ELO A;  1D7Q A;  1T9Q A;  1UE6 A;  1IU6 A;  1VQJ A;  5IP7 H;  1OXT A;  3KYH C;  4DUZ L;  4X6A H;  1LUZ A;  4DK3 C;  4H02 A;  4DV2 L;  3ULP A;  4X66 Q;  3DLL A;  1YHB A;  1RWD A;  2JA5 G;  2CKA A;  4UPA A;  3M4P A;  3PUV A;  1FHH A;  1VQM A;  2V0E A;  2ZJP A;  2A69 D;  2JI3 A;  1WCM G;  3UDI A;  3TEH B;  1V9P A;  1S72 A;  3U58 A;  1MJE A;  3H3V H;  5C4J H;  3A5Z B;  1WI5 A;  2D62 A;  3SGI A;  1YIJ A;  1I6H H;  3TRE A;  1HNW Q;  1K8A C;  1M90 C;  2IY5 B;  1N9W A;  5JEA G;  1CAD A;  1K9M C;  5FJ8 G;  4A3L G;  4A3K H;  3J7Z C;  2ATW A;  1HZ9 A;  1V43 A;  2C6A A;  3K7A H;  3BZK A;  2MNA A;  4GKJ L;  1IBK L;  4A93 H;  2A68 D;  3U4Z A;  4YHH L;  2K50 A;  2IX1 A;  1VQP A;  3HKZ G;  3P2A A;  3TQY A;  1X3G A;  2K4K A;  2MFI A;  1VQ4 A;  3Q8D A;  4NXM L;  4IFD J;  3L0O A;  1CSQ A;  2CFM A;  5HGQ A;  4P75 A;  4AYB G;  3RN5 A;  1TWC H;  3CW2 C;  4A4I A;  3AEV A;  1W3S A;  2NN6 I;  3HOU G;  5AN9 H;  4L5R C;  3A5U A;  1YK5 A;  3PKJ A;  3AFQ A;  4IOA A;  2XJR A;  3ZJY C;  1TXY A;  4LFA Q;  1KIX A;  5IYD H;  2B29 A;  1MKH A;  1VS0 A;  2NN6 G;  4QJF A;  5HY6 A;  2VQE Q;  2WP8 J;  4C3I H;  5IT9 c;  1HR0 W;  1XNQ L;  3J7A 5;  2IHF A;  3RZT A;  3NEM A;  1LYL A;  4L5Q A;  4BY1 G;  4XGH A;  4DR6 Q;  2ZTE A;  4A3C H;  4JCV E;  2PI2 A;  4DNI A;  3S16 H;  3W1B A;  2ZJR A;  2EIF A;  1VQH A;  2PMZ E;  3UDX A;  3GTM H;  2K2D A;  3RZO H;  3M85 A;  1OTC A;  3I4M G;  4GN4 B;  1BVS A;  4BY1 H;  3H15 A;  1VQA A;  2UUB Q;  1SE8 A;  1AE2 A;  2NZH A;  1YV1 A;  1AE3 A;  2WB1 G;  4R4I A;  4JBK A;  1Q1E A;  3HOW G;  4DV3 L;  4A3E H;  1I94 L;  2NYD A;  2M6P A;  3CPF A;  1SLJ A;  2VL6 A;  2HIV A;  2Z6K A;  4DUZ Q;  3CCM A;  3B08 B;  4ZN3 B;  4R4Q A;  2XJS A;  4DUY Q;  4IFD G;  2KN9 A;  4JG2 A;  4X66 L;  1PV4 A;  4AQY Q;  3CF5 A;  1IRO A;  3ULL A;  1G51 A;  3AYH B;  4GNX C;  1W2B A;  1TWF H;  4IFD I;  1E1T A;  1BBU A;  3KLW A;  4MNO A;  4GN3 B;  3I4N G;  2UXC L;  5RXN A;  4YWL A;  5ELN A;  1XNR L;  2H5X A;  5C44 H;  2JA7 H;  2BA1 A;  4QQB X;  1CAA A;  1PFS A;  4LF8 Q;  2XGT A;  2VUM H;  2GVB A;  4NPS A;  4UP7 A;  3EIV A;  5E7N A;  3PV0 A;  3OTO L;  4DV0 L;  4GNX B;  3KYW A;  4AQY L;  4JI2 L;  4JI7 Q;  3HOY H;  2VQF L;  3D0F A;  4YWK A;  3J7Y 1;  3JC6 6;  2N78 A;  2E2I H;  4AHY A;  3RLF A;  5FLX c;  3S2H H;  2R7D A;  1Q86 C;  4XXB B;  2NVY H;  1B2J A;  4IPD A;  2NVQ H;  1S2Z A;  1TWA H;  2UXC Q;  2CWP A;  4DAM A;  2ASB A;  2V0F A;  1T9P A;  1P16 A;  1PHJ A;  3GTP H;  4GLA C;  1VZG A;  3NBH B;  1J5E Q;  4A3M H;  3PO3 G;  2XJV A;  3HKZ E;  5LMU Q;  3GDE A;  4DR5 Q;  1N36 L;  2BH2 A;  4IJL A;  3BJU A;  2YTX A;  1E7Z A;  2N49 A;  2ERS A;  1G6P A;  1VQE A;  1L1O A;  2CQO A;  4DR2 Q;  2V3B B;  1VCX A;  1H95 A;  1N8R C;  1EOV A;  4RG1 A;  1RDG A;  4PZ7 A;  2VQE L;  2B3G A;  2GVA A;  4DUY L;  4DV7 L;  3T1H L;  2Q2T A;  1SRU A;  4LFA L;  3GTO H;  3A44 A;  1ZRP A;  3PO3 H;  4Y52 H;  1PA6 A;  4LUO A;  2KCT A;  1IRN A;  4DV4 L;  2HT1 A;  4LHL A;  1HNZ L;  5K36 G;  5M3F H;  2E5L L;  2M4Y A;  1VQD A;  3HOX H;  4ZN1 B;  1OXS C;  1JB7 A;  2UUB L;  4AHX A;  4K9F A;  2KBN A;  1VQ9 A;  3JC6 2;  3GTQ H;  2LCQ A;  1PYS B;  1RYQ A;  4JI4 Q;  4XIG S;  1KC8 C;  4AR5 A;  3JAM i;  3GTJ H;  2QL0 A;  1HZC A;  1M1K C;  4AH6 A;  3J81 c;  4C3J H;  1X54 A;  5MLC 3;  3E0E A;  4YCV A;  1SMM A;  4KHZ A;  3TRZ A;  4JV5 L;  4A3I H;  3G71 A;  2I5H A;  3IU3 I;  5C0X J;  4PG3 A;  1IBL Q;  5GAE C;  5JVG 1;  2A19 A;  1NY4 A;  2WFW A;  1PH7 A;  4AHW A;  1JE5 A;  2OQK A;  2R92 H;  3CCV A;  1MJC A;  1K8G A;  1LKM A;  4DV5 L;  4HIM A;  3FKI H;  3S24 A;  1YIT A;  2B63 G;  3ZG6 A;  4A76 A;  2VZA A;  4JI3 Q;  4DV1 Q;  2O5J D;  1PH3 A;  2R7Z H;  4B3R Q;  3U4V A;  2HQL A;  4ME3 A;  2GN5 A;  4AR3 A;  2DUD A;  3KOJ A;  4DV2 Q;  3VDY A;  4AR4 A;  2B63 H;  1PH8 A;  2R92 G;  2MO1 A;  5M3M H;  1Q81 C;  2EXD A;  4A3E G;  2AMC B;  2OCE A;  4X62 L;  4Y7N H;  3CAM A;  2UUC L;  2RDV A;  4JBM A;  4DV1 L;  3FHW A;  1KHI A;  2H12 A;  1EQR A;  1SMW A;  3WWL A;  2LXJ A;  4DAY B;  2JA5 H;  2JA7 G;  2L15 A;  3TS2 A;  3S1Q H;  1HNW L;  4EX5 A;  1Q12 A;  3I4N H;  3MSU A;  1OXU A;  4GNX A;  2N3S A;  1VQ6 A;  2Q2U A;  4GN5 A;  4P71 A;  3K8A A;  4JV5 Q;  5H1S E;  5BR8 Q;  2JA9 A;  1NNQ A;  5GAD c;  5JEA J;  2EQS A;  4A75 A;  1XMO L;  1EWI A;  4C2M H;  2R6G A;  2Q2H A;  4A3D H;  1H7V A;  1TWG H;  1JJ2 A;  1HR0 L;  3S1M H;  4OXP A;  3UE0 A;  4DKA C;  1KRS A;  4HJ5 A;  4DR1 Q;  2XJT A;  4JI4 L;  4JAE A;  1PH6 A;  1YJW A;  2QGQ A;  3KYY A;  2IHE A;  5AJ3 Q;  2Z3R B;  1Q8K A;  3RLO A;  3CP0 A;  1HJP A;  1EYG A;  1SRO A;  1C09 A;  1I50 H;  4IOC A;  4WJ3 M;  1VQF A;  2BE5 D;  3J80 c;  1L1O C;  1PYB A;  1NTG A;  3CCR A;  5IY0 A;  4BA1 I;  4POF A;  5AJ3 L;  4GOP A;  4DR5 L;  2JA8 H;  2AWO A;  2ZTD A;  1PH5 A;  5DLQ E;  1YJ9 A;  1C7Y A;  3HOV G;  1C0A A;  2ZM6 Q;  3KF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...