2PPTA

Crystal structure of thioredoxin-2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
149
structure length
149
Chain Sequence
MMGAKMAESLRLTCLACGQANKVPSDRLAAGPKCGICGAGLITGKVAGIDPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin-2
publication title Crystal Structure of thioredoxin-2
rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 39
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2007-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.140 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2pptA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pptA02
1FB6A 2E2GA 5CNWA 4OO5A 3GKXA 3FHKA 1M99A 4ZBBA 3WGXA 3F6DA 4CHSA 1TW9A 3S9FA 10GSA 3RPNA 2PMTA 4HZ4A 4XS1A 1EGOA 4K8MA 3UVHA 2DC5A 5E59A 4TR4A 6GSYA 1UVZA 2NTOA 3E3EA 2MYGA 4Q5QA 4ML1A 2YV9A 1V9WA 5G5FA 1TI1A 3UARA 1F2EA 5IM9A 3EMXA 4MA9A 5DQYA 1TK5B 3HCZA 3ZL5A 2OJLA 1SK2A 4KNDA 1A2JA 3TOUA 1SL1B 2FCHA 5AISA 2VCQA 4MPFA 2VCVA 4NAXA 3DEXA 5ABRA 18GSA 3VPTA 1V58A 2EC4A 1GSDA 2IN3A 2H6XA 1VGLA 3L4NA 16GSA 4IN0A 1S3DA 2HXKA 5EPFA 4MP4A 2OE1A 1WWJA 1M2DA 1V2AA 4Q5RA 4DSSB 2GZYA 1IYIA 4ZB8A 4EDYA 3GNJA 2CV4A 3QDNA 1FG4A 2NBSA 4YQUA 2VUPA 4IHUA 5ELAA 1O85A 4EVMA 2WCIA 4MMMA 4LMVA 3LJRA 2HSHA 2H0GA 4XIHA 3M8NA 1EV4A 3ZTLA 2VCWA 3IDVA 3ZVJA 4I2UA 5ENUA 2OBIA 3WT1A 3CSHA 5F0GA 1F3BA 1YEXA 3E9JB 2WGRA 1OKDA 1QQ2A 1TI3A 2XPEA 2DMLA 3RBTA 2X99A 2WDUA 1R5AA 2L57A 4TVEA 2JSZA 2QSIA 5JWQB 1W4VA 4PX1A 2VLUA 2GQKA 11GSA 4YQMA 1BX9A 2A2SA 4MJEA 2XPDA 4OCEA 1GTIA 3EMPA 5GZZB 2AJQB 1G7EA 5G5EA 2H66A 3DRNA 1IYHA 3GTUB 4OWYA 3GYKA 5AGYA 1EOGA 5D96A 3QPMA 6GSTA 12GSA 4NWYA 2WS2A 1WMJA 2Z9SA 5JCUA 3TJGA 3CRUA 3RDWA 2LQOA 3F3RA 1THOA 1OC3A 3PR8A 3GH9A 4N0ZA 1PX6A 1J9BA 2CVKA 3L9SA 4KDYA 3KIJA 3UOMA 2IMFA 1FAAA 2K8SA 2A4VA 4MABA 2NDOA 3M0FA 1K3YA 4XRDA 2VD0A 3D4MA 3HYPA 3WYWA 3LYPA 1WP0A 4XHMA 3CSIA 1ERUA 3KP8A 3HA9A 1A23A 3O3TA 2IJYA 4FYBA 2HT9A 5HFGA 4DSSA 1XPVA 2QKEA 5LCZA 1S3CA 4JBBA 2DIYA 1Y25A 4IP6A 2CZ3A 4K2DA 3FZ9A 1ERTA 2FA8A 3TCOA 2FWFA 1XIYA 1TU8A 4EKZA 3MDKA 4ECIA 4MF5A 1KEBA 2VLVA 4RI7A 2WB9A 1B9YC 6GSSA 4I2TA 2K8VA 3QD9A 2REMA 3Q19A 4JR6A 3A5WA 1EEMA 2M46A 2B5XA 2GQMA 4POKA 1WJKA 5E4WA 4ECCA 2DJ1A 2AYTA 2N5FA 3BCIA 1RW1A 4NMUA 1LU4A 1ILOA 2F51A 4HZ2A 3KMOA 1SJIA 2B3SA 4BWSA 4AGSA 5ECNB 4O32A 3IHQA 4V2NA 2DSAA 4IGJA 3DWVA 4IKHA 2H8LA 3KTBA 3GTUA 4TR3A 3K8NA 2JZRA 2X8GA 3IK9A 2DLXA 1O81A 2O87A 4QL7A 4IELA 1T7PB 3GFKA 2LNTA 2E0QA 1MDJA 1THXA 3P8WA 2VCTA 1ON4A 4ID0A 4PURA 4ECBA 3V1WA 2R4VA 1SK0A 3PGTA 3G7IA 3P2AA 4WEYA 5IMCA 5H5SA 3ME8A 1HQOA 1N8JA 4GSNA 1T00A 2AAWA 1TXXA 3KZQA 5B7CA 3HD5A 2L5LA 1B4PA 3UBLA 3FEUA 2L4QA 4GWRA 3TRXA 1YKCA 1ERVA 1M2BA 2WJUA 4WKWA 2C80A 3P90A 1O6JA 1MTCA 5CYYA 3W8JA 4LLRA 4KDUA 3TKRA 3GHAA 1QGVA 3SBCA 1GTUA 3Q74A 5ID2B 3M3MA 4OFMA 4V2MA 4ZIJA 2L6DA 2I1UA 4G2EA 4PNGA 2IFQB 1Z7PA 4YAPA 7GSSA 3R2QA 5CAXA 4MF7A 3LQ7A 1F3AA 1Z3EA 1AW9A 2GQLA 5G31A 3P7XA 5COHA 2YJHA 2DJ0A 1OKTA 3O76A 2FA4A 2PBJA 2V32A 3DGQA 1TRWA 3PINA 2RLIA 2R5GA 3APOA 2C3TA 1ZOFA 3ED3A 4FYUA 3FW2A 3TDGA 5CREA 2B7KA 1SD9A 1Q98A 4WBRD 1T1VA 1QK8A 1TTZA 4LMWA 3GSTA 5J4UA 4NPBA 3LFLA 3FZ4A 2B7JA 4GF0A 5HFIA 1S3AA 1SD8A 1DE2A 22GSA 2TIRA 4PUAA 3B08B 5HR2A 4RI6A 3VK9A 4POMA 1AQXA 5ECLB 2H1DA 2V1MA 4GXZA 2G2QA 2DJ3A 1ZYEA 1DE1A 2OKAA 2BJXA 3ZREA 1NW2A 13GSA 2VL3A 2ON5A 3IE3A 3GIXA 2QGVA 1EP7A 4BVYA 3D5JA 1F37A 5A4WA 3F0IA 2H72A 3GL3A 3KH7A 1V40A 5KN3A 4J56E 1B48A 2I3YA 1PGTA 2MZCA 3FR6A 5A4VA 4MZBA 4GLTA 1AAZA 3ERGA 2FWEA 1GUKA 3HJMA 3FY7A 4BPYA 3HJPA 1YY7A 1U3IA 3BOAA 4GRFA 5LD0A 5H5RA 1TRVA 1TRSA 2LTKA 5IPHA 2AB6A 3FKFA 2KUCA 2K18A 4KX4A 5DDLA 4IQAA 4TR1A 2TRXA 3ZFBA 5ID2A 2DJ2A 3FR9A 3TJBA 3RHCA 1GLPA 2IFQA 4RQXA 4EF0A 5J3RA 1AXDA 4POBA 2LJRA 2HYXA 2GVPA 1BYEA 1MD3A 4PNFA 1I9DA 2IMDA 1VRSD 5IOXA 4NHZA 1PL2A 2PUKC 1ZGNA 1CQHA 1SKSB 2X64A 1UC7A 2KOKA 5GAND 4F03A 1YJ6A 2M72A 3VWVA 4IW9A 4XCSA 5DCHA 3TKPA 2DIZA 5DVBA 5DJMA 5B6NA 2MMAA 2RUEA 1PL1A 3ERWA 2C3QA 4HDEA 3D0ZA 4G19A 5AIXA 1X9MB 1X5DA 1M9BA 2FY6A 1A8YA 1TP9A 1MEKA 1E6BA 4BWQA 2AUVA 1EP8A 2KLXA 3ME7A 2L5OA 4F82A 1YEPA 1A24A 1HNBA 3C7MA 4Q5FA 2LRTA 1F9MA 2R2JA 3ZFLA 1PSQA 5F06A 2C3NA 2K9FA 4TR0A 3IC4A 1AQVA 4OFTA 2H74A 4HQSA 1RK4A 3EU3A 3WD6A 4NHWA 2YANA 2ES7A 2HFDA 2MMZA 1YF0A 2LS5A 3H1NA 3M1GA 4P3YB 4MLYA 3F9UA 2H30A 2VM1A 2C1YA 3UEMA 1EWXA 2GS3A 2N5BA 2VM2A 3CXGA 5JCGA 3HKRA 1Q4JA 3NOFA 2CZ2A 2F8FA 1QMVA 2PN8A 2JL4A 1ZMAA 3EVIA 4OCFA 5DALB 4X1UA 4MDCA 3UJ1A 5H5QA 3VI5A 1JZDA 4RUVA 2V6KA 4FIWA 5HFKA 2OBKA 2RM5A 4XS4B 2YCDA 1XXUA 2CAIA 3TKQA 5ECRB 2EIRA 3EURA 3C71A 4ZILA 1HYUA 1YQ1A 1MDKA 4GQCA 5ELGA 1J08A 3BBYA 5IMZA 3IPZA 4JU5A 4OMVA 4TXOB 2CVDA 5L71A 1LBKA 2B6MA 4K9ZA 2VD1A 5LNKe 2F3MA 3MSZA 2PGTA 1FVJA 3EU4A 1H4OA 4MF6A 1XFLA 1ZZYA 3Q18A 1SKWB 4KSOA 3WGDA 4I6XA 3B0AB 2KP1A 5KN0A 3J7Yb 1BEDA 1KTEA 2F9SA 5AN1A 3KCMA 3OR5A 1GL8A 3KH9A 1KNGA 4K1FA 5DAKB 1SU9A 3L0HA 2OE0A 1M2AA 1PD21 1OC8A 4G10A 4KB3A 2C0EA 1GULA 5CRWA 2OA7A 1XWCA 1T8EB 2GZPA 1TOFA 1BJXA 2WRTA 1MDIA 3TUEA 3HJOA 4KGIA 1V98A 4TKYA 3I6AA 4XTSA 1PX7A 3CTGA 5EY6A 1DBYA 4XRAA 5D9VA 1XWAA 3W6GA 3NZNA 4E8EA 2K6VA 2DBCA 1TDIA 3EINA 3TRQA 3Q6OA 2IWTA 3TJKA 2H0IA 2LEGA 4L0UA 1XOAA 5DCGA 4HU7A 1NHOA 4WF4A 4AJ6A 4ML6A 4QQ7A 1OE8A 1H75A 3ZMLA 4JE1A 3F63A 2IPAA 4HEA2 4WBJA 2FLSA 5B8BA 4FH8A 3CMIA 3IK7A 1GSYA 4D73B 3DKSA 3TKSC 2NPBA 5EVOA 3TB2A 5J5NA 4L5OA 2XBIA 5IOWA 1W89A 1GNWA 1U3AA 4MCUA 2OACA 2H76A 2PVQA 4I5QA 2HLSA 4YQVA 3H79A 4HQZA 2YWNA 3TKSA 4TXOA 2IMIA 2HZEB 4HS1A 2F8AA 4I8BA 5IMAA 1HNAA 2MBTA 3IAM2 1O73A 5C04A 5F8BA 3TGZA 3GSSA 4MJBA 3ZITA 3KM6A 2QC7A 2FWHA 2JZTA 4KCAA 2B1LA 3C1SA 1J0FA 3ERFA 2HZFA 1VF3A 2L59A 3LG6A 2RIIA 2LRNA 3VFIA 4PQ1A 4XXBB 1FO5A 5IMVA 2DJJA 5DAKA 1OC9B 2J9HA 1Z6NA 1A2MA 3HY2A 4WR5A 4JRRA 1SJ6A 4IVFA 2VAFA 3GMFA 4WF5A 2C8UA 2IL3A 2OADA 2VIMA 5AIVA 1O8WA 2IIYA 4I97A 9GSSA 1AC1A 4K6XA 2M80A 2LUSA 2AHEA 4ZL8A 3NIVA 2GSQA 2D2ZA 1WE0A 1AQWA 4K0NA 1YDKA 1NM3A 3APSA 4KE3A 4EDZA 3FR3A 4AF2A 4WXTA 1GWCA 2YN1A 2EIOA 1T4YA 4CDOA 3FYGA 2CT6A 2CX3A 2VCXA 3U5RE 3IAS2 3KP9A 4H86A 4WR4A 2RM6A 4K7NA 1PMTA 1EGRA 4N30A 2GDRA 1GRXA 3C73A 4YH2A 3TJFA 4F0CA 3D6IA 3UIWA 2C6AA 4E8HA 5ECSA 2VL2C 3VWXA 4JR4A 4D73A 4Q5NA 1Z6MA 4EL1A 1Y6EA 1FW1A 4V1Ap 1G6YA 2LJKA 1XCCA 3JCML 1OVNA 4Z7XA 19GSA 2L6CA 2R6KA 1XWKA 3ZMKA 3LGCA 1R5PA 4TRXA 1ML6A 5FHIA 4XS6A 2HZEA 1E2YA 4TOPA 3KXOA 5INYA 5JWOB 1TK8B 3IXRA 2FHEA 2WFCA 2P0GA 5FT3A 1Z5YE 4BA7A 2H0HA 2H6YA 6GSUA 4HJMA 5IQYA 17GSA 2CX4A 3LSZA 2O8VB 1K0OA 1K0MA 2GSRA 4KH7A 2MMOA 3N9JA 1QUWA 3SWLA 3EC3A 3F4RA 2B1KA 3GURA 3QR6A 3FK8A 1BG5A 3WT2A 2RUFA 3U6VA 5ECHB 1OC9A 4N10A 5CRDA 2ZUPA 1KBNA 4J57E 3ZZXA 3EWLA 1B8XA 1F6MC 1Z9HA 3RPPA 5IO2A 2PU9C 2H1GA 3MAKA 1U87A 1XBSA 3G9BA 4RQRA 1X5CA 3VWWA 1USBA 3DIEA 3UL3A 2GT6A 3HHVA 3CSJA 2MBSA 3GX8A 4KW6A 1YF1A 1TK0B 2GT5A 4GSTA 3ZLPA 4LL1B 2IMKA 4PXOA 1WPIA 5F05A 1MD4A 4ACSA 8GSSA 1X0RA 2J23A 3H93A 4K7IA 1EV9A 4ZL7A 4NV2A 2OE3A 5HR1A 1K0NA 4ZL9A 1C72A 1WRYA 5GSTA 4NV5A 2O7KA 4ZB6A 1TRUA 4HI7A 3VLNA 3GRXA 5G2ZA 2KP2A 1FB0A 2KHPA 1ZYQB 5DQSA 3WGEA 1WIKA 3ISOA 3TKSE 5J41A 2WULA 5KN2A 5CRHA 3IA1A 1K0CA 5B8AA 4HU9A 1T3BA 1OYJA 2H73A 1VF4A 1GTBA 2GSTA 4EXJA 1WOUA 5J9BA 4ZBAA 3HDCA 2TRCP 1K0DA 2FWGA 3HZ4A 5D9XA 4F9ZA 2VL9A 1JZWA 4FO5A 1XZOA 2H70A 1O7UA 2HE3A 4LL4B 5CP1A 2O89A 1JFUA 2AV4A 3H4KA 2CAQA 5A5KA 1R7HA 2LKUA 3QCPA 3FRCA 5J9CA 3UVTA 1ST9A 2C6BA 5ECKB 5CRGA 2P31A 3M9JA 4WETA 1PN9A 4LA1A 4O5RA 1M7TA 4EC0A 1SL2B 2H19A 4ZXGA 1ZL9A 4AJ8A 1K3OA 2VO4A 2YZHA 3F4TA 3GV1A 2PWJA 3AY8A 3QFAC 2YPMA 5IPGA 1SYRA 5D73A 4MJAA 4HOJA 1XVWA 3GL5A 2C0FA 4KSMA 1GNEA 4BVXA 1GSQA 1V57A 2EIQA 4DSQA 2IMEA 3LEFA 2VCZA 2PERA 2B5EA 3DMLA 3I9V2 3G7YA 5D8IA 2MMNA 5HR3A 1B4QA 3TJJA 1XW6A 4KUNA 2ZCTA 1R26A 1X5EA 2YWMA 2H75A 2X8CA 2R3XA 2P5QA 4G9HA 1U88A 4F2IA 3DYRA 1JLVA 2ALBA 3IBHA 2CQ9A 1SJZA 4OD7A 2LSTA 3GN3A 1YZXA 5DBQA 1GSUA 2FGXA 3G7JA 1BQ7A 5HR0A 2N5AA 3A2XA 1I5GA 2P5RA 1AIUA 4L5LA 2ON7A 2C0GA 3US3A 3DD3A 3LORA 2YV7A 1GUHA 1QXHA 5G1LA 4DVCA 1LJRA 2L4CA 4IP1A 4IS0A 2V41A 3GUSA 3C8EA 3KMNA 2YOIA 2I4AA 2JADA 3ZIJA 1OE7A 1JHBA 2LQQA 1UN2A 2C4JA 3D22A 1ZCPA 3L9VA 2GLRA 3KGKA 14GSA 1SENA 2H6ZA 4MH3A 4ILFA 3ZRDA 1JZRA 3F8UA 1BAYA 3N5OA 3QOUA 1XW9A 1RQMA 1GSFA 2R37A 5A4UA 2H71A 4HUAA 3IV4A 3GKNA 2O85A 4TN8A 3HXSA 3BCKA 1FVKA 3HZ8A 4X43A 3I43A 5D9TA 3GH6A 1G7OA 2LV3A 5EL8A 3F4SA 2BMXA 3D4TA 3GKMA 3IOSA 2LRCA 4DEJA 3VWUA 2JSYA 1GUMA 1TJDA 4X0XA 2PVOC 2YZUA 4L0WA 1GLQA 4IQ1A 3PH9A 2YJ7A 4YAVA 2GSSA 5IMFA 3TRPA 2GZZA 1GSSA 3HVSA 5DALA 1URMA 2FNOA 3ZIVA 3C1RA 4AJ7A 2VLTA 1VF1A 3I69A 1M0UA 3MNGA 3QAVA 5ECMB 4EO3A 1OAZA 5ECQB 4KCEA 4XS4A 1SYXA 4PUFC 4PGTA 5ECOB 4GCIA 5F07A 5D93A 5JWRB 4IJIA 1PKWA 2H1AA 3A3TA 5HQPA 1TU7A 2A2RA 2FD3A 6GSVA 2YNXA 4TXVA 2DMMA 2J9UB 4EUYA 2YWIA 4PQIA 4EE0A 4ZBDA 2C0DA 2BTOT 1A8LA 2G0FA 3E0UA 5D9WA 5CO3A 2XC2A 4GQFA 3KD0A 1N2AA 1CQGA 4N0VA 1TKDB 3QFBC 4OO4A 4TW5A 3FZ5A 4ZB9A 1Z7RA 4JEDA 3UMAA 1EEJA 3GKKA 1ERWA 2HNLA 4K7OA 2JU5A 3IR4A 1VF2A 2XBQA 5IO0A 4O92A 4MH2A 1SK1A 3BD2A 3L78A 3TOTA 4CW9A 1A0FA 5KN1A 4KA0A 3KTLA 5C00A 1XOBA 2E2MA 2XHFA 5GAPD 1B9XC 2WZ9A 5G30A 4ISDA 2X8HA 3H8QA 4MJCA 3LXTA 1HNCA 2FUG2 3F6FA 4DSRA 3F3QA 2GTUA 3FZAA 4O7HA 5ECIB 5FWGA 1NHYA 4V1Ag 3DVXA 3UBKA 2CA8A 3IRAA 1FOVA 4J2FA 1T4ZA 2H1BA 1FHEA 1GP1A 1YKAA 2NVLA 4TR1B 3EE2A 2YWOA 2YP6A 5JCWA 1EZKA 3QAWA 2H01A 1HD2A 2HRNA 4HJ2A 5ECPB 4K0GA 2I81A 1ACVA 4KAEA 2V2GA 4QL9A 2DJKA 4F0BA 2V6OA 2GGTA 1JLWA 3RHBA 2E7PA 1NSWA 6GSXA 3KEBA 3BJ5A 3CRTA 1EOHA 2I9HA 1PQNA 1ABAA 3D21A 1QFNA 1JZOA 2JZSA 3MWHA 4ECJA 2HSYA 3ZVJD 3APQA 1K0AA 4IBPA 3QAGA 4MZCA 2VL2A 1XVQA 4V2LA 1XWBA 1SKRB 4MPGA 3UAPA 3VPQA 5GSSA 5DJLA 6GSWA 3LYKA 2JACA 3GA4A 1SL0B 3GX0A 3VURA 3CYNA 1GSEA 3VI7A 2ZNMA 4NXIA 1X9WB 3J7Yk 4GSSA 1XW5A 4GTUA 4FYCA 3A2VA 1K3LA 3QMXA 4KDXA 2CVBA 1G0TA 1O8XA 1M9AA 1PRXA 2VOCA 5G1KA 1K0BA 1UA5A 4L8EA 3O6TA 1DSBA 3CTFA 4MK3A 1A2LA 3LWAA 1AUCA 20GSA 1X9SB 3M9KA 2LJAA 3LXZA 3HVVA 3EYTA 1G6WA 1GTAA 4IJ3A 3W8SA 3A2WA 2B5YA 4ULXA 5IMDA 4N11A 3DXBA 1PA3A 2HI7A 1U6TA 5IIZA 3KJYA 4PQHA 4MZWA 3HVXA 3RAZA 3ZYWA 1PKZA 1DUGA 1R4WA 2PPTA 4POLA 1GH2A 5B6MA 3CBUA 2HRFA 4JZQA 5KEJA 3L9UA 4OFNA 1A0RP 1XWGA 3DVWA 4BL7A 2LNSA
chains in the Genus database with same CATH superfamily
1FB6A 2E2GA 5CNWA 5C4XL 2JA6L 4OO5A 3GKXA 3FHKA 1M99A 4ZBBA 3WGXA 3F6DA 4CHSA 1TW9A 3S9FA 10GSA 3RPNA 2PMTA 4HZ4A 5KOWA 4C2M1 4XS1A 3IHGA 1CAAA 2V3BB 1EGOA 4K8MA 3UVHA 2DC5A 5E59A 4TR4A 6GSYA 1UVZA 2NTOA 3E3EA 2MYGA 4Q5QA 4ML1A 2YV9A 1V9WA 5G5FA 1TI1A 3UARA 1F2EA 5IM9A 3EMXA 4MA9A 5DQYA 2Y0SP 1TK5B 3HCZA 3ZL5A 2OJLA 4AYBP 1SK2A 4KNDA 2QA1A 1A2JA 3TOUA 1SL1B 2KKDA 2FCHA 5AISA 3HOXL 2VCQA 4MPFA 2VCVA 4NAXA 3DEXA 5C44L 1BE7A 5ABRA 18GSA 3VPTA 3S2HL 1V58A 2PVXA 2EC4A 1GSDA 2IN3A 2H6XA 1VGLA 3L4NA 16GSA 4IN0A 5EIOC 1S3DA 2HXKA 5EPFA 4MP4A 2OE1A 2A69D 1WWJA 1M2DA 1V2AA 4Q5RA 2V0EA 4DSSB 2GZYA 1IYIA 3MIXA 4ZB8A 4EDYA 3GNJA 2CV4A 2ERSA 3QDNA 1FG4A 2NBSA 4YQUA 2VUPA 4IHUA 5ELAA 1O85A 4EVMA 1B2OA 2WCIA 4MMMA 4LMVA 1LTLA 3LJRA 4C3IL 2NVYL 1T9PA 2HSHA 2H0GA 4XIHA 3M8NA 1EV4A 1SMUA 4C3HL 3ZTLA 2VCWA 3IDVA 3ZVJA 1YK4A 4I2UA 4O5QA 3HOWL 1S30A 2OBIA 5ENUA 3WT1A 3CSHA 5F0GA 1F3BA 5MF6A 1YEXA 3E9JB 3A44A 2WGRA 2XJQA 1OKDA 1QQ2A 1TI3A 4HSCX 3PKIA 2XPEA 2DMLA 3RBTA 2X99A 5M3FL 2L0ZA 3PIP1 3FKIL 2WDUA 1R5AA 2L57A 4TVEA 2JSZA 2QSIA 5JWQB 1W4VA 4PX1A 2VLUA 2GQKA 11GSA 4YQMA 1BX9A 2A2SA 4MJEA 2XPDA 4OCEA 4JAEA 1GTIA 3EMPA 5GZZB 2AJQB 1G7EA 5G5EA 2H66A 3HOYL 3DRNA 1IYHA 3GTUB 4OWYA 3GYKA 5AGYA 1EOGA 5D96A 3QPMA 6GSTA 3MPSA 12GSA 4NWYA 2WS2A 1WMJA 2Z9SA 5JCUA 1R0GA 3TJGA 3CRUA 1I50L 3RDWA 2LQOA 1B2JA 1ODHA 3F3RA 1THOA 1OC3A 3PR8A 3GH9A 4N0ZA 3IC8A 1PX6A 1J9BA 2CVKA 3L9SA 4KDYA 4USSA 2NVTL 3KIJA 3UOMA 1SMMA 2IMFA 2EY4E 1FAAA 2K8SA 2A4VA 4MABA 2NDOA 3M0FA 1OWBA 1K3YA 4AHZA 4XRDA 2VD0A 3D4MA 3HYPA 1VZIA 3WYWA 1IU5A 2Z3QB 3H9BA 3LYPA 1WP0A 4XHMA 5FLML 4KF9A 3CSIA 1ERUA 2HRAA 3KP8A 3HA9A 1A23A 3O3TA 2KN9A 3HJYB 4O5UA 2IJYA 4FYBA 3PO2L 2RDVA 2HT9A 5HFGA 4DSSA 1XPVA 1YV1A 2QKEA 5LCZA 1S3CA 4JBBA 2DIYA 1Y25A 4IP6A 2XJTA 4A3IL 2CZ3A 3FZ9A 4K2DA 1ERTA 2XJUA 3GTLL 4YKGA 2FA8A 3TCOA 2FWFA 1XIYA 3S1RL 3FMWA 1TU8A 4EKZA 3MDKA 4ECIA 4MF5A 1KEBA 2VLVA 4RI7A 2WB9A 1B9YC 6GSSA 4I2TA 2K8VA 3QD9A 2REMA 3Q19A 4JR6A 3PL5A 3LNLA 3A5WA 1EEMA 2M46A 2B5XA 2GQMA 2PMZP 4POKA 1WJKA 5E4WA 4ECCA 2DJ1A 4ICYA 2AYTA 2N5FA 3HKZP 3BCIA 1RW1A 2A6ED 4NMUA 2NVQL 1LU4A 1ILOA 2F51A 4HZ2A 3KMOA 1SJIA 2B3SA 4BWSA 3S16L 4AGSA 5ECNB 4O32A 3IHQA 4V2NA 1YUZA 2DSAA 4IGJA 3DWVA 3MSUA 4IKHA 2H8LA 3KTBA 1B71A 3GTUA 4TR3A 3K8NA 2JZRA 5BRTA 2X8GA 3IK9A 1IU6A 5GAHc 2DLXA 1O81A 3PIO1 2O87A 2WB1P 4QL7A 4IELA 1T7PB 2UZ8A 1DX8A 3GFKA 2LNTA 2E0QA 1MDJA 1THXA 3P8WA 2VCTA 1ON4A 4ID0A 4PURA 4ME3A 4ECBA 3ZG6A 3V1WA 2R4VA 1SK0A 1VZGA 3G7IA 3PGTA 2R92L 3P2AA 4WEYA 5IMCA 5H5SA 3H9CA 3ME8A 4BVYB 1HQOA 1N8JA 4GSNA 1IROA 1T00A 2AAWA 1TXXA 3KZQA 5B7CA 3HD5A 1K83L 2L5LA 1PFYA 4A3BL 1B4PA 3UBLA 3FEUA 2L4QA 3RZTA 4UY81 5JVH1 2A2PA 4GWRA 3TRXA 1YKCA 1ERVA 1M2BA 2WJUA 4WKWA 2A68D 2C80A 3P90A 1O6JA 3HOZL 2R0PA 1MTCA 5CYYA 1BQ9A 4LLRA 1ZYPA 3W8JA 4KDUA 3TKRA 3GHAA 1QGVA 1IRNA 3SBCA 2DKHA 1PFWA 1GTUA 3Q74A 5ID2B 3M3MA 4OFMA 4V2MA 4ZIJA 5MFZA 2L6DA 2I1UA 4G2EA 4PNGA 3GTJL 2IFQB 1Z7PA 4YAPA 7GSSA 3R2QA 4Z2RA 5CAXA 4MF7A 2JA7L 3LQ7A 1F3AA 1Z3EA 1AW9A 2GQLA 5G31A 3P7XA 5COHA 2YJHA 2DJ0A 1OKTA 3O76A 2FA4A 2PBJA 2V32A 3DGQA 1S3RA 5M5YL 1TRWA 3PINA 2RLIA 2R5GA 3APOA 2C3TA 1ZOFA 3QVDA 3ED3A 4FYUA 1R9TL 3FW2A 3TDGA 5CREA 2B7KA 1S2ZA 1SD9A 1Q98A 4WBRD 1T1VA 1QK8A 1TTZA 4LMWA 3GSTA 5J4UA 3K35A 4NPBA 3LFLA 3FZ4A 2B7JA 2JI1A 5GAGc 4GF0A 5HFIA 1S3AA 1SD8A 3S2DL 3HOUL 1DE2A 22GSA 2TIRA 4PUAA 3B08B 3PZAA 5HR2A 4RI6A 3VK9A 4POMA 1AQXA 5ECLB 2H1DA 2V1MA 4GXZA 2G2QA 2DJ3A 1ZYEA 4E6YA 1R0IA 1DE1A 2OKAA 2BJXA 3ZREA 1NW2A 13GSA 3KYUA 2VL3A 2ON5A 3IE3A 3GIXA 2QGVA 1EP7A 4AI0A 4BVYA 3D5JA 1F37A 2QA2A 5A4WA 3F0IA 2H72A 3GL3A 4X4JA 3KH7A 1V40A 2PYAA 5KN3A 4J56E 1B48A 2I3YA 1PGTA 2MZCA 1RDVA 1M3IA 2PSMC 3FR6A 4Z2UA 5A4VA 1SFOL 4MZBA 4BBRL 4GLTA 1AAZA 3ERGA 2FWEA 1GUKA 4TVMA 3HJMA 3FY7A 4BPYA 3HJPA 1YY7A 1U3IA 3BOAA 4GRFA 5LD0A 2E2HL 4LHLA 5H5RA 1TRVA 4BVXB 1TRSA 2LTKA 5IPHA 2AB6A 3FKFA 2KUCA 2K18A 4KX4A 1PFUA 5DDLA 4IQAA 2AYJA 4TR1A 2TRXA 3ZFBA 5ID2A 2DJ2A 3FR9A 3TJBA 2DKIA 3RHCA 1GLPA 2IFQA 1TWAL 4RQXA 4EF0A 5J3RA 1AXDA 4POBA 2LJRA 2HYXA 2GVPA 4AHYA 1BYEA 3J7Y1 4AR5A 1MD3A 4PNFA 1I9DA 2IMDA 1VRSD 5IOXA 4A5PA 4NHZA 1PL2A 2PUKC 1ZGNA 1CQHA 1SKSB 2X64A 1UC7A 2A4HA 2KOKA 1RDGA 5GAND 4X6AL 4F03A 1YJ6A 2M72A 3VWVA 4IW9A 4XCSA 5DCHA 3TKPA 2DIZA 5DVBA 5DJMA 5B6NA 3GTPL 2MMAA 2RUEA 1ZYNA 1PL1A 3ERWA 2C3QA 4HDEA 3D0ZA 4G19A 1Z92B 5AIXA 1X9MB 2B5ID 1X5DA 1M9BA 1RWDA 7RXNA 2FY6A 1A8YA 1TP9A 1MEKA 1E6BA 4BWQA 2AUVA 1EP8A 2KLXA 3ME7A 2L5OA 4F82A 1YEPA 1A24A 1HNBA 3C7MA 4Q5FA 2LRTA 4YWLA 4LHNA 1F9MA 2R2JA 3ZFLA 1PSQA 5F06A 2C3NA 2K9FA 4TR0A 3IC4A 1AQVA 4OFTA 1ZRPA 2H74A 4HQSA 1RK4A 3EU3A 3WD6A 4NHWA 3PPUA 2YANA 2ES7A 2HFDA 2MMZA 1YF0A 2LS5A 3H1NA 3M1GA 3S1QL 4P3YB 5AN9H 4MLYA 3F9UA 1T9OA 2H30A 4MNNA 2VM1A 2C1YA 3UEMA 1EWXA 4A3ML 2GS3A 2N5BA 2VM2A 3CXGA 5JCGA 3HKRA 1Q4JA 3NOFA 2CZ2A 2F8FA 1QMVA 2PN8A 2JL4A 1ZMAA 3EVIA 4OCFA 5DALB 4X1UA 4MDCA 3UJ1A 5H5QA 3VI5A 1JZDA 4RUVA 5KOXA 1PFOA 4CY8A 2V6KA 4FIWA 5HFKA 1SMWA 2OBKA 2RM5A 4XS4B 2YCDA 1XXUA 2CAIA 3TKQA 5ECRB 2EIRA 3EURA 3C71A 2JI2A 4ZILA 1HYUA 1YQ1A 1MDKA 4GQCA 6RXNA 5ELGA 1J08A 3BBYA 5IMZA 3HOVL 3IPZA 4JU5A 4OMVA 4TXOB 2CVDA 5L71A 1LBKA 2B6MA 4K9ZA 4BXXL 1YK5A 2R7ZL 2VD1A 5LNKe 2F3MA 3MSZA 1WCML 2PGTA 3I4ML 1FVJA 3EU4A 1H4OA 4MF6A 1XFLA 1ZZYA 3Q18A 1SKWB 3LWVB 3LWPB 4KSOA 3WGDA 2R0GA 4I6XA 3B0AB 2KP1A 5KN0A 2GMGA 3J7Yb 5FJ8L 1BEDA 1KTEA 2F9SA 3KCMA 4G0IA 5AN1A 3OR5A 1GL8A 3KH9A 1KNGA 4K1FA 5DAKB 1TWCL 1SU9A 4A3CL 3L0HA 2OE0A 1M2AA 1PD21 1OC8A 4G10A 4KB3A 2C0EA 1GULA 1E8JA 5CRWA 2OA7A 3PKJA 5IP9L 2JA5L 1XWCA 1T8EB 2GZPA 1TOFA 1BJXA 2WRTA 4QIWP 1MDIA 3TUEA 3HJOA 4KGIA 1V98A 4POFA 4TKYA 3I6AA 4XTSA 1PX7A 3CTGA 5EY6A 1DBYA 4XRAA 5D9VA 4Y7NL 1XG8A 3LW9A 1XWAA 3W6GA 3NZNA 3H97A 4E8EA 2K6VA 2DBCA 2M4YA 1IW7D 2MS3A 3LPEB 1TDIA 3EINA 3TRQA 3Q6OA 2IWTA 2RFKB 5MFPA 3TJKA 2V0FA 2H0IA 2LEGA 2LCQA 4L0UA 1XOAA 3KYVA 3LWOB 1PN0A 5DCGA 4HU7A 1NHOA 4WF4A 1LKOA 4AJ6A 2M6PA 5MLC3 4ML6A 8RXNA 1QCVA 4QQ7A 1OE8A 1H75A 3ZMLA 4JE1A 5C4JL 3F63A 2IPAA 4HEA2 4BBSL 1VZHA 4WBJA 2FLSA 5B8BA 4AR3A 4FH8A 3CMIA 3IK7A 4JAFA 1GSYA 4D73B 3DKSA 3TKSC 2NPBA 5EVOA 3TB2A 5J5NA 4L5OA 2XBIA 5IOWA 1W89A 1NXGA 1GNWA 1U3AA 4A3KL 3A5IA 3RYGA 4MCUA 2OACA 1WJVA 4AHXA 2H76A 2JI3A 2PVQA 4I5QA 4AHWA 2HLSA 4YQVA 3H79A 4HQZA 2YWNA 3HVNA 3TKSA 4TXOA 2IMIA 2HZEB 1I6HL 4HS1A 2F8AA 4I8BA 5IMAA 1HNAA 2MBTA 3IAM2 1O73A 5C04A 3GTKL 2XJRA 4K5RA 5F8BA 3TGZA 3GSSA 3KYXA 4MJBA 4ZN1B 3ZITA 3KM6A 2QC7A 2M6OA 2VL6A 2FWHA 2JZTA 4KCAA 2B1LA 3C1SA 1J0FA 5C3EL 3ERFA 2HZFA 1VF3A 2L59A 3LG6A 2RIIA 2LRNA 3VFIA 4PQ1A 4CY6A 4XXBB 1FO5A 5IMVA 5RXNA 2ERJA 2DJJA 5DAKA 1OC9B 2J9HA 1Z6NA 1A2MA 3HY2A 4WR5A 3NFPI 4JRRA 1SJ6A 4IVFA 2E2IL 2VAFA 3GMFA 4WF5A 2C8UA 5GADc 2IL3A 2OADA 2VIMA 5AIVA 1O8WA 2IIYA 4I97A 9GSSA 1CADA 1AC1A 4K6XA 2M80A 2LUSA 2AHEA 4ZL8A 3NIVA 2GSQA 2D2ZA 1WE0A 1AQWA 5AI3A 1TWHL 4K0NA 1QYBA 1YDKA 1NM3A 3APSA 4KE3A 4EDZA 3FR3A 4AF2A 4WXTA 1GWCA 2YN1A 2EIOA 1T4YA 4CDOA 3FYGA 1JYBA 2CT6A 2CX3A 2VCXA 3U5RE 3IAS2 3KP9A 4H86A 4WR4A 2RM6A 4K7NA 1PMTA 1EGRA 4N30A 2GDRA 1GRXA 3C73A 4YH2A 3TJFA 4F0CA 3D6IA 3UIWA 4XGHA 2C6AA 4E8HA 5ECSA 2VL2C 3VWXA 4JR4A 2YU9L 4D73A 4ZN3B 4Q5NA 1Z6MA 2AQCA 5BMUA 3SS2A 3S15L 4EL1A 1BQ8A 1Y6EA 1FW1A 2DSXA 3MYDA 4V1Ap 1G6YA 2LJKA 4K5SA 1XCCA 3JCML 1OVNA 4Z7XA 5M5XL 19GSA 2L6CA 2R6KA 1XWKA 3ZMKA 3LGCA 1R5PA 4AR6A 4TRXA 1ML6A 5FHIA 4XS6A 2JA8L 2HZEA 3KYWA 1E2YA 4TOPA 3KXOA 2CR8A 5INYA 5JWOB 1TK8B 3IXRA 2FHEA 2WFCA 2P0GA 3CQZL 5FT3A 1Z5YE 3H0GL 2A6HD 4BA7A 3M4OL 2H0HA 2H6YA 6GSUA 4HJMA 5IQYA 17GSA 2CX4A 3LSZA 2O8VB 1K0OA 5IYBL 1K0MA 1T9QA 2GSRA 4KH7A 2MMOA 3N9JA 1QUWA 3SWLA 3EC3A 4JAGA 3F4RA 2B1KA 3GURA 2E2JL 2XJVA 3GTOL 3QR6A 1NXEA 4A3DL 3FK8A 1BG5A 3WT2A 2RUFA 3U6VA 5ECHB 1OC9A 4B8CD 4N10A 2ZUPA 4Y52L 5CRDA 1KBNA 2AUSB 4J57E 3ZZXA 3EWLA 1B8XA 1F6MC 1Z9HA 3RPPA 5IO2A 4PTSA 2PU9C 2H1GA 3MAKA 1U87A 1XBSA 3G9BA 4RQRA 1X5CA 3VWWA 4A3FL 1USBA 3DIEA 3S14L 3UL3A 2GT6A 3HHVA 3CSJA 3S17L 2MBSA 3GX8A 4KW6A 1YF1A 1TK0B 2GT5A 4GSTA 3ZLPA 4LL1B 1NNQA 2IMKA 4PXOA 1R0JA 1WPIA 5F05A 1MD4A 4ACSA 8GSSA 1X0RA 2J23A 3H93A 4K7IA 1EV9A 4ZL7A 4A3EL 4NV2A 2OE3A 5HR1A 1K0NA 4ZL9A 1C72A 1WRYA 5GSTA 4POGA 4NV5A 2O7KA 4ZB6A 1TRUA 4HI7A 3VLNA 3GRXA 5G2ZA 2KP2A 1FB0A 2KHPA 1ZYQB 5DQSA 3WGEA 1WIKA 3ISOA 3TKSE 2ZIXA 4V196 5J41A 2WAQP 2WULA 4G0KA 2NYDA 4BIKA 5KN2A 5CRHA 3IA1A 2CKAA 1K0CA 5B8AA 4HU9A 1T3BA 1OYJA 2H73A 1VF4A 5K2ME 1PFVA 1GTBA 1C09A 2GSTA 4EXJA 1WOUA 5J9BA 2HRKA 4ZBAA 3HDCA 2TRCP 1K0DA 2FWGA 3HZ4A 5D9XA 4F9ZA 2VL9A 1JZWA 4G0LA 2BE5D 3WWLA 1FHMA 4FO5A 1XZOA 2H70A 1O7UA 2HE3A 4LL4B 1B13A 5CP1A 2O89A 1JFUA 2AV4A 2QL0A 3H4KA 4A3JL 2CAQA 4A3GL 5A5KA 3J7Z1 2NVXL 1R7HA 2LKUA 3QCPA 3QQCE 3FRCA 5J9CA 3UVTA 1ST9A 2C6BA 5ECKB 1Y1WL 5CRGA 2P31A 3M9JA 1LKMA 4WETA 1PN9A 4LA1A 3JR7A 4O5RA 2VUML 1M7TA 4EC0A 1SL2B 2H19A 4ZXGA 1ZL9A 5JVG1 4AJ8A 1K3OA 2VO4A 4WFN1 2YZHA 3F4TA 3GV1A 2PWJA 3AY8A 3QFAC 2YPMA 5IPGA 1SYRA 5D73A 4MJAA 4HOJA 1XVWA 3GL5A 5EINC 2C0FA 4KSMA 1GNEA 4BVXA 1GSQA 1V57A 2EIQA 1RYQA 4DSQA 2IMEA 3LEFA 2VCZA 2PERA 2B5EA 3DMLA 3I9V2 3LWQB 3G7YA 5D8IA 2MMNA 5HR3A 3MQKB 1B4QA 3TJJA 1XW6A 4KUNA 2ZCTA 1R26A 1X5EA 3K7AL 2YWMA 2H75A 2X8CA 2R3XA 2P5QA 4G9HA 1U88A 4F2IA 3P8BA 5IYDL 3DYRA 1JLVA 4GS7D 2ALBA 3IBHA 2CQ9A 1SJZA 3HJWB 4OD7A 5AI2A 2LSTA 3GN3A 1YZXA 5DBQA 1GSUA 3VPBE 2FGXA 3G7JA 1BQ7A 5HR0A 2N5AA 3A2XA 1I5GA 2P5RA 1M3JA 3RZOL 1AIUA 3PWFA 4L5LA 1RYTA 2ON7A 4EIQA 2C0GA 3US3A 3DD3A 3LORA 2YV7A 3H3VM 1GUHA 1QXHA 5G1LA 4DVCA 1LJRA 2B63L 2L4CA 4IP1A 4IS0A 2V41A 3GUSA 3C8EA 1BRFA 3KYYA 3KMNA 2YOIA 2I4AA 2JADA 1Y1VL 4JADA 3ZIJA 1OE7A 3H99A 3I4NL 1JHBA 2LQQA 1LKPA 1YUXA 3LWRB 1UN2A 2C4JA 2CKCA 3D22A 2R0CA 4AR4A 5M5WL 1ZCPA 3L9VA 2GLRA 3KGKA 14GSA 1SENA 2H6ZA 4MH3A 4ILFA 4A3LL 2HVYC 3ZRDA 1JZRA 3F8UA 4EIPA 5DM61 1BAYA 3N5OA 3QOUA 1XW9A 1RQMA 1GSFA 2R37A 5A4UA 4TPUA 2H71A 4HUAA 4C3JL 2XJSA 3IV4A 3GKNA 2O85A 4TN8A 3HXSA 3BCKA 1FVKA 3HZ8A 4X43A 2X49A 3I43A 5D9TA 3GH6A 1G7OA 2LV3A 5EL8A 3F4SA 4U671 2BMXA 3D4TA 3GKMA 3IOSA 2LRCA 4DEJA 3VWUA 2JSYA 1F4LA 1GUMA 1TJDA 4X0XA 2PVOC 2YZUA 4L0WA 1GLQA 4IQ1A 4Z2TA 3PH9A 5IP7L 2YJ7A 4YAVA 2GSSA 5IMFA 3TRPA 1BFYA 2GZZA 2M4VA 1GSSA 3HVSA 5DALA 1URMA 2FNOA 3ZIVA 3C1RA 4AJ7A 2VLTA 1VF1A 2H12A 3I69A 1M0UA 3MNGA 3QAVA 5ECMB 4EO3A 1OAZA 5ECQB 3RZDL 4KCEA 4XS4A 1SYXA 4AI2A 4PUFC 4PGTA 5ECOB 4GCIA 5F07A 2APOB 1PZXA 5D93A 4K2XA 5JWRB 4IJIA 1PKWA 2H1AA 3A3TA 4YKFA 5HQPA 1TU7A 2A2RA 4A93L 2FD3A 4BY7L 6GSVA 2YNXA 4TXVA 2PVEA 2DMMA 2J9UB 4EUYA 2YWIA 4PQIA 4EE0A 3R3EA 4ZBDA 1TWGL 2C0DA 2BTOT 1A8LA 2G0FA 3E0UA 5D9WA 2K2DA 5CO3A 2HR5A 2XC2A 4GQFA 5MGNA 3KD0A 3IU3I 1N2AA 1CQGA 4N0VA 3S1ML 1TKDB 3QFBC 4OO4A 4TW5A 1S24A 3FZ5A 2X4AA 4ZB9A 5IYCL 1Z7RA 4AI3A 4JEDA 3UMAA 1EEJA 3GKKA 1ERWA 2HNLA 4K7OA 2JU5A 3IR4A 1VF2A 4BY1L 1RB9A 2XBQA 5IO0A 4O92A 4MH2A 1SK1A 3BD2A 3L78A 3TOTA 4CW9A 1A0FA 5KN1A 4KA0A 3KTLA 1QQTA 2R93L 5C00A 4AI1A 5GAEc 1XOBA 2E2MA 2XHFA 5GAPD 1B9XC 2WZ9A 5G30A 4ISDA 2X8HA 3H8QA 2XJPA 4MJCA 3LXTA 1HNCA 2FUG2 3F6FA 4DSRA 1FOHA 3F3QA 2GTUA 3FZAA 4BL7B 4O7HA 3M3YL 5ECIB 5FWGA 3HAXC 1NHYA 4V1Ag 3DVXA 3UBKA 2HSMA 3GTQL 2CA8A 3IRAA 1FOVA 4J2FA 1T4ZA 2H1BA 1FHEA 1GP1A 4G6BA 1YKAA 2NVLA 4TR1B 3EE2A 2YWOA 2YP6A 5JCWA 1EZKA 3QAWA 2H01A 1R0FA 1HD2A 3FDJA 2HRNA 4HJ2A 5ECPB 4K0GA 2I81A 1ACVA 4KAEA 2V2GA 4QL9A 2DJKA 4F0BA 2V6OA 2GGTA 1JLWA 3RHBA 2E7PA 1NSWA 6GSXA 3KEBA 3BJ5A 3CRTA 1EOHA 2I9HA 1ABAA 1PQNA 3CQFA 3D21A 1QFNA 1JZOA 3WWNB 2JZSA 4K9FA 3MWHA 4ECJA 2HSYA 3ZVJD 1H7VA 3APQA 1K0AA 1R0HA 3PO3L 2O5JD 4IBPA 3QAGA 4RXNA 4MZCA 2VL2A 1XVQA 1XWBA 4V2LA 1SKRB 4MPGA 3S1NL 3UAPA 3VPQA 5GSSA 5DJLA 6GSWA 3LYKA 2JACA 3GA4A 1SL0B 3GX0A 3VURA 3CYNA 1GSEA 3VI7A 2ZNMA 4NXIA 1X9WB 3J7Yk 1XW5A 4GSSA 4FYCA 3A2VA 4GTUA 1K3LA 3QMXA 4KDXA 2CVBA 3GTML 1G0TA 1O8XA 1M9AA 1PRXA 2VOCA 5G1KA 1K0BA 1UA5A 4L8EA 3O6TA 1DSBA 1P7PA 3CTFA 4MK3A 1A2LA 3LWAA 1AUCA 20GSA 1X9SB 3M9KA 2LJAA 3LXZA 3EPTA 3HVVA 3EYTA 1G6WA 5H1Sc 1FHHA 1GTAA 4IJ3A 3W8SA 3A2WA 5IY0A 2B5YA 4ULXA 5IMDA 1I3QL 4N11A 3DXBA 1PA3A 2HI7A 2Z3RB 1U6TA 5DM71 5IIZA 3KJYA 4PQHA 4MZWA 4FQUA 3RZ6A 3GTGL 3HVXA 3RAZA 3ZYWA 1PKZA 1DUGA 1R4WA 2PPTA 4POLA 1GH2A 5B6MA 3CBUA 2HRFA 4YWMA 4JZQA 5KEJA 3L9UA 4OFNA 1A0RP 1TWFL 1XWGA 5M3ML 3DVWA 4BL7A 2LNSA 1OWCA 1VCXA 1DVBA
chains in the Genus database with same CATH topology
1FB6A 2E2GA 5CNWA 4OO5A 3GKXA 3FHKA 1M99A 4ZBBA 3WGXA 3F6DA 4CHSA 1TW9A 3S9FA 10GSA 3RPNA 2PMTA 4HZ4A 5KOWA 4XS1A 3IHGA 1CAAA 2V3BB 1EGOA 4K8MA 3UVHA 2DC5A 5E59A 4TR4A 6GSYA 1UVZA 2NTOA 3E3EA 2MYGA 4Q5QA 4ML1A 2YV9A 1V9WA 5G5FA 1TI1A 3UARA 1F2EA 5IM9A 3EMXA 4MA9A 5DQYA 1TK5B 3HCZA 3ZL5A 2OJLA 1SK2A 4KNDA 2QA1A 1A2JA 3TOUA 1SL1B 2KKDA 2FCHA 5AISA 2VCQA 4MPFA 2VCVA 4NAXA 3DEXA 1BE7A 5ABRA 18GSA 3VPTA 1V58A 2PVXA 2EC4A 1GSDA 2IN3A 2H6XA 1VGLA 3L4NA 16GSA 4IN0A 5EIOC 1S3DA 2HXKA 5EPFA 4MP4A 2OE1A 2A69D 1WWJA 1M2DA 1V2AA 4Q5RA 2V0EA 4DSSB 2GZYA 1IYIA 3MIXA 4ZB8A 4EDYA 3GNJA 2CV4A 2ERSA 3QDNA 1FG4A 2NBSA 4YQUA 2VUPA 4IHUA 5ELAA 1O85A 4EVMA 1B2OA 2WCIA 4MMMA 4LMVA 1LTLA 3LJRA 1T9PA 2HSHA 2H0GA 4XIHA 3M8NA 1EV4A 1SMUA 3ZTLA 2VCWA 3IDVA 3ZVJA 1YK4A 4I2UA 4O5QA 1S30A 2OBIA 5ENUA 3WT1A 3CSHA 5F0GA 1F3BA 5MF6A 1YEXA 3E9JB 3A44A 2WGRA 2XJQA 1OKDA 1QQ2A 1TI3A 3PKIA 2XPEA 2DMLA 3RBTA 2X99A 2L0ZA 3PIP1 2WDUA 1R5AA 2L57A 4TVEA 2JSZA 2QSIA 5JWQB 1W4VA 4PX1A 2VLUA 2GQKA 11GSA 4YQMA 1BX9A 2A2SA 4MJEA 2XPDA 4OCEA 4JAEA 1GTIA 3EMPA 5GZZB 2AJQB 1G7EA 5G5EA 2H66A 3DRNA 1IYHA 3GTUB 4OWYA 3GYKA 5AGYA 1EOGA 5D96A 3QPMA 6GSTA 3MPSA 12GSA 4NWYA 2WS2A 1WMJA 2Z9SA 5JCUA 1R0GA 3TJGA 3CRUA 3RDWA 2LQOA 1B2JA 1ODHA 3F3RA 1THOA 1OC3A 3PR8A 3GH9A 4N0ZA 3IC8A 1PX6A 1J9BA 2CVKA 3L9SA 4KDYA 4USSA 3KIJA 3UOMA 1SMMA 2IMFA 1FAAA 2K8SA 2A4VA 4MABA 2NDOA 3M0FA 1OWBA 1K3YA 4AHZA 4XRDA 2VD0A 3D4MA 3HYPA 1VZIA 3WYWA 1IU5A 2Z3QB 3LYPA 1WP0A 4XHMA 4KF9A 3CSIA 1ERUA 2HRAA 3KP8A 3HA9A 1A23A 3O3TA 2KN9A 4O5UA 2IJYA 4FYBA 2RDVA 2HT9A 5HFGA 4DSSA 1XPVA 1YV1A 2QKEA 5LCZA 1S3CA 4JBBA 2DIYA 1Y25A 4IP6A 2XJTA 2CZ3A 4K2DA 3FZ9A 1ERTA 2XJUA 4YKGA 2FA8A 3TCOA 2FWFA 1XIYA 3FMWA 1TU8A 4EKZA 3MDKA 4ECIA 4MF5A 1KEBA 2VLVA 4RI7A 2WB9A 1B9YC 6GSSA 4I2TA 2K8VA 3QD9A 2REMA 3Q19A 4JR6A 3LNLA 3A5WA 1EEMA 2M46A 2B5XA 2GQMA 4POKA 1WJKA 5E4WA 4ECCA 2DJ1A 4ICYA 2AYTA 2N5FA 3BCIA 1RW1A 2A6ED 4NMUA 1LU4A 1ILOA 2F51A 4HZ2A 3KMOA 1SJIA 2B3SA 4BWSA 4AGSA 5ECNB 4O32A 3IHQA 4V2NA 1YUZA 2DSAA 4IGJA 3DWVA 3MSUA 4IKHA 2H8LA 3KTBA 1B71A 3GTUA 4TR3A 3K8NA 2JZRA 5BRTA 2X8GA 3IK9A 1IU6A 5GAHc 2DLXA 1O81A 3PIO1 2O87A 4QL7A 4IELA 1T7PB 2UZ8A 1DX8A 3GFKA 2LNTA 2E0QA 1MDJA 1THXA 3P8WA 2VCTA 1ON4A 4ID0A 4PURA 4ME3A 4ECBA 3ZG6A 3V1WA 2R4VA 1SK0A 3PGTA 1VZGA 3G7IA 3P2AA 4WEYA 5IMCA 5H5SA 3ME8A 4BVYB 1HQOA 1N8JA 4GSNA 1IROA 1T00A 2AAWA 1TXXA 3KZQA 5B7CA 3HD5A 2L5LA 1B4PA 3UBLA 3FEUA 2L4QA 3RZTA 4UY81 5JVH1 2A2PA 4GWRA 3TRXA 1YKCA 1ERVA 1M2BA 2WJUA 4WKWA 2A68D 2C80A 3P90A 1O6JA 2R0PA 1MTCA 5CYYA 1BQ9A 4LLRA 1ZYPA 3W8JA 4KDUA 3TKRA 3GHAA 1QGVA 1IRNA 3SBCA 2DKHA 1GTUA 3Q74A 5ID2B 3M3MA 4OFMA 4V2MA 4ZIJA 5MFZA 2L6DA 2I1UA 4G2EA 4PNGA 2IFQB 1Z7PA 4YAPA 7GSSA 3R2QA 4Z2RA 5CAXA 4MF7A 3LQ7A 1F3AA 1Z3EA 1AW9A 2GQLA 5G31A 3P7XA 5COHA 2YJHA 2DJ0A 1OKTA 3O76A 2FA4A 2PBJA 2V32A 3DGQA 1TRWA 3PINA 2RLIA 2R5GA 3APOA 2C3TA 1ZOFA 3QVDA 3ED3A 4FYUA 3FW2A 3TDGA 5CREA 2B7KA 1S2ZA 1SD9A 1Q98A 4WBRD 1T1VA 1QK8A 1TTZA 4LMWA 3GSTA 5J4UA 3K35A 4NPBA 3LFLA 3FZ4A 2B7JA 2JI1A 5GAGc 4GF0A 5HFIA 1S3AA 1SD8A 1DE2A 22GSA 2TIRA 4PUAA 3B08B 3PZAA 5HR2A 4RI6A 3VK9A 4POMA 1AQXA 5ECLB 2H1DA 2V1MA 4GXZA 2G2QA 2DJ3A 1ZYEA 4E6YA 1R0IA 1DE1A 2OKAA 2BJXA 3ZREA 1NW2A 13GSA 3KYUA 2VL3A 2ON5A 3IE3A 3GIXA 2QGVA 1EP7A 4AI0A 4BVYA 3D5JA 1F37A 2QA2A 5A4WA 3F0IA 2H72A 3GL3A 4X4JA 3KH7A 1V40A 2PYAA 5KN3A 4J56E 1B48A 2I3YA 1PGTA 2MZCA 1RDVA 2PSMC 3FR6A 4Z2UA 5A4VA 4MZBA 4GLTA 1AAZA 3ERGA 2FWEA 1GUKA 4TVMA 3HJMA 3FY7A 4BPYA 3HJPA 1YY7A 1U3IA 3BOAA 4GRFA 5LD0A 4LHLA 5H5RA 1TRVA 4BVXB 1TRSA 2LTKA 5IPHA 2AB6A 3FKFA 2KUCA 2K18A 4KX4A 5DDLA 4IQAA 2AYJA 4TR1A 2TRXA 3ZFBA 5ID2A 2DJ2A 3FR9A 3TJBA 2DKIA 3RHCA 1GLPA 2IFQA 4RQXA 4EF0A 5J3RA 1AXDA 4POBA 2LJRA 2HYXA 2GVPA 4AHYA 1BYEA 3J7Y1 4AR5A 1MD3A 4PNFA 1I9DA 2IMDA 1VRSD 5IOXA 4A5PA 4NHZA 1PL2A 2PUKC 1ZGNA 1CQHA 1SKSB 2X64A 1UC7A 2A4HA 2KOKA 1RDGA 5GAND 4F03A 1YJ6A 2M72A 3VWVA 4IW9A 4XCSA 5DCHA 3TKPA 2DIZA 5DVBA 5DJMA 5B6NA 2MMAA 2RUEA 1ZYNA 1PL1A 3ERWA 2C3QA 4HDEA 3D0ZA 4G19A 1Z92B 5AIXA 1X9MB 2B5ID 1X5DA 1M9BA 1RWDA 7RXNA 2FY6A 1A8YA 1TP9A 1MEKA 1E6BA 4BWQA 2AUVA 1EP8A 2KLXA 3ME7A 2L5OA 4F82A 1YEPA 1A24A 1HNBA 3C7MA 4Q5FA 2LRTA 4YWLA 4LHNA 1F9MA 2R2JA 3ZFLA 1PSQA 5F06A 2C3NA 2K9FA 4TR0A 3IC4A 1AQVA 4OFTA 1ZRPA 2H74A 4HQSA 1RK4A 3EU3A 3WD6A 4NHWA 3PPUA 2YANA 2ES7A 2HFDA 2MMZA 1YF0A 2LS5A 3H1NA 3M1GA 4P3YB 5AN9H 4MLYA 3F9UA 1T9OA 2H30A 4MNNA 2VM1A 2C1YA 3UEMA 1EWXA 2GS3A 2N5BA 2VM2A 3CXGA 5JCGA 3HKRA 1Q4JA 3NOFA 2CZ2A 2F8FA 1QMVA 2PN8A 2JL4A 1ZMAA 3EVIA 4OCFA 5DALB 4X1UA 4MDCA 3UJ1A 5H5QA 3VI5A 1JZDA 4RUVA 5KOXA 4CY8A 2V6KA 4FIWA 5HFKA 1SMWA 2OBKA 2RM5A 4XS4B 2YCDA 1XXUA 2CAIA 3TKQA 5ECRB 2EIRA 3EURA 3C71A 2JI2A 4ZILA 1HYUA 1YQ1A 1MDKA 4GQCA 6RXNA 5ELGA 1J08A 3BBYA 5IMZA 3IPZA 4JU5A 4OMVA 4TXOB 2CVDA 5L71A 1LBKA 2B6MA 4K9ZA 1YK5A 2VD1A 5LNKe 2F3MA 3MSZA 2PGTA 1FVJA 3EU4A 1H4OA 4MF6A 1XFLA 1ZZYA 3Q18A 1SKWB 4KSOA 3WGDA 2R0GA 4I6XA 3B0AB 2KP1A 5KN0A 2GMGA 3J7Yb 1BEDA 4G0IA 1KTEA 2F9SA 3KCMA 5AN1A 3OR5A 1GL8A 3KH9A 1KNGA 4K1FA 5DAKB 1SU9A 3L0HA 2OE0A 1M2AA 1PD21 1OC8A 4G10A 4KB3A 2C0EA 1GULA 1E8JA 5CRWA 2OA7A 3PKJA 1XWCA 1T8EB 2GZPA 1TOFA 1BJXA 2WRTA 1MDIA 3TUEA 3HJOA 4KGIA 1V98A 4POFA 4TKYA 3I6AA 4XTSA 1PX7A 3CTGA 5EY6A 1DBYA 4XRAA 5D9VA 3LW9A 1XWAA 3W6GA 3NZNA 4E8EA 2K6VA 2DBCA 2M4YA 1IW7D 2MS3A 3LPEB 1TDIA 3EINA 3TRQA 3Q6OA 2IWTA 5MFPA 3TJKA 2V0FA 2H0IA 2LEGA 2LCQA 4L0UA 1XOAA 3KYVA 1PN0A 5DCGA 4HU7A 1NHOA 4WF4A 1LKOA 4AJ6A 2M6PA 5MLC3 4ML6A 8RXNA 1QCVA 4QQ7A 1OE8A 1H75A 3ZMLA 4JE1A 3F63A 2IPAA 4HEA2 1VZHA 4WBJA 2FLSA 5B8BA 4AR3A 4FH8A 3CMIA 3IK7A 4JAFA 1GSYA 4D73B 3DKSA 3TKSC 2NPBA 5EVOA 3TB2A 5J5NA 4L5OA 2XBIA 5IOWA 1W89A 1NXGA 1GNWA 1U3AA 3A5IA 3RYGA 4MCUA 2OACA 1WJVA 4AHXA 2H76A 2JI3A 2PVQA 4I5QA 4AHWA 2HLSA 4YQVA 3H79A 4HQZA 2YWNA 3TKSA 4TXOA 2IMIA 2HZEB 4HS1A 2F8AA 4I8BA 5IMAA 1HNAA 2MBTA 3IAM2 1O73A 5C04A 2XJRA 4K5RA 5F8BA 3TGZA 3GSSA 3KYXA 4MJBA 4ZN1B 3ZITA 3KM6A 2QC7A 2M6OA 2VL6A 2FWHA 2JZTA 4KCAA 2B1LA 3C1SA 1J0FA 3ERFA 2HZFA 1VF3A 2L59A 3LG6A 2RIIA 2LRNA 3VFIA 4PQ1A 4CY6A 4XXBB 1FO5A 5IMVA 5RXNA 2ERJA 2DJJA 5DAKA 1OC9B 2J9HA 1Z6NA 1A2MA 3HY2A 4WR5A 3NFPI 4JRRA 1SJ6A 4IVFA 2VAFA 3GMFA 4WF5A 2C8UA 5GADc 2IL3A 2OADA 2VIMA 5AIVA 1O8WA 2IIYA 4I97A 9GSSA 1CADA 1AC1A 4K6XA 2M80A 2LUSA 2AHEA 4ZL8A 3NIVA 2GSQA 2D2ZA 1WE0A 1AQWA 5AI3A 4K0NA 1QYBA 1YDKA 1NM3A 3APSA 4KE3A 4EDZA 3FR3A 4AF2A 4WXTA 1GWCA 2YN1A 2EIOA 1T4YA 4CDOA 3FYGA 1JYBA 2CT6A 2CX3A 2VCXA 3U5RE 3IAS2 3KP9A 4H86A 4WR4A 2RM6A 4K7NA 1PMTA 1EGRA 4N30A 2GDRA 1GRXA 3C73A 4YH2A 3TJFA 4F0CA 3D6IA 3UIWA 4XGHA 2C6AA 4E8HA 5ECSA 2VL2C 3VWXA 4JR4A 4D73A 4ZN3B 4Q5NA 1Z6MA 5BMUA 3SS2A 4EL1A 1BQ8A 1Y6EA 1FW1A 2DSXA 3MYDA 4V1Ap 1G6YA 2LJKA 4K5SA 1XCCA 3JCML 1OVNA 4Z7XA 19GSA 2L6CA 2R6KA 1XWKA 3ZMKA 3LGCA 1R5PA 4AR6A 4TRXA 1ML6A 5FHIA 4XS6A 2HZEA 3KYWA 1E2YA 4TOPA 3KXOA 2CR8A 5INYA 5JWOB 1TK8B 3IXRA 2FHEA 2WFCA 2P0GA 5FT3A 1Z5YE 2A6HD 4BA7A 2H0HA 2H6YA 6GSUA 4HJMA 5IQYA 17GSA 2CX4A 3LSZA 2O8VB 1K0OA 1K0MA 1T9QA 2GSRA 4KH7A 2MMOA 3N9JA 1QUWA 3SWLA 3EC3A 4JAGA 3F4RA 2B1KA 3GURA 2XJVA 3QR6A 1NXEA 3FK8A 1BG5A 3WT2A 2RUFA 3U6VA 5ECHB 1OC9A 4B8CD 4N10A 2ZUPA 5CRDA 1KBNA 4J57E 3ZZXA 3EWLA 1B8XA 1F6MC 1Z9HA 3RPPA 5IO2A 4PTSA 2PU9C 2H1GA 3MAKA 1U87A 1XBSA 3G9BA 4RQRA 1X5CA 3VWWA 1USBA 3DIEA 3UL3A 2GT6A 3HHVA 3CSJA 2MBSA 3GX8A 4KW6A 1YF1A 1TK0B 2GT5A 4GSTA 3ZLPA 4LL1B 1NNQA 2IMKA 4PXOA 1R0JA 1WPIA 5F05A 1MD4A 4ACSA 8GSSA 1X0RA 2J23A 3H93A 4K7IA 1EV9A 4ZL7A 4NV2A 2OE3A 5HR1A 1K0NA 4ZL9A 1C72A 1WRYA 5GSTA 4POGA 4NV5A 2O7KA 4ZB6A 1TRUA 4HI7A 3VLNA 3GRXA 5G2ZA 2KP2A 1FB0A 2KHPA 1ZYQB 5DQSA 3WGEA 1WIKA 3ISOA 3TKSE 2ZIXA 4V196 5J41A 2WULA 4G0KA 2NYDA 5KN2A 5CRHA 3IA1A 2CKAA 1K0CA 5B8AA 4HU9A 1T3BA 1OYJA 2H73A 1VF4A 5K2ME 1GTBA 1C09A 2GSTA 4EXJA 1WOUA 5J9BA 2HRKA 4ZBAA 3HDCA 2TRCP 1K0DA 2FWGA 3HZ4A 5D9XA 4F9ZA 2VL9A 1JZWA 4G0LA 2BE5D 3WWLA 1FHMA 4FO5A 1XZOA 2H70A 1O7UA 2HE3A 4LL4B 1B13A 5CP1A 2O89A 1JFUA 2AV4A 2QL0A 3H4KA 2CAQA 5A5KA 3J7Z1 1R7HA 2LKUA 3QCPA 3QQCE 3FRCA 5J9CA 3UVTA 1ST9A 2C6BA 5ECKB 5CRGA 2P31A 3M9JA 1LKMA 4WETA 1PN9A 4LA1A 4O5RA 1M7TA 4EC0A 1SL2B 2H19A 4ZXGA 1ZL9A 5JVG1 4AJ8A 1K3OA 2VO4A 4WFN1 2YZHA 3F4TA 3GV1A 2PWJA 3AY8A 3QFAC 2YPMA 5IPGA 1SYRA 5D73A 4MJAA 4HOJA 1XVWA 3GL5A 5EINC 2C0FA 4KSMA 1GNEA 4BVXA 1GSQA 1V57A 2EIQA 1RYQA 4DSQA 2IMEA 3LEFA 2VCZA 2PERA 2B5EA 3DMLA 3I9V2 3G7YA 5D8IA 2MMNA 5HR3A 1B4QA 3TJJA 1XW6A 4KUNA 2ZCTA 1R26A 1X5EA 2YWMA 2H75A 2X8CA 2R3XA 2P5QA 4G9HA 1U88A 4F2IA 3P8BA 3DYRA 1JLVA 4GS7D 2ALBA 3IBHA 2CQ9A 1SJZA 4OD7A 5AI2A 2LSTA 3GN3A 1YZXA 5DBQA 1GSUA 3VPBE 2FGXA 3G7JA 1BQ7A 5HR0A 2N5AA 3A2XA 1I5GA 2P5RA 1AIUA 3PWFA 4L5LA 1RYTA 2ON7A 4EIQA 2C0GA 3US3A 3DD3A 3LORA 2YV7A 1GUHA 1QXHA 5G1LA 4DVCA 1LJRA 2L4CA 4IP1A 4IS0A 2V41A 3GUSA 3C8EA 1BRFA 3KYYA 3KMNA 2YOIA 2I4AA 2JADA 4JADA 3ZIJA 1OE7A 1JHBA 2LQQA 1LKPA 1YUXA 1UN2A 2C4JA 2CKCA 3D22A 2R0CA 4AR4A 1ZCPA 3L9VA 2GLRA 3KGKA 14GSA 1SENA 2H6ZA 4MH3A 4ILFA 3ZRDA 1JZRA 3F8UA 4EIPA 5DM61 1BAYA 3N5OA 3QOUA 1XW9A 1RQMA 1GSFA 2R37A 5A4UA 4TPUA 2H71A 4HUAA 2XJSA 3IV4A 3GKNA 2O85A 4TN8A 3HXSA 3BCKA 1FVKA 3HZ8A 4X43A 2X49A 3I43A 5D9TA 3GH6A 1G7OA 2LV3A 5EL8A 3F4SA 4U671 2BMXA 3IOSA 3D4TA 3GKMA 2LRCA 4DEJA 3VWUA 2JSYA 1GUMA 1TJDA 4X0XA 2PVOC 2YZUA 4L0WA 1GLQA 4IQ1A 4Z2TA 3PH9A 2YJ7A 4YAVA 2GSSA 5IMFA 3TRPA 1BFYA 2GZZA 2M4VA 1GSSA 3HVSA 5DALA 1URMA 2FNOA 3ZIVA 3C1RA 4AJ7A 2VLTA 1VF1A 2H12A 3I69A 1M0UA 3MNGA 3QAVA 5ECMB 4EO3A 1OAZA 5ECQB 4KCEA 4XS4A 1SYXA 4AI2A 4PUFC 4PGTA 5ECOB 4GCIA 5F07A 5D93A 4K2XA 5JWRB 4IJIA 1PKWA 2H1AA 3A3TA 4YKFA 5HQPA 1TU7A 2A2RA 2FD3A 6GSVA 2YNXA 4TXVA 2PVEA 2DMMA 2J9UB 4EUYA 2YWIA 4PQIA 4EE0A 3R3EA 4ZBDA 2C0DA 2BTOT 1A8LA 2G0FA 3E0UA 5D9WA 2K2DA 5CO3A 2HR5A 2XC2A 4GQFA 5MGNA 3KD0A 3IU3I 1N2AA 1CQGA 4N0VA 1TKDB 3QFBC 4OO4A 4TW5A 1S24A 3FZ5A 2X4AA 4ZB9A 1Z7RA 4AI3A 4JEDA 3UMAA 1EEJA 3GKKA 1ERWA 2HNLA 4K7OA 2JU5A 3IR4A 1VF2A 1RB9A 2XBQA 5IO0A 4O92A 4MH2A 1SK1A 3BD2A 3L78A 3TOTA 4CW9A 1A0FA 5KN1A 4KA0A 3KTLA 5C00A 4AI1A 5GAEc 1XOBA 2E2MA 2XHFA 5GAPD 1B9XC 2WZ9A 5G30A 4ISDA 2X8HA 3H8QA 2XJPA 4MJCA 3LXTA 1HNCA 2FUG2 3F6FA 4DSRA 1FOHA 3F3QA 2GTUA 3FZAA 4BL7B 4O7HA 5ECIB 5FWGA 1NHYA 4V1Ag 3DVXA 3UBKA 2HSMA 2CA8A 3IRAA 1FOVA 4J2FA 1T4ZA 2H1BA 1FHEA 1GP1A 4G6BA 1YKAA 2NVLA 4TR1B 3EE2A 2YWOA 2YP6A 5JCWA 1EZKA 3QAWA 2H01A 1R0FA 1HD2A 2HRNA 4HJ2A 5ECPB 4K0GA 2I81A 1ACVA 4KAEA 2V2GA 4QL9A 2DJKA 4F0BA 2V6OA 2GGTA 1JLWA 3RHBA 2E7PA 1NSWA 6GSXA 3KEBA 3BJ5A 3CRTA 1EOHA 2I9HA 1ABAA 1PQNA 3D21A 1QFNA 1JZOA 3WWNB 2JZSA 4K9FA 3MWHA 4ECJA 2HSYA 3ZVJD 1H7VA 3APQA 1K0AA 1R0HA 2O5JD 4IBPA 3QAGA 4RXNA 4MZCA 2VL2A 1XVQA 1XWBA 4V2LA 1SKRB 4MPGA 3UAPA 3VPQA 5GSSA 5DJLA 6GSWA 3LYKA 2JACA 3GA4A 1SL0B 3GX0A 3VURA 3CYNA 1GSEA 3VI7A 2ZNMA 4NXIA 1X9WB 3J7Yk 4GSSA 1XW5A 4GTUA 4FYCA 3A2VA 1K3LA 3QMXA 4KDXA 2CVBA 1G0TA 1O8XA 1M9AA 1PRXA 2VOCA 5G1KA 1K0BA 1UA5A 4L8EA 3O6TA 1DSBA 3CTFA 4MK3A 1A2LA 3LWAA 1AUCA 20GSA 1X9SB 3M9KA 2LJAA 3LXZA 3EPTA 3HVVA 3EYTA 1G6WA 5H1Sc 1FHHA 1GTAA 4IJ3A 3W8SA 3A2WA 5IY0A 2B5YA 4ULXA 5IMDA 4N11A 3DXBA 1PA3A 2HI7A 2Z3RB 1U6TA 5DM71 5IIZA 3KJYA 4PQHA 4MZWA 4FQUA 3RZ6A 3HVXA 3RAZA 3ZYWA 1PKZA 1DUGA 1R4WA 2PPTA 4POLA 1GH2A 5B6MA 3CBUA 2HRFA 4YWMA 4JZQA 5KEJA 3L9UA 4OFNA 1A0RP 1XWGA 3DVWA 4BL7A 2LNSA 1OWCA 1VCXA 1DVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FB6 A;  2E2G A;  5CNW A;  4OO5 A;  3GKX A;  3FHK A;  1M99 A;  4ZBB A;  3WGX A;  3F6D A;  4CHS A;  1TW9 A;  3S9F A;  10GS A;  3RPN A;  2PMT A;  4HZ4 A;  4XS1 A;  1EGO A;  4K8M A;  3UVH A;  2DC5 A;  5E59 A;  4TR4 A;  6GSY A;  1UVZ A;  2NTO A;  3E3E A;  2MYG A;  4Q5Q A;  4ML1 A;  2YV9 A;  1V9W A;  5G5F A;  1TI1 A;  3UAR A;  1F2E A;  5IM9 A;  3EMX A;  4MA9 A;  5DQY A;  1TK5 B;  3HCZ A;  3ZL5 A;  2OJL A;  1SK2 A;  4KND A;  1A2J A;  3TOU A;  1SL1 B;  2FCH A;  5AIS A;  2VCQ A;  4MPF A;  2VCV A;  4NAX A;  3DEX A;  5ABR A;  18GS A;  3VPT A;  1V58 A;  2EC4 A;  1GSD A;  2IN3 A;  2H6X A;  1VGL A;  3L4N A;  16GS A;  4IN0 A;  1S3D A;  2HXK A;  5EPF A;  4MP4 A;  2OE1 A;  1WWJ A;  1M2D A;  1V2A A;  4Q5R A;  4DSS B;  2GZY A;  1IYI A;  4ZB8 A;  4EDY A;  3GNJ A;  2CV4 A;  3QDN A;  1FG4 A;  2NBS A;  4YQU A;  2VUP A;  4IHU A;  5ELA A;  1O85 A;  4EVM A;  2WCI A;  4MMM A;  4LMV A;  3LJR A;  2HSH A;  2H0G A;  4XIH A;  3M8N A;  1EV4 A;  3ZTL A;  2VCW A;  3IDV A;  3ZVJ A;  4I2U A;  5ENU A;  2OBI A;  3WT1 A;  3CSH A;  5F0G A;  1F3B A;  1YEX A;  3E9J B;  2WGR A;  1OKD A;  1QQ2 A;  1TI3 A;  2XPE A;  2DML A;  3RBT A;  2X99 A;  2WDU A;  1R5A A;  2L57 A;  4TVE A;  2JSZ A;  2QSI A;  5JWQ B;  1W4V A;  4PX1 A;  2VLU A;  2GQK A;  11GS A;  4YQM A;  1BX9 A;  2A2S A;  4MJE A;  2XPD A;  4OCE A;  1GTI A;  3EMP A;  5GZZ B;  2AJQ B;  1G7E A;  5G5E A;  2H66 A;  3DRN A;  1IYH A;  3GTU B;  4OWY A;  3GYK A;  5AGY A;  1EOG A;  5D96 A;  3QPM A;  6GST A;  12GS A;  4NWY A;  2WS2 A;  1WMJ A;  2Z9S A;  5JCU A;  3TJG A;  3CRU A;  3RDW A;  2LQO A;  3F3R A;  1THO A;  1OC3 A;  3PR8 A;  3GH9 A;  4N0Z A;  1PX6 A;  1J9B A;  2CVK A;  3L9S A;  4KDY A;  3KIJ A;  3UOM A;  2IMF A;  1FAA A;  2K8S A;  2A4V A;  4MAB A;  2NDO A;  3M0F A;  1K3Y A;  4XRD A;  2VD0 A;  3D4M A;  3HYP A;  3WYW A;  3LYP A;  1WP0 A;  4XHM A;  3CSI A;  1ERU A;  3KP8 A;  3HA9 A;  1A23 A;  3O3T A;  2IJY A;  4FYB A;  2HT9 A;  5HFG A;  4DSS A;  1XPV A;  2QKE A;  5LCZ A;  1S3C A;  4JBB A;  2DIY A;  1Y25 A;  4IP6 A;  2CZ3 A;  4K2D A;  3FZ9 A;  1ERT A;  2FA8 A;  3TCO A;  2FWF A;  1XIY A;  1TU8 A;  4EKZ A;  3MDK A;  4ECI A;  4MF5 A;  1KEB A;  2VLV A;  4RI7 A;  2WB9 A;  1B9Y C;  6GSS A;  4I2T A;  2K8V A;  3QD9 A;  2REM A;  3Q19 A;  4JR6 A;  3A5W A;  1EEM A;  2M46 A;  2B5X A;  2GQM A;  4POK A;  1WJK A;  5E4W A;  4ECC A;  2DJ1 A;  2AYT A;  2N5F A;  3BCI A;  1RW1 A;  4NMU A;  1LU4 A;  1ILO A;  2F51 A;  4HZ2 A;  3KMO A;  1SJI A;  2B3S A;  4BWS A;  4AGS A;  5ECN B;  4O32 A;  3IHQ A;  4V2N A;  2DSA A;  4IGJ A;  3DWV A;  4IKH A;  2H8L A;  3KTB A;  3GTU A;  4TR3 A;  3K8N A;  2JZR A;  2X8G A;  3IK9 A;  2DLX A;  1O81 A;  2O87 A;  4QL7 A;  4IEL A;  1T7P B;  3GFK A;  2LNT A;  2E0Q A;  1MDJ A;  1THX A;  3P8W A;  2VCT A;  1ON4 A;  4ID0 A;  4PUR A;  4ECB A;  3V1W A;  2R4V A;  1SK0 A;  3PGT A;  3G7I A;  3P2A A;  4WEY A;  5IMC A;  5H5S A;  3ME8 A;  1HQO A;  1N8J A;  4GSN A;  1T00 A;  2AAW A;  1TXX A;  3KZQ A;  5B7C A;  3HD5 A;  2L5L A;  1B4P A;  3UBL A;  3FEU A;  2L4Q A;  4GWR A;  3TRX A;  1YKC A;  1ERV A;  1M2B A;  2WJU A;  4WKW A;  2C80 A;  3P90 A;  1O6J A;  1MTC A;  5CYY A;  3W8J A;  4LLR A;  4KDU A;  3TKR A;  3GHA A;  1QGV A;  3SBC A;  1GTU A;  3Q74 A;  5ID2 B;  3M3M A;  4OFM A;  4V2M A;  4ZIJ A;  2L6D A;  2I1U A;  4G2E A;  4PNG A;  2IFQ B;  1Z7P A;  4YAP A;  7GSS A;  3R2Q A;  5CAX A;  4MF7 A;  3LQ7 A;  1F3A A;  1Z3E A;  1AW9 A;  2GQL A;  5G31 A;  3P7X A;  5COH A;  2YJH A;  2DJ0 A;  1OKT A;  3O76 A;  2FA4 A;  2PBJ A;  2V32 A;  3DGQ A;  1TRW A;  3PIN A;  2RLI A;  2R5G A;  3APO A;  2C3T A;  1ZOF A;  3ED3 A;  4FYU A;  3FW2 A;  3TDG A;  5CRE A;  2B7K A;  1SD9 A;  1Q98 A;  4WBR D;  1T1V A;  1QK8 A;  1TTZ A;  4LMW A;  3GST A;  5J4U A;  4NPB A;  3LFL A;  3FZ4 A;  2B7J A;  4GF0 A;  5HFI A;  1S3A A;  1SD8 A;  1DE2 A;  22GS A;  2TIR A;  4PUA A;  3B08 B;  5HR2 A;  4RI6 A;  3VK9 A;  4POM A;  1AQX A;  5ECL B;  2H1D A;  2V1M A;  4GXZ A;  2G2Q A;  2DJ3 A;  1ZYE A;  1DE1 A;  2OKA A;  2BJX A;  3ZRE A;  1NW2 A;  13GS A;  2VL3 A;  2ON5 A;  3IE3 A;  3GIX A;  2QGV A;  1EP7 A;  4BVY A;  3D5J A;  1F37 A;  5A4W A;  3F0I A;  2H72 A;  3GL3 A;  3KH7 A;  1V40 A;  5KN3 A;  4J56 E;  1B48 A;  2I3Y A;  1PGT A;  2MZC A;  3FR6 A;  5A4V A;  4MZB A;  4GLT A;  1AAZ A;  3ERG A;  2FWE A;  1GUK A;  3HJM A;  3FY7 A;  4BPY A;  3HJP A;  1YY7 A;  1U3I A;  3BOA A;  4GRF A;  5LD0 A;  5H5R A;  1TRV A;  1TRS A;  2LTK A;  5IPH A;  2AB6 A;  3FKF A;  2KUC A;  2K18 A;  4KX4 A;  5DDL A;  4IQA A;  4TR1 A;  2TRX A;  3ZFB A;  5ID2 A;  2DJ2 A;  3FR9 A;  3TJB A;  3RHC A;  1GLP A;  2IFQ A;  4RQX A;  4EF0 A;  5J3R A;  1AXD A;  4POB A;  2LJR A;  2HYX A;  2GVP A;  1BYE A;  1MD3 A;  4PNF A;  1I9D A;  2IMD A;  1VRS D;  5IOX A;  4NHZ A;  1PL2 A;  2PUK C;  1ZGN A;  1CQH A;  1SKS B;  2X64 A;  1UC7 A;  2KOK A;  5GAN D;  4F03 A;  1YJ6 A;  2M72 A;  3VWV A;  4IW9 A;  4XCS A;  5DCH A;  3TKP A;  2DIZ A;  5DVB A;  5DJM A;  5B6N A;  2MMA A;  2RUE A;  1PL1 A;  3ERW A;  2C3Q A;  4HDE A;  3D0Z A;  4G19 A;  5AIX A;  1X9M B;  1X5D A;  1M9B A;  2FY6 A;  1A8Y A;  1TP9 A;  1MEK A;  1E6B A;  4BWQ A;  2AUV A;  1EP8 A;  2KLX A;  3ME7 A;  2L5O A;  4F82 A;  1YEP A;  1A24 A;  1HNB A;  3C7M A;  4Q5F A;  2LRT A;  1F9M A;  2R2J A;  3ZFL A;  1PSQ A;  5F06 A;  2C3N A;  2K9F A;  4TR0 A;  3IC4 A;  1AQV A;  4OFT A;  2H74 A;  4HQS A;  1RK4 A;  3EU3 A;  3WD6 A;  4NHW A;  2YAN A;  2ES7 A;  2HFD A;  2MMZ A;  1YF0 A;  2LS5 A;  3H1N A;  3M1G A;  4P3Y B;  4MLY A;  3F9U A;  2H30 A;  2VM1 A;  2C1Y A;  3UEM A;  1EWX A;  2GS3 A;  2N5B A;  2VM2 A;  3CXG A;  5JCG A;  3HKR A;  1Q4J A;  3NOF A;  2CZ2 A;  2F8F A;  1QMV A;  2PN8 A;  2JL4 A;  1ZMA A;  3EVI A;  4OCF A;  5DAL B;  4X1U A;  4MDC A;  3UJ1 A;  5H5Q A;  3VI5 A;  1JZD A;  4RUV A;  2V6K A;  4FIW A;  5HFK A;  2OBK A;  2RM5 A;  4XS4 B;  2YCD A;  1XXU A;  2CAI A;  3TKQ A;  5ECR B;  2EIR A;  3EUR A;  3C71 A;  4ZIL A;  1HYU A;  1YQ1 A;  1MDK A;  4GQC A;  5ELG A;  1J08 A;  3BBY A;  5IMZ A;  3IPZ A;  4JU5 A;  4OMV A;  4TXO B;  2CVD A;  5L71 A;  1LBK A;  2B6M A;  4K9Z A;  2VD1 A;  5LNK e;  2F3M A;  3MSZ A;  2PGT A;  1FVJ A;  3EU4 A;  1H4O A;  4MF6 A;  1XFL A;  1ZZY A;  3Q18 A;  1SKW B;  4KSO A;  3WGD A;  4I6X A;  3B0A B;  2KP1 A;  5KN0 A;  3J7Y b;  1BED A;  1KTE A;  2F9S A;  5AN1 A;  3KCM A;  3OR5 A;  1GL8 A;  3KH9 A;  1KNG A;  4K1F A;  5DAK B;  1SU9 A;  3L0H A;  2OE0 A;  1M2A A;  1PD2 1;  1OC8 A;  4G10 A;  4KB3 A;  2C0E A;  1GUL A;  5CRW A;  2OA7 A;  1XWC A;  1T8E B;  2GZP A;  1TOF A;  1BJX A;  2WRT A;  1MDI A;  3TUE A;  3HJO A;  4KGI A;  1V98 A;  4TKY A;  3I6A A;  4XTS A;  1PX7 A;  3CTG A;  5EY6 A;  1DBY A;  4XRA A;  5D9V A;  1XWA A;  3W6G A;  3NZN A;  4E8E A;  2K6V A;  2DBC A;  1TDI A;  3EIN A;  3TRQ A;  3Q6O A;  2IWT A;  3TJK A;  2H0I A;  2LEG A;  4L0U A;  1XOA A;  5DCG A;  4HU7 A;  1NHO A;  4WF4 A;  4AJ6 A;  4ML6 A;  4QQ7 A;  1OE8 A;  1H75 A;  3ZML A;  4JE1 A;  3F63 A;  2IPA A;  4HEA 2;  4WBJ A;  2FLS A;  5B8B A;  4FH8 A;  3CMI A;  3IK7 A;  1GSY A;  4D73 B;  3DKS A;  3TKS C;  2NPB A;  5EVO A;  3TB2 A;  5J5N A;  4L5O A;  2XBI A;  5IOW A;  1W89 A;  1GNW A;  1U3A A;  4MCU A;  2OAC A;  2H76 A;  2PVQ A;  4I5Q A;  2HLS A;  4YQV A;  3H79 A;  4HQZ A;  2YWN A;  3TKS A;  4TXO A;  2IMI A;  2HZE B;  4HS1 A;  2F8A A;  4I8B A;  5IMA A;  1HNA A;  2MBT A;  3IAM 2;  1O73 A;  5C04 A;  5F8B A;  3TGZ A;  3GSS A;  4MJB A;  3ZIT A;  3KM6 A;  2QC7 A;  2FWH A;  2JZT A;  4KCA A;  2B1L A;  3C1S A;  1J0F A;  3ERF A;  2HZF A;  1VF3 A;  2L59 A;  3LG6 A;  2RII A;  2LRN A;  3VFI A;  4PQ1 A;  4XXB B;  1FO5 A;  5IMV A;  2DJJ A;  5DAK A;  1OC9 B;  2J9H A;  1Z6N A;  1A2M A;  3HY2 A;  4WR5 A;  4JRR A;  1SJ6 A;  4IVF A;  2VAF A;  3GMF A;  4WF5 A;  2C8U A;  2IL3 A;  2OAD A;  2VIM A;  5AIV A;  1O8W A;  2IIY A;  4I97 A;  9GSS A;  1AC1 A;  4K6X A;  2M80 A;  2LUS A;  2AHE A;  4ZL8 A;  3NIV A;  2GSQ A;  2D2Z A;  1WE0 A;  1AQW A;  4K0N A;  1YDK A;  1NM3 A;  3APS A;  4KE3 A;  4EDZ A;  3FR3 A;  4AF2 A;  4WXT A;  1GWC A;  2YN1 A;  2EIO A;  1T4Y A;  4CDO A;  3FYG A;  2CT6 A;  2CX3 A;  2VCX A;  3U5R E;  3IAS 2;  3KP9 A;  4H86 A;  4WR4 A;  2RM6 A;  4K7N A;  1PMT A;  1EGR A;  4N30 A;  2GDR A;  1GRX A;  3C73 A;  4YH2 A;  3TJF A;  4F0C A;  3D6I A;  3UIW A;  2C6A A;  4E8H A;  5ECS A;  2VL2 C;  3VWX A;  4JR4 A;  4D73 A;  4Q5N A;  1Z6M A;  4EL1 A;  1Y6E A;  1FW1 A;  4V1A p;  1G6Y A;  2LJK A;  1XCC A;  3JCM L;  1OVN A;  4Z7X A;  19GS A;  2L6C A;  2R6K A;  1XWK A;  3ZMK A;  3LGC A;  1R5P A;  4TRX A;  1ML6 A;  5FHI A;  4XS6 A;  2HZE A;  1E2Y A;  4TOP A;  3KXO A;  5INY A;  5JWO B;  1TK8 B;  3IXR A;  2FHE A;  2WFC A;  2P0G A;  5FT3 A;  1Z5Y E;  4BA7 A;  2H0H A;  2H6Y A;  6GSU A;  4HJM A;  5IQY A;  17GS A;  2CX4 A;  3LSZ A;  2O8V B;  1K0O A;  1K0M A;  2GSR A;  4KH7 A;  2MMO A;  3N9J A;  1QUW A;  3SWL A;  3EC3 A;  3F4R A;  2B1K A;  3GUR A;  3QR6 A;  3FK8 A;  1BG5 A;  3WT2 A;  2RUF A;  3U6V A;  5ECH B;  1OC9 A;  4N10 A;  5CRD A;  2ZUP A;  1KBN A;  4J57 E;  3ZZX A;  3EWL A;  1B8X A;  1F6M C;  1Z9H A;  3RPP A;  5IO2 A;  2PU9 C;  2H1G A;  3MAK A;  1U87 A;  1XBS A;  3G9B A;  4RQR A;  1X5C A;  3VWW A;  1USB A;  3DIE A;  3UL3 A;  2GT6 A;  3HHV A;  3CSJ A;  2MBS A;  3GX8 A;  4KW6 A;  1YF1 A;  1TK0 B;  2GT5 A;  4GST A;  3ZLP A;  4LL1 B;  2IMK A;  4PXO A;  1WPI A;  5F05 A;  1MD4 A;  4ACS A;  8GSS A;  1X0R A;  2J23 A;  3H93 A;  4K7I A;  1EV9 A;  4ZL7 A;  4NV2 A;  2OE3 A;  5HR1 A;  1K0N A;  4ZL9 A;  1C72 A;  1WRY A;  5GST A;  4NV5 A;  2O7K A;  4ZB6 A;  1TRU A;  4HI7 A;  3VLN A;  3GRX A;  5G2Z A;  2KP2 A;  1FB0 A;  2KHP A;  1ZYQ B;  5DQS A;  3WGE A;  1WIK A;  3ISO A;  3TKS E;  5J41 A;  2WUL A;  5KN2 A;  5CRH A;  3IA1 A;  1K0C A;  5B8A A;  4HU9 A;  1T3B A;  1OYJ A;  2H73 A;  1VF4 A;  1GTB A;  2GST A;  4EXJ A;  1WOU A;  5J9B A;  4ZBA A;  3HDC A;  2TRC P;  1K0D A;  2FWG A;  3HZ4 A;  5D9X A;  4F9Z A;  2VL9 A;  1JZW A;  4FO5 A;  1XZO A;  2H70 A;  1O7U A;  2HE3 A;  4LL4 B;  5CP1 A;  2O89 A;  1JFU A;  2AV4 A;  3H4K A;  2CAQ A;  5A5K A;  1R7H A;  2LKU A;  3QCP A;  3FRC A;  5J9C A;  3UVT A;  1ST9 A;  2C6B A;  5ECK B;  5CRG A;  2P31 A;  3M9J A;  4WET A;  1PN9 A;  4LA1 A;  4O5R A;  1M7T A;  4EC0 A;  1SL2 B;  2H19 A;  4ZXG A;  1ZL9 A;  4AJ8 A;  1K3O A;  2VO4 A;  2YZH A;  3F4T A;  3GV1 A;  2PWJ A;  3AY8 A;  3QFA C;  2YPM A;  5IPG A;  1SYR A;  5D73 A;  4MJA A;  4HOJ A;  1XVW A;  3GL5 A;  2C0F A;  4KSM A;  1GNE A;  4BVX A;  1GSQ A;  1V57 A;  2EIQ A;  4DSQ A;  2IME A;  3LEF A;  2VCZ A;  2PER A;  2B5E A;  3DML A;  3I9V 2;  3G7Y A;  5D8I A;  2MMN A;  5HR3 A;  1B4Q A;  3TJJ A;  1XW6 A;  4KUN A;  2ZCT A;  1R26 A;  1X5E A;  2YWM A;  2H75 A;  2X8C A;  2R3X A;  2P5Q A;  4G9H A;  1U88 A;  4F2I A;  3DYR A;  1JLV A;  2ALB A;  3IBH A;  2CQ9 A;  1SJZ A;  4OD7 A;  2LST A;  3GN3 A;  1YZX A;  5DBQ A;  1GSU A;  2FGX A;  3G7J A;  1BQ7 A;  5HR0 A;  2N5A A;  3A2X A;  1I5G A;  2P5R A;  1AIU A;  4L5L A;  2ON7 A;  2C0G A;  3US3 A;  3DD3 A;  3LOR A;  2YV7 A;  1GUH A;  1QXH A;  5G1L A;  4DVC A;  1LJR A;  2L4C A;  4IP1 A;  4IS0 A;  2V41 A;  3GUS A;  3C8E A;  3KMN A;  2YOI A;  2I4A A;  2JAD A;  3ZIJ A;  1OE7 A;  1JHB A;  2LQQ A;  1UN2 A;  2C4J A;  3D22 A;  1ZCP A;  3L9V A;  2GLR A;  3KGK A;  14GS A;  1SEN A;  2H6Z A;  4MH3 A;  4ILF A;  3ZRD A;  1JZR A;  3F8U A;  1BAY A;  3N5O A;  3QOU A;  1XW9 A;  1RQM A;  1GSF A;  2R37 A;  5A4U A;  2H71 A;  4HUA A;  3IV4 A;  3GKN A;  2O85 A;  4TN8 A;  3HXS A;  3BCK A;  1FVK A;  3HZ8 A;  4X43 A;  3I43 A;  5D9T A;  3GH6 A;  1G7O A;  2LV3 A;  5EL8 A;  3F4S A;  2BMX A;  3D4T A;  3GKM A;  3IOS A;  2LRC A;  4DEJ A;  3VWU A;  2JSY A;  1GUM A;  1TJD A;  4X0X A;  2PVO C;  2YZU A;  4L0W A;  1GLQ A;  4IQ1 A;  3PH9 A;  2YJ7 A;  4YAV A;  2GSS A;  5IMF A;  3TRP A;  2GZZ A;  1GSS A;  3HVS A;  5DAL A;  1URM A;  2FNO A;  3ZIV A;  3C1R A;  4AJ7 A;  2VLT A;  1VF1 A;  3I69 A;  1M0U A;  3MNG A;  3QAV A;  5ECM B;  4EO3 A;  1OAZ A;  5ECQ B;  4KCE A;  4XS4 A;  1SYX A;  4PUF C;  4PGT A;  5ECO B;  4GCI A;  5F07 A;  5D93 A;  5JWR B;  4IJI A;  1PKW A;  2H1A A;  3A3T A;  5HQP A;  1TU7 A;  2A2R A;  2FD3 A;  6GSV A;  2YNX A;  4TXV A;  2DMM A;  2J9U B;  4EUY A;  2YWI A;  4PQI A;  4EE0 A;  4ZBD A;  2C0D A;  2BTO T;  1A8L A;  2G0F A;  3E0U A;  5D9W A;  5CO3 A;  2XC2 A;  4GQF A;  3KD0 A;  1N2A A;  1CQG A;  4N0V A;  1TKD B;  3QFB C;  4OO4 A;  4TW5 A;  3FZ5 A;  4ZB9 A;  1Z7R A;  4JED A;  3UMA A;  1EEJ A;  3GKK A;  1ERW A;  2HNL A;  4K7O A;  2JU5 A;  3IR4 A;  1VF2 A;  2XBQ A;  5IO0 A;  4O92 A;  4MH2 A;  1SK1 A;  3BD2 A;  3L78 A;  3TOT A;  4CW9 A;  1A0F A;  5KN1 A;  4KA0 A;  3KTL A;  5C00 A;  1XOB A;  2E2M A;  2XHF A;  5GAP D;  1B9X C;  2WZ9 A;  5G30 A;  4ISD A;  2X8H A;  3H8Q A;  4MJC A;  3LXT A;  1HNC A;  2FUG 2;  3F6F A;  4DSR A;  3F3Q A;  2GTU A;  3FZA A;  4O7H A;  5ECI B;  5FWG A;  1NHY A;  4V1A g;  3DVX A;  3UBK A;  2CA8 A;  3IRA A;  1FOV A;  4J2F A;  1T4Z A;  2H1B A;  1FHE A;  1GP1 A;  1YKA A;  2NVL A;  4TR1 B;  3EE2 A;  2YWO A;  2YP6 A;  5JCW A;  1EZK A;  3QAW A;  2H01 A;  1HD2 A;  2HRN A;  4HJ2 A;  5ECP B;  4K0G A;  2I81 A;  1ACV A;  4KAE A;  2V2G A;  4QL9 A;  2DJK A;  4F0B A;  2V6O A;  2GGT A;  1JLW A;  3RHB A;  2E7P A;  1NSW A;  6GSX A;  3KEB A;  3BJ5 A;  3CRT A;  1EOH A;  2I9H A;  1PQN A;  1ABA A;  3D21 A;  1QFN A;  1JZO A;  2JZS A;  3MWH A;  4ECJ A;  2HSY A;  3ZVJ D;  3APQ A;  1K0A A;  4IBP A;  3QAG A;  4MZC A;  2VL2 A;  1XVQ A;  4V2L A;  1XWB A;  1SKR B;  4MPG A;  3UAP A;  3VPQ A;  5GSS A;  5DJL A;  6GSW A;  3LYK A;  2JAC A;  3GA4 A;  1SL0 B;  3GX0 A;  3VUR A;  3CYN A;  1GSE A;  3VI7 A;  2ZNM A;  4NXI A;  1X9W B;  3J7Y k;  4GSS A;  1XW5 A;  4GTU A;  4FYC A;  3A2V A;  1K3L A;  3QMX A;  4KDX A;  2CVB A;  1G0T A;  1O8X A;  1M9A A;  1PRX A;  2VOC A;  5G1K A;  1K0B A;  1UA5 A;  4L8E A;  3O6T A;  1DSB A;  3CTF A;  4MK3 A;  1A2L A;  3LWA A;  1AUC A;  20GS A;  1X9S B;  3M9K A;  2LJA A;  3LXZ A;  3HVV A;  3EYT A;  1G6W A;  1GTA A;  4IJ3 A;  3W8S A;  3A2W A;  2B5Y A;  4ULX A;  5IMD A;  4N11 A;  3DXB A;  1PA3 A;  2HI7 A;  1U6T A;  5IIZ A;  3KJY A;  4PQH A;  4MZW A;  3HVX A;  3RAZ A;  3ZYW A;  1PKZ A;  1DUG A;  1R4W A;  2PPT A;  4POL A;  1GH2 A;  5B6M A;  3CBU A;  2HRF A;  4JZQ A;  5KEJ A;  3L9U A;  4OFN A;  1A0R P;  1XWG A;  3DVW A;  4BL7 A;  2LNS A; 
#chains in the Genus database with same CATH topology
 1FB6 A;  2E2G A;  5CNW A;  5C4X L;  2JA6 L;  4OO5 A;  3GKX A;  3FHK A;  1M99 A;  4ZBB A;  3WGX A;  3F6D A;  4CHS A;  1TW9 A;  3S9F A;  10GS A;  3RPN A;  2PMT A;  4HZ4 A;  5KOW A;  4C2M 1;  4XS1 A;  3IHG A;  1CAA A;  2V3B B;  1EGO A;  4K8M A;  3UVH A;  2DC5 A;  5E59 A;  4TR4 A;  6GSY A;  1UVZ A;  2NTO A;  3E3E A;  2MYG A;  4Q5Q A;  4ML1 A;  2YV9 A;  1V9W A;  5G5F A;  1TI1 A;  3UAR A;  1F2E A;  5IM9 A;  3EMX A;  4MA9 A;  5DQY A;  2Y0S P;  1TK5 B;  3HCZ A;  3ZL5 A;  2OJL A;  4AYB P;  1SK2 A;  4KND A;  2QA1 A;  1A2J A;  3TOU A;  1SL1 B;  2KKD A;  2FCH A;  5AIS A;  3HOX L;  2VCQ A;  4MPF A;  2VCV A;  4NAX A;  3DEX A;  5C44 L;  1BE7 A;  5ABR A;  18GS A;  3VPT A;  3S2H L;  1V58 A;  2PVX A;  2EC4 A;  1GSD A;  2IN3 A;  2H6X A;  1VGL A;  3L4N A;  16GS A;  4IN0 A;  5EIO C;  1S3D A;  2HXK A;  5EPF A;  4MP4 A;  2OE1 A;  2A69 D;  1WWJ A;  1M2D A;  1V2A A;  4Q5R A;  2V0E A;  4DSS B;  2GZY A;  1IYI A;  3MIX A;  4ZB8 A;  4EDY A;  3GNJ A;  2CV4 A;  2ERS A;  3QDN A;  1FG4 A;  2NBS A;  4YQU A;  2VUP A;  4IHU A;  5ELA A;  1O85 A;  4EVM A;  1B2O A;  2WCI A;  4MMM A;  4LMV A;  1LTL A;  3LJR A;  4C3I L;  2NVY L;  1T9P A;  2HSH A;  2H0G A;  4XIH A;  3M8N A;  1EV4 A;  1SMU A;  4C3H L;  3ZTL A;  2VCW A;  3IDV A;  3ZVJ A;  1YK4 A;  4I2U A;  4O5Q A;  3HOW L;  1S30 A;  2OBI A;  5ENU A;  3WT1 A;  3CSH A;  5F0G A;  1F3B A;  5MF6 A;  1YEX A;  3E9J B;  3A44 A;  2WGR A;  2XJQ A;  1OKD A;  1QQ2 A;  1TI3 A;  4HSC X;  3PKI A;  2XPE A;  2DML A;  3RBT A;  2X99 A;  5M3F L;  2L0Z A;  3PIP 1;  3FKI L;  2WDU A;  1R5A A;  2L57 A;  4TVE A;  2JSZ A;  2QSI A;  5JWQ B;  1W4V A;  4PX1 A;  2VLU A;  2GQK A;  11GS A;  4YQM A;  1BX9 A;  2A2S A;  4MJE A;  2XPD A;  4OCE A;  4JAE A;  1GTI A;  3EMP A;  5GZZ B;  2AJQ B;  1G7E A;  5G5E A;  2H66 A;  3HOY L;  3DRN A;  1IYH A;  3GTU B;  4OWY A;  3GYK A;  5AGY A;  1EOG A;  5D96 A;  3QPM A;  6GST A;  3MPS A;  12GS A;  4NWY A;  2WS2 A;  1WMJ A;  2Z9S A;  5JCU A;  1R0G A;  3TJG A;  3CRU A;  1I50 L;  3RDW A;  2LQO A;  1B2J A;  1ODH A;  3F3R A;  1THO A;  1OC3 A;  3PR8 A;  3GH9 A;  4N0Z A;  3IC8 A;  1PX6 A;  1J9B A;  2CVK A;  3L9S A;  4KDY A;  4USS A;  2NVT L;  3KIJ A;  3UOM A;  1SMM A;  2IMF A;  2EY4 E;  1FAA A;  2K8S A;  2A4V A;  4MAB A;  2NDO A;  3M0F A;  1OWB A;  1K3Y A;  4AHZ A;  4XRD A;  2VD0 A;  3D4M A;  3HYP A;  1VZI A;  3WYW A;  1IU5 A;  2Z3Q B;  3H9B A;  3LYP A;  1WP0 A;  4XHM A;  5FLM L;  4KF9 A;  3CSI A;  1ERU A;  2HRA A;  3KP8 A;  3HA9 A;  1A23 A;  3O3T A;  2KN9 A;  3HJY B;  4O5U A;  2IJY A;  4FYB A;  3PO2 L;  2RDV A;  2HT9 A;  5HFG A;  4DSS A;  1XPV A;  1YV1 A;  2QKE A;  5LCZ A;  1S3C A;  4JBB A;  2DIY A;  1Y25 A;  4IP6 A;  2XJT A;  4A3I L;  2CZ3 A;  3FZ9 A;  4K2D A;  1ERT A;  2XJU A;  3GTL L;  4YKG A;  2FA8 A;  3TCO A;  2FWF A;  1XIY A;  3S1R L;  3FMW A;  1TU8 A;  4EKZ A;  3MDK A;  4ECI A;  4MF5 A;  1KEB A;  2VLV A;  4RI7 A;  2WB9 A;  1B9Y C;  6GSS A;  4I2T A;  2K8V A;  3QD9 A;  2REM A;  3Q19 A;  4JR6 A;  3PL5 A;  3LNL A;  3A5W A;  1EEM A;  2M46 A;  2B5X A;  2GQM A;  2PMZ P;  4POK A;  1WJK A;  5E4W A;  4ECC A;  2DJ1 A;  4ICY A;  2AYT A;  2N5F A;  3HKZ P;  3BCI A;  1RW1 A;  2A6E D;  4NMU A;  2NVQ L;  1LU4 A;  1ILO A;  2F51 A;  4HZ2 A;  3KMO A;  1SJI A;  2B3S A;  4BWS A;  3S16 L;  4AGS A;  5ECN B;  4O32 A;  3IHQ A;  4V2N A;  1YUZ A;  2DSA A;  4IGJ A;  3DWV A;  3MSU A;  4IKH A;  2H8L A;  3KTB A;  1B71 A;  3GTU A;  4TR3 A;  3K8N A;  2JZR A;  5BRT A;  2X8G A;  3IK9 A;  1IU6 A;  5GAH c;  2DLX A;  1O81 A;  3PIO 1;  2O87 A;  2WB1 P;  4QL7 A;  4IEL A;  1T7P B;  2UZ8 A;  1DX8 A;  3GFK A;  2LNT A;  2E0Q A;  1MDJ A;  1THX A;  3P8W A;  2VCT A;  1ON4 A;  4ID0 A;  4PUR A;  4ME3 A;  4ECB A;  3ZG6 A;  3V1W A;  2R4V A;  1SK0 A;  1VZG A;  3G7I A;  3PGT A;  2R92 L;  3P2A A;  4WEY A;  5IMC A;  5H5S A;  3H9C A;  3ME8 A;  4BVY B;  1HQO A;  1N8J A;  4GSN A;  1IRO A;  1T00 A;  2AAW A;  1TXX A;  3KZQ A;  5B7C A;  3HD5 A;  1K83 L;  2L5L A;  1PFY A;  4A3B L;  1B4P A;  3UBL A;  3FEU A;  2L4Q A;  3RZT A;  4UY8 1;  5JVH 1;  2A2P A;  4GWR A;  3TRX A;  1YKC A;  1ERV A;  1M2B A;  2WJU A;  4WKW A;  2A68 D;  2C80 A;  3P90 A;  1O6J A;  3HOZ L;  2R0P A;  1MTC A;  5CYY A;  1BQ9 A;  4LLR A;  1ZYP A;  3W8J A;  4KDU A;  3TKR A;  3GHA A;  1QGV A;  1IRN A;  3SBC A;  2DKH A;  1PFW A;  1GTU A;  3Q74 A;  5ID2 B;  3M3M A;  4OFM A;  4V2M A;  4ZIJ A;  5MFZ A;  2L6D A;  2I1U A;  4G2E A;  4PNG A;  3GTJ L;  2IFQ B;  1Z7P A;  4YAP A;  7GSS A;  3R2Q A;  4Z2R A;  5CAX A;  4MF7 A;  2JA7 L;  3LQ7 A;  1F3A A;  1Z3E A;  1AW9 A;  2GQL A;  5G31 A;  3P7X A;  5COH A;  2YJH A;  2DJ0 A;  1OKT A;  3O76 A;  2FA4 A;  2PBJ A;  2V32 A;  3DGQ A;  1S3R A;  5M5Y L;  1TRW A;  3PIN A;  2RLI A;  2R5G A;  3APO A;  2C3T A;  1ZOF A;  3QVD A;  3ED3 A;  4FYU A;  1R9T L;  3FW2 A;  3TDG A;  5CRE A;  2B7K A;  1S2Z A;  1SD9 A;  1Q98 A;  4WBR D;  1T1V A;  1QK8 A;  1TTZ A;  4LMW A;  3GST A;  5J4U A;  3K35 A;  4NPB A;  3LFL A;  3FZ4 A;  2B7J A;  2JI1 A;  5GAG c;  4GF0 A;  5HFI A;  1S3A A;  1SD8 A;  3S2D L;  3HOU L;  1DE2 A;  22GS A;  2TIR A;  4PUA A;  3B08 B;  3PZA A;  5HR2 A;  4RI6 A;  3VK9 A;  4POM A;  1AQX A;  5ECL B;  2H1D A;  2V1M A;  4GXZ A;  2G2Q A;  2DJ3 A;  1ZYE A;  4E6Y A;  1R0I A;  1DE1 A;  2OKA A;  2BJX A;  3ZRE A;  1NW2 A;  13GS A;  3KYU A;  2VL3 A;  2ON5 A;  3IE3 A;  3GIX A;  2QGV A;  1EP7 A;  4AI0 A;  4BVY A;  3D5J A;  1F37 A;  2QA2 A;  5A4W A;  3F0I A;  2H72 A;  3GL3 A;  4X4J A;  3KH7 A;  1V40 A;  2PYA A;  5KN3 A;  4J56 E;  1B48 A;  2I3Y A;  1PGT A;  2MZC A;  1RDV A;  1M3I A;  2PSM C;  3FR6 A;  4Z2U A;  5A4V A;  1SFO L;  4MZB A;  4BBR L;  4GLT A;  1AAZ A;  3ERG A;  2FWE A;  1GUK A;  4TVM A;  3HJM A;  3FY7 A;  4BPY A;  3HJP A;  1YY7 A;  1U3I A;  3BOA A;  4GRF A;  5LD0 A;  2E2H L;  4LHL A;  5H5R A;  1TRV A;  4BVX B;  1TRS A;  2LTK A;  5IPH A;  2AB6 A;  3FKF A;  2KUC A;  2K18 A;  4KX4 A;  1PFU A;  5DDL A;  4IQA A;  2AYJ A;  4TR1 A;  2TRX A;  3ZFB A;  5ID2 A;  2DJ2 A;  3FR9 A;  3TJB A;  2DKI A;  3RHC A;  1GLP A;  2IFQ A;  1TWA L;  4RQX A;  4EF0 A;  5J3R A;  1AXD A;  4POB A;  2LJR A;  2HYX A;  2GVP A;  4AHY A;  1BYE A;  3J7Y 1;  4AR5 A;  1MD3 A;  4PNF A;  1I9D A;  2IMD A;  1VRS D;  5IOX A;  4A5P A;  4NHZ A;  1PL2 A;  2PUK C;  1ZGN A;  1CQH A;  1SKS B;  2X64 A;  1UC7 A;  2A4H A;  2KOK A;  1RDG A;  5GAN D;  4X6A L;  4F03 A;  1YJ6 A;  2M72 A;  3VWV A;  4IW9 A;  4XCS A;  5DCH A;  3TKP A;  2DIZ A;  5DVB A;  5DJM A;  5B6N A;  3GTP L;  2MMA A;  2RUE A;  1ZYN A;  1PL1 A;  3ERW A;  2C3Q A;  4HDE A;  3D0Z A;  4G19 A;  1Z92 B;  5AIX A;  1X9M B;  2B5I D;  1X5D A;  1M9B A;  1RWD A;  7RXN A;  2FY6 A;  1A8Y A;  1TP9 A;  1MEK A;  1E6B A;  4BWQ A;  2AUV A;  1EP8 A;  2KLX A;  3ME7 A;  2L5O A;  4F82 A;  1YEP A;  1A24 A;  1HNB A;  3C7M A;  4Q5F A;  2LRT A;  4YWL A;  4LHN A;  1F9M A;  2R2J A;  3ZFL A;  1PSQ A;  5F06 A;  2C3N A;  2K9F A;  4TR0 A;  3IC4 A;  1AQV A;  4OFT A;  1ZRP A;  2H74 A;  4HQS A;  1RK4 A;  3EU3 A;  3WD6 A;  4NHW A;  3PPU A;  2YAN A;  2ES7 A;  2HFD A;  2MMZ A;  1YF0 A;  2LS5 A;  3H1N A;  3M1G A;  3S1Q L;  4P3Y B;  5AN9 H;  4MLY A;  3F9U A;  1T9O A;  2H30 A;  4MNN A;  2VM1 A;  2C1Y A;  3UEM A;  1EWX A;  4A3M L;  2GS3 A;  2N5B A;  2VM2 A;  3CXG A;  5JCG A;  3HKR A;  1Q4J A;  3NOF A;  2CZ2 A;  2F8F A;  1QMV A;  2PN8 A;  2JL4 A;  1ZMA A;  3EVI A;  4OCF A;  5DAL B;  4X1U A;  4MDC A;  3UJ1 A;  5H5Q A;  3VI5 A;  1JZD A;  4RUV A;  5KOX A;  1PFO A;  4CY8 A;  2V6K A;  4FIW A;  5HFK A;  1SMW A;  2OBK A;  2RM5 A;  4XS4 B;  2YCD A;  1XXU A;  2CAI A;  3TKQ A;  5ECR B;  2EIR A;  3EUR A;  3C71 A;  2JI2 A;  4ZIL A;  1HYU A;  1YQ1 A;  1MDK A;  4GQC A;  6RXN A;  5ELG A;  1J08 A;  3BBY A;  5IMZ A;  3HOV L;  3IPZ A;  4JU5 A;  4OMV A;  4TXO B;  2CVD A;  5L71 A;  1LBK A;  2B6M A;  4K9Z A;  4BXX L;  1YK5 A;  2R7Z L;  2VD1 A;  5LNK e;  2F3M A;  3MSZ A;  1WCM L;  2PGT A;  3I4M L;  1FVJ A;  3EU4 A;  1H4O A;  4MF6 A;  1XFL A;  1ZZY A;  3Q18 A;  1SKW B;  3LWV B;  3LWP B;  4KSO A;  3WGD A;  2R0G A;  4I6X A;  3B0A B;  2KP1 A;  5KN0 A;  2GMG A;  3J7Y b;  5FJ8 L;  1BED A;  1KTE A;  2F9S A;  3KCM A;  4G0I A;  5AN1 A;  3OR5 A;  1GL8 A;  3KH9 A;  1KNG A;  4K1F A;  5DAK B;  1TWC L;  1SU9 A;  4A3C L;  3L0H A;  2OE0 A;  1M2A A;  1PD2 1;  1OC8 A;  4G10 A;  4KB3 A;  2C0E A;  1GUL A;  1E8J A;  5CRW A;  2OA7 A;  3PKJ A;  5IP9 L;  2JA5 L;  1XWC A;  1T8E B;  2GZP A;  1TOF A;  1BJX A;  2WRT A;  4QIW P;  1MDI A;  3TUE A;  3HJO A;  4KGI A;  1V98 A;  4POF A;  4TKY A;  3I6A A;  4XTS A;  1PX7 A;  3CTG A;  5EY6 A;  1DBY A;  4XRA A;  5D9V A;  4Y7N L;  1XG8 A;  3LW9 A;  1XWA A;  3W6G A;  3NZN A;  3H97 A;  4E8E A;  2K6V A;  2DBC A;  2M4Y A;  1IW7 D;  2MS3 A;  3LPE B;  1TDI A;  3EIN A;  3TRQ A;  3Q6O A;  2IWT A;  2RFK B;  5MFP A;  3TJK A;  2V0F A;  2H0I A;  2LEG A;  2LCQ A;  4L0U A;  1XOA A;  3KYV A;  3LWO B;  1PN0 A;  5DCG A;  4HU7 A;  1NHO A;  4WF4 A;  1LKO A;  4AJ6 A;  2M6P A;  5MLC 3;  4ML6 A;  8RXN A;  1QCV A;  4QQ7 A;  1OE8 A;  1H75 A;  3ZML A;  4JE1 A;  5C4J L;  3F63 A;  2IPA A;  4HEA 2;  4BBS L;  1VZH A;  4WBJ A;  2FLS A;  5B8B A;  4AR3 A;  4FH8 A;  3CMI A;  3IK7 A;  4JAF A;  1GSY A;  4D73 B;  3DKS A;  3TKS C;  2NPB A;  5EVO A;  3TB2 A;  5J5N A;  4L5O A;  2XBI A;  5IOW A;  1W89 A;  1NXG A;  1GNW A;  1U3A A;  4A3K L;  3A5I A;  3RYG A;  4MCU A;  2OAC A;  1WJV A;  4AHX A;  2H76 A;  2JI3 A;  2PVQ A;  4I5Q A;  4AHW A;  2HLS A;  4YQV A;  3H79 A;  4HQZ A;  2YWN A;  3HVN A;  3TKS A;  4TXO A;  2IMI A;  2HZE B;  1I6H L;  4HS1 A;  2F8A A;  4I8B A;  5IMA A;  1HNA A;  2MBT A;  3IAM 2;  1O73 A;  5C04 A;  3GTK L;  2XJR A;  4K5R A;  5F8B A;  3TGZ A;  3GSS A;  3KYX A;  4MJB A;  4ZN1 B;  3ZIT A;  3KM6 A;  2QC7 A;  2M6O A;  2VL6 A;  2FWH A;  2JZT A;  4KCA A;  2B1L A;  3C1S A;  1J0F A;  5C3E L;  3ERF A;  2HZF A;  1VF3 A;  2L59 A;  3LG6 A;  2RII A;  2LRN A;  3VFI A;  4PQ1 A;  4CY6 A;  4XXB B;  1FO5 A;  5IMV A;  5RXN A;  2ERJ A;  2DJJ A;  5DAK A;  1OC9 B;  2J9H A;  1Z6N A;  1A2M A;  3HY2 A;  4WR5 A;  3NFP I;  4JRR A;  1SJ6 A;  4IVF A;  2E2I L;  2VAF A;  3GMF A;  4WF5 A;  2C8U A;  5GAD c;  2IL3 A;  2OAD A;  2VIM A;  5AIV A;  1O8W A;  2IIY A;  4I97 A;  9GSS A;  1CAD A;  1AC1 A;  4K6X A;  2M80 A;  2LUS A;  2AHE A;  4ZL8 A;  3NIV A;  2GSQ A;  2D2Z A;  1WE0 A;  1AQW A;  5AI3 A;  1TWH L;  4K0N A;  1QYB A;  1YDK A;  1NM3 A;  3APS A;  4KE3 A;  4EDZ A;  3FR3 A;  4AF2 A;  4WXT A;  1GWC A;  2YN1 A;  2EIO A;  1T4Y A;  4CDO A;  3FYG A;  1JYB A;  2CT6 A;  2CX3 A;  2VCX A;  3U5R E;  3IAS 2;  3KP9 A;  4H86 A;  4WR4 A;  2RM6 A;  4K7N A;  1PMT A;  1EGR A;  4N30 A;  2GDR A;  1GRX A;  3C73 A;  4YH2 A;  3TJF A;  4F0C A;  3D6I A;  3UIW A;  4XGH A;  2C6A A;  4E8H A;  5ECS A;  2VL2 C;  3VWX A;  4JR4 A;  2YU9 L;  4D73 A;  4ZN3 B;  4Q5N A;  1Z6M A;  2AQC A;  5BMU A;  3SS2 A;  3S15 L;  4EL1 A;  1BQ8 A;  1Y6E A;  1FW1 A;  2DSX A;  3MYD A;  4V1A p;  1G6Y A;  2LJK A;  4K5S A;  1XCC A;  3JCM L;  1OVN A;  4Z7X A;  5M5X L;  19GS A;  2L6C A;  2R6K A;  1XWK A;  3ZMK A;  3LGC A;  1R5P A;  4AR6 A;  4TRX A;  1ML6 A;  5FHI A;  4XS6 A;  2JA8 L;  2HZE A;  3KYW A;  1E2Y A;  4TOP A;  3KXO A;  2CR8 A;  5INY A;  5JWO B;  1TK8 B;  3IXR A;  2FHE A;  2WFC A;  2P0G A;  3CQZ L;  5FT3 A;  1Z5Y E;  3H0G L;  2A6H D;  4BA7 A;  3M4O L;  2H0H A;  2H6Y A;  6GSU A;  4HJM A;  5IQY A;  17GS A;  2CX4 A;  3LSZ A;  2O8V B;  1K0O A;  5IYB L;  1K0M A;  1T9Q A;  2GSR A;  4KH7 A;  2MMO A;  3N9J A;  1QUW A;  3SWL A;  3EC3 A;  4JAG A;  3F4R A;  2B1K A;  3GUR A;  2E2J L;  2XJV A;  3GTO L;  3QR6 A;  1NXE A;  4A3D L;  3FK8 A;  1BG5 A;  3WT2 A;  2RUF A;  3U6V A;  5ECH B;  1OC9 A;  4B8C D;  4N10 A;  2ZUP A;  4Y52 L;  5CRD A;  1KBN A;  2AUS B;  4J57 E;  3ZZX A;  3EWL A;  1B8X A;  1F6M C;  1Z9H A;  3RPP A;  5IO2 A;  4PTS A;  2PU9 C;  2H1G A;  3MAK A;  1U87 A;  1XBS A;  3G9B A;  4RQR A;  1X5C A;  3VWW A;  4A3F L;  1USB A;  3DIE A;  3S14 L;  3UL3 A;  2GT6 A;  3HHV A;  3CSJ A;  3S17 L;  2MBS A;  3GX8 A;  4KW6 A;  1YF1 A;  1TK0 B;  2GT5 A;  4GST A;  3ZLP A;  4LL1 B;  1NNQ A;  2IMK A;  4PXO A;  1R0J A;  1WPI A;  5F05 A;  1MD4 A;  4ACS A;  8GSS A;  1X0R A;  2J23 A;  3H93 A;  4K7I A;  1EV9 A;  4ZL7 A;  4A3E L;  4NV2 A;  2OE3 A;  5HR1 A;  1K0N A;  4ZL9 A;  1C72 A;  1WRY A;  5GST A;  4POG A;  4NV5 A;  2O7K A;  4ZB6 A;  1TRU A;  4HI7 A;  3VLN A;  3GRX A;  5G2Z A;  2KP2 A;  1FB0 A;  2KHP A;  1ZYQ B;  5DQS A;  3WGE A;  1WIK A;  3ISO A;  3TKS E;  2ZIX A;  4V19 6;  5J41 A;  2WAQ P;  2WUL A;  4G0K A;  2NYD A;  4BIK A;  5KN2 A;  5CRH A;  3IA1 A;  2CKA A;  1K0C A;  5B8A A;  4HU9 A;  1T3B A;  1OYJ A;  2H73 A;  1VF4 A;  5K2M E;  1PFV A;  1GTB A;  1C09 A;  2GST A;  4EXJ A;  1WOU A;  5J9B A;  2HRK A;  4ZBA A;  3HDC A;  2TRC P;  1K0D A;  2FWG A;  3HZ4 A;  5D9X A;  4F9Z A;  2VL9 A;  1JZW A;  4G0L A;  2BE5 D;  3WWL A;  1FHM A;  4FO5 A;  1XZO A;  2H70 A;  1O7U A;  2HE3 A;  4LL4 B;  1B13 A;  5CP1 A;  2O89 A;  1JFU A;  2AV4 A;  2QL0 A;  3H4K A;  4A3J L;  2CAQ A;  4A3G L;  5A5K A;  3J7Z 1;  2NVX L;  1R7H A;  2LKU A;  3QCP A;  3QQC E;  3FRC A;  5J9C A;  3UVT A;  1ST9 A;  2C6B A;  5ECK B;  1Y1W L;  5CRG A;  2P31 A;  3M9J A;  1LKM A;  4WET A;  1PN9 A;  4LA1 A;  3JR7 A;  4O5R A;  2VUM L;  1M7T A;  4EC0 A;  1SL2 B;  2H19 A;  4ZXG A;  1ZL9 A;  5JVG 1;  4AJ8 A;  1K3O A;  2VO4 A;  4WFN 1;  2YZH A;  3F4T A;  3GV1 A;  2PWJ A;  3AY8 A;  3QFA C;  2YPM A;  5IPG A;  1SYR A;  5D73 A;  4MJA A;  4HOJ A;  1XVW A;  3GL5 A;  5EIN C;  2C0F A;  4KSM A;  1GNE A;  4BVX A;  1GSQ A;  1V57 A;  2EIQ A;  1RYQ A;  4DSQ A;  2IME A;  3LEF A;  2VCZ A;  2PER A;  2B5E A;  3DML A;  3I9V 2;  3LWQ B;  3G7Y A;  5D8I A;  2MMN A;  5HR3 A;  3MQK B;  1B4Q A;  3TJJ A;  1XW6 A;  4KUN A;  2ZCT A;  1R26 A;  1X5E A;  3K7A L;  2YWM A;  2H75 A;  2X8C A;  2R3X A;  2P5Q A;  4G9H A;  1U88 A;  4F2I A;  3P8B A;  5IYD L;  3DYR A;  1JLV A;  4GS7 D;  2ALB A;  3IBH A;  2CQ9 A;  1SJZ A;  3HJW B;  4OD7 A;  5AI2 A;  2LST A;  3GN3 A;  1YZX A;  5DBQ A;  1GSU A;  3VPB E;  2FGX A;  3G7J A;  1BQ7 A;  5HR0 A;  2N5A A;  3A2X A;  1I5G A;  2P5R A;  1M3J A;  3RZO L;  1AIU A;  3PWF A;  4L5L A;  1RYT A;  2ON7 A;  4EIQ A;  2C0G A;  3US3 A;  3DD3 A;  3LOR A;  2YV7 A;  3H3V M;  1GUH A;  1QXH A;  5G1L A;  4DVC A;  1LJR A;  2B63 L;  2L4C A;  4IP1 A;  4IS0 A;  2V41 A;  3GUS A;  3C8E A;  1BRF A;  3KYY A;  3KMN A;  2YOI A;  2I4A A;  2JAD A;  1Y1V L;  4JAD A;  3ZIJ A;  1OE7 A;  3H99 A;  3I4N L;  1JHB A;  2LQQ A;  1LKP A;  1YUX A;  3LWR B;  1UN2 A;  2C4J A;  2CKC A;  3D22 A;  2R0C A;  4AR4 A;  5M5W L;  1ZCP A;  3L9V A;  2GLR A;  3KGK A;  14GS A;  1SEN A;  2H6Z A;  4MH3 A;  4ILF A;  4A3L L;  2HVY C;  3ZRD A;  1JZR A;  3F8U A;  4EIP A;  5DM6 1;  1BAY A;  3N5O A;  3QOU A;  1XW9 A;  1RQM A;  1GSF A;  2R37 A;  5A4U A;  4TPU A;  2H71 A;  4HUA A;  4C3J L;  2XJS A;  3IV4 A;  3GKN A;  2O85 A;  4TN8 A;  3HXS A;  3BCK A;  1FVK A;  3HZ8 A;  4X43 A;  2X49 A;  3I43 A;  5D9T A;  3GH6 A;  1G7O A;  2LV3 A;  5EL8 A;  3F4S A;  4U67 1;  2BMX A;  3D4T A;  3GKM A;  3IOS A;  2LRC A;  4DEJ A;  3VWU A;  2JSY A;  1F4L A;  1GUM A;  1TJD A;  4X0X A;  2PVO C;  2YZU A;  4L0W A;  1GLQ A;  4IQ1 A;  4Z2T A;  3PH9 A;  5IP7 L;  2YJ7 A;  4YAV A;  2GSS A;  5IMF A;  3TRP A;  1BFY A;  2GZZ A;  2M4V A;  1GSS A;  3HVS A;  5DAL A;  1URM A;  2FNO A;  3ZIV A;  3C1R A;  4AJ7 A;  2VLT A;  1VF1 A;  2H12 A;  3I69 A;  1M0U A;  3MNG A;  3QAV A;  5ECM B;  4EO3 A;  1OAZ A;  5ECQ B;  3RZD L;  4KCE A;  4XS4 A;  1SYX A;  4AI2 A;  4PUF C;  4PGT A;  5ECO B;  4GCI A;  5F07 A;  2APO B;  1PZX A;  5D93 A;  4K2X A;  5JWR B;  4IJI A;  1PKW A;  2H1A A;  3A3T A;  4YKF A;  5HQP A;  1TU7 A;  2A2R A;  4A93 L;  2FD3 A;  4BY7 L;  6GSV A;  2YNX A;  4TXV A;  2PVE A;  2DMM A;  2J9U B;  4EUY A;  2YWI A;  4PQI A;  4EE0 A;  3R3E A;  4ZBD A;  1TWG L;  2C0D A;  2BTO T;  1A8L A;  2G0F A;  3E0U A;  5D9W A;  2K2D A;  5CO3 A;  2HR5 A;  2XC2 A;  4GQF A;  5MGN A;  3KD0 A;  3IU3 I;  1N2A A;  1CQG A;  4N0V A;  3S1M L;  1TKD B;  3QFB C;  4OO4 A;  4TW5 A;  1S24 A;  3FZ5 A;  2X4A A;  4ZB9 A;  5IYC L;  1Z7R A;  4AI3 A;  4JED A;  3UMA A;  1EEJ A;  3GKK A;  1ERW A;  2HNL A;  4K7O A;  2JU5 A;  3IR4 A;  1VF2 A;  4BY1 L;  1RB9 A;  2XBQ A;  5IO0 A;  4O92 A;  4MH2 A;  1SK1 A;  3BD2 A;  3L78 A;  3TOT A;  4CW9 A;  1A0F A;  5KN1 A;  4KA0 A;  3KTL A;  1QQT A;  2R93 L;  5C00 A;  4AI1 A;  5GAE c;  1XOB A;  2E2M A;  2XHF A;  5GAP D;  1B9X C;  2WZ9 A;  5G30 A;  4ISD A;  2X8H A;  3H8Q A;  2XJP A;  4MJC A;  3LXT A;  1HNC A;  2FUG 2;  3F6F A;  4DSR A;  1FOH A;  3F3Q A;  2GTU A;  3FZA A;  4BL7 B;  4O7H A;  3M3Y L;  5ECI B;  5FWG A;  3HAX C;  1NHY A;  4V1A g;  3DVX A;  3UBK A;  2HSM A;  3GTQ L;  2CA8 A;  3IRA A;  1FOV A;  4J2F A;  1T4Z A;  2H1B A;  1FHE A;  1GP1 A;  4G6B A;  1YKA A;  2NVL A;  4TR1 B;  3EE2 A;  2YWO A;  2YP6 A;  5JCW A;  1EZK A;  3QAW A;  2H01 A;  1R0F A;  1HD2 A;  3FDJ A;  2HRN A;  4HJ2 A;  5ECP B;  4K0G A;  2I81 A;  1ACV A;  4KAE A;  2V2G A;  4QL9 A;  2DJK A;  4F0B A;  2V6O A;  2GGT A;  1JLW A;  3RHB A;  2E7P A;  1NSW A;  6GSX A;  3KEB A;  3BJ5 A;  3CRT A;  1EOH A;  2I9H A;  1ABA A;  1PQN A;  3CQF A;  3D21 A;  1QFN A;  1JZO A;  3WWN B;  2JZS A;  4K9F A;  3MWH A;  4ECJ A;  2HSY A;  3ZVJ D;  1H7V A;  3APQ A;  1K0A A;  1R0H A;  3PO3 L;  2O5J D;  4IBP A;  3QAG A;  4RXN A;  4MZC A;  2VL2 A;  1XVQ A;  1XWB A;  4V2L A;  1SKR B;  4MPG A;  3S1N L;  3UAP A;  3VPQ A;  5GSS A;  5DJL A;  6GSW A;  3LYK A;  2JAC A;  3GA4 A;  1SL0 B;  3GX0 A;  3VUR A;  3CYN A;  1GSE A;  3VI7 A;  2ZNM A;  4NXI A;  1X9W B;  3J7Y k;  1XW5 A;  4GSS A;  4FYC A;  3A2V A;  4GTU A;  1K3L A;  3QMX A;  4KDX A;  2CVB A;  3GTM L;  1G0T A;  1O8X A;  1M9A A;  1PRX A;  2VOC A;  5G1K A;  1K0B A;  1UA5 A;  4L8E A;  3O6T A;  1DSB A;  1P7P A;  3CTF A;  4MK3 A;  1A2L A;  3LWA A;  1AUC A;  20GS A;  1X9S B;  3M9K A;  2LJA A;  3LXZ A;  3EPT A;  3HVV A;  3EYT A;  1G6W A;  5H1S c;  1FHH A;  1GTA A;  4IJ3 A;  3W8S A;  3A2W A;  5IY0 A;  2B5Y A;  4ULX A;  5IMD A;  1I3Q L;  4N11 A;  3DXB A;  1PA3 A;  2HI7 A;  2Z3R B;  1U6T A;  5DM7 1;  5IIZ A;  3KJY A;  4PQH A;  4MZW A;  4FQU A;  3RZ6 A;  3GTG L;  3HVX A;  3RAZ A;  3ZYW A;  1PKZ A;  1DUG A;  1R4W A;  2PPT A;  4POL A;  1GH2 A;  5B6M A;  3CBU A;  2HRF A;  4YWM A;  4JZQ A;  5KEJ A;  3L9U A;  4OFN A;  1A0R P;  1TWF L;  1XWG A;  5M3M L;  3DVW A;  4BL7 A;  2LNS A;  1OWC A;  1VCX A;  1DVB A; 
#chains in the Genus database with same CATH homology
 1FB6 A;  2E2G A;  5CNW A;  4OO5 A;  3GKX A;  3FHK A;  1M99 A;  4ZBB A;  3WGX A;  3F6D A;  4CHS A;  1TW9 A;  3S9F A;  10GS A;  3RPN A;  2PMT A;  4HZ4 A;  5KOW A;  4XS1 A;  3IHG A;  1CAA A;  2V3B B;  1EGO A;  4K8M A;  3UVH A;  2DC5 A;  5E59 A;  4TR4 A;  6GSY A;  1UVZ A;  2NTO A;  3E3E A;  2MYG A;  4Q5Q A;  4ML1 A;  2YV9 A;  1V9W A;  5G5F A;  1TI1 A;  3UAR A;  1F2E A;  5IM9 A;  3EMX A;  4MA9 A;  5DQY A;  1TK5 B;  3HCZ A;  3ZL5 A;  2OJL A;  1SK2 A;  4KND A;  2QA1 A;  1A2J A;  3TOU A;  1SL1 B;  2KKD A;  2FCH A;  5AIS A;  2VCQ A;  4MPF A;  2VCV A;  4NAX A;  3DEX A;  1BE7 A;  5ABR A;  18GS A;  3VPT A;  1V58 A;  2PVX A;  2EC4 A;  1GSD A;  2IN3 A;  2H6X A;  1VGL A;  3L4N A;  16GS A;  4IN0 A;  5EIO C;  1S3D A;  2HXK A;  5EPF A;  4MP4 A;  2OE1 A;  2A69 D;  1WWJ A;  1M2D A;  1V2A A;  4Q5R A;  2V0E A;  4DSS B;  2GZY A;  1IYI A;  3MIX A;  4ZB8 A;  4EDY A;  3GNJ A;  2CV4 A;  2ERS A;  3QDN A;  1FG4 A;  2NBS A;  4YQU A;  2VUP A;  4IHU A;  5ELA A;  1O85 A;  4EVM A;  1B2O A;  2WCI A;  4MMM A;  4LMV A;  1LTL A;  3LJR A;  1T9P A;  2HSH A;  2H0G A;  4XIH A;  3M8N A;  1EV4 A;  1SMU A;  3ZTL A;  2VCW A;  3IDV A;  3ZVJ A;  1YK4 A;  4I2U A;  4O5Q A;  1S30 A;  2OBI A;  5ENU A;  3WT1 A;  3CSH A;  5F0G A;  1F3B A;  5MF6 A;  1YEX A;  3E9J B;  3A44 A;  2WGR A;  2XJQ A;  1OKD A;  1QQ2 A;  1TI3 A;  3PKI A;  2XPE A;  2DML A;  3RBT A;  2X99 A;  2L0Z A;  3PIP 1;  2WDU A;  1R5A A;  2L57 A;  4TVE A;  2JSZ A;  2QSI A;  5JWQ B;  1W4V A;  4PX1 A;  2VLU A;  2GQK A;  11GS A;  4YQM A;  1BX9 A;  2A2S A;  4MJE A;  2XPD A;  4OCE A;  4JAE A;  1GTI A;  3EMP A;  5GZZ B;  2AJQ B;  1G7E A;  5G5E A;  2H66 A;  3DRN A;  1IYH A;  3GTU B;  4OWY A;  3GYK A;  5AGY A;  1EOG A;  5D96 A;  3QPM A;  6GST A;  3MPS A;  12GS A;  4NWY A;  2WS2 A;  1WMJ A;  2Z9S A;  5JCU A;  1R0G A;  3TJG A;  3CRU A;  3RDW A;  2LQO A;  1B2J A;  1ODH A;  3F3R A;  1THO A;  1OC3 A;  3PR8 A;  3GH9 A;  4N0Z A;  3IC8 A;  1PX6 A;  1J9B A;  2CVK A;  3L9S A;  4KDY A;  4USS A;  3KIJ A;  3UOM A;  1SMM A;  2IMF A;  1FAA A;  2K8S A;  2A4V A;  4MAB A;  2NDO A;  3M0F A;  1OWB A;  1K3Y A;  4AHZ A;  4XRD A;  2VD0 A;  3D4M A;  3HYP A;  1VZI A;  3WYW A;  1IU5 A;  2Z3Q B;  3LYP A;  1WP0 A;  4XHM A;  4KF9 A;  3CSI A;  1ERU A;  2HRA A;  3KP8 A;  3HA9 A;  1A23 A;  3O3T A;  2KN9 A;  4O5U A;  2IJY A;  4FYB A;  2RDV A;  2HT9 A;  5HFG A;  4DSS A;  1XPV A;  1YV1 A;  2QKE A;  5LCZ A;  1S3C A;  4JBB A;  2DIY A;  1Y25 A;  4IP6 A;  2XJT A;  2CZ3 A;  4K2D A;  3FZ9 A;  1ERT A;  2XJU A;  4YKG A;  2FA8 A;  3TCO A;  2FWF A;  1XIY A;  3FMW A;  1TU8 A;  4EKZ A;  3MDK A;  4ECI A;  4MF5 A;  1KEB A;  2VLV A;  4RI7 A;  2WB9 A;  1B9Y C;  6GSS A;  4I2T A;  2K8V A;  3QD9 A;  2REM A;  3Q19 A;  4JR6 A;  3LNL A;  3A5W A;  1EEM A;  2M46 A;  2B5X A;  2GQM A;  4POK A;  1WJK A;  5E4W A;  4ECC A;  2DJ1 A;  4ICY A;  2AYT A;  2N5F A;  3BCI A;  1RW1 A;  2A6E D;  4NMU A;  1LU4 A;  1ILO A;  2F51 A;  4HZ2 A;  3KMO A;  1SJI A;  2B3S A;  4BWS A;  4AGS A;  5ECN B;  4O32 A;  3IHQ A;  4V2N A;  1YUZ A;  2DSA A;  4IGJ A;  3DWV A;  3MSU A;  4IKH A;  2H8L A;  3KTB A;  1B71 A;  3GTU A;  4TR3 A;  3K8N A;  2JZR A;  5BRT A;  2X8G A;  3IK9 A;  1IU6 A;  5GAH c;  2DLX A;  1O81 A;  3PIO 1;  2O87 A;  4QL7 A;  4IEL A;  1T7P B;  2UZ8 A;  1DX8 A;  3GFK A;  2LNT A;  2E0Q A;  1MDJ A;  1THX A;  3P8W A;  2VCT A;  1ON4 A;  4ID0 A;  4PUR A;  4ME3 A;  4ECB A;  3ZG6 A;  3V1W A;  2R4V A;  1SK0 A;  3PGT A;  1VZG A;  3G7I A;  3P2A A;  4WEY A;  5IMC A;  5H5S A;  3ME8 A;  4BVY B;  1HQO A;  1N8J A;  4GSN A;  1IRO A;  1T00 A;  2AAW A;  1TXX A;  3KZQ A;  5B7C A;  3HD5 A;  2L5L A;  1B4P A;  3UBL A;  3FEU A;  2L4Q A;  3RZT A;  4UY8 1;  5JVH 1;  2A2P A;  4GWR A;  3TRX A;  1YKC A;  1ERV A;  1M2B A;  2WJU A;  4WKW A;  2A68 D;  2C80 A;  3P90 A;  1O6J A;  2R0P A;  1MTC A;  5CYY A;  1BQ9 A;  4LLR A;  1ZYP A;  3W8J A;  4KDU A;  3TKR A;  3GHA A;  1QGV A;  1IRN A;  3SBC A;  2DKH A;  1GTU A;  3Q74 A;  5ID2 B;  3M3M A;  4OFM A;  4V2M A;  4ZIJ A;  5MFZ A;  2L6D A;  2I1U A;  4G2E A;  4PNG A;  2IFQ B;  1Z7P A;  4YAP A;  7GSS A;  3R2Q A;  4Z2R A;  5CAX A;  4MF7 A;  3LQ7 A;  1F3A A;  1Z3E A;  1AW9 A;  2GQL A;  5G31 A;  3P7X A;  5COH A;  2YJH A;  2DJ0 A;  1OKT A;  3O76 A;  2FA4 A;  2PBJ A;  2V32 A;  3DGQ A;  1TRW A;  3PIN A;  2RLI A;  2R5G A;  3APO A;  2C3T A;  1ZOF A;  3QVD A;  3ED3 A;  4FYU A;  3FW2 A;  3TDG A;  5CRE A;  2B7K A;  1S2Z A;  1SD9 A;  1Q98 A;  4WBR D;  1T1V A;  1QK8 A;  1TTZ A;  4LMW A;  3GST A;  5J4U A;  3K35 A;  4NPB A;  3LFL A;  3FZ4 A;  2B7J A;  2JI1 A;  5GAG c;  4GF0 A;  5HFI A;  1S3A A;  1SD8 A;  1DE2 A;  22GS A;  2TIR A;  4PUA A;  3B08 B;  3PZA A;  5HR2 A;  4RI6 A;  3VK9 A;  4POM A;  1AQX A;  5ECL B;  2H1D A;  2V1M A;  4GXZ A;  2G2Q A;  2DJ3 A;  1ZYE A;  4E6Y A;  1R0I A;  1DE1 A;  2OKA A;  2BJX A;  3ZRE A;  1NW2 A;  13GS A;  3KYU A;  2VL3 A;  2ON5 A;  3IE3 A;  3GIX A;  2QGV A;  1EP7 A;  4AI0 A;  4BVY A;  3D5J A;  1F37 A;  2QA2 A;  5A4W A;  3F0I A;  2H72 A;  3GL3 A;  4X4J A;  3KH7 A;  1V40 A;  2PYA A;  5KN3 A;  4J56 E;  1B48 A;  2I3Y A;  1PGT A;  2MZC A;  1RDV A;  2PSM C;  3FR6 A;  4Z2U A;  5A4V A;  4MZB A;  4GLT A;  1AAZ A;  3ERG A;  2FWE A;  1GUK A;  4TVM A;  3HJM A;  3FY7 A;  4BPY A;  3HJP A;  1YY7 A;  1U3I A;  3BOA A;  4GRF A;  5LD0 A;  4LHL A;  5H5R A;  1TRV A;  4BVX B;  1TRS A;  2LTK A;  5IPH A;  2AB6 A;  3FKF A;  2KUC A;  2K18 A;  4KX4 A;  5DDL A;  4IQA A;  2AYJ A;  4TR1 A;  2TRX A;  3ZFB A;  5ID2 A;  2DJ2 A;  3FR9 A;  3TJB A;  2DKI A;  3RHC A;  1GLP A;  2IFQ A;  4RQX A;  4EF0 A;  5J3R A;  1AXD A;  4POB A;  2LJR A;  2HYX A;  2GVP A;  4AHY A;  1BYE A;  3J7Y 1;  4AR5 A;  1MD3 A;  4PNF A;  1I9D A;  2IMD A;  1VRS D;  5IOX A;  4A5P A;  4NHZ A;  1PL2 A;  2PUK C;  1ZGN A;  1CQH A;  1SKS B;  2X64 A;  1UC7 A;  2A4H A;  2KOK A;  1RDG A;  5GAN D;  4F03 A;  1YJ6 A;  2M72 A;  3VWV A;  4IW9 A;  4XCS A;  5DCH A;  3TKP A;  2DIZ A;  5DVB A;  5DJM A;  5B6N A;  2MMA A;  2RUE A;  1ZYN A;  1PL1 A;  3ERW A;  2C3Q A;  4HDE A;  3D0Z A;  4G19 A;  1Z92 B;  5AIX A;  1X9M B;  2B5I D;  1X5D A;  1M9B A;  1RWD A;  7RXN A;  2FY6 A;  1A8Y A;  1TP9 A;  1MEK A;  1E6B A;  4BWQ A;  2AUV A;  1EP8 A;  2KLX A;  3ME7 A;  2L5O A;  4F82 A;  1YEP A;  1A24 A;  1HNB A;  3C7M A;  4Q5F A;  2LRT A;  4YWL A;  4LHN A;  1F9M A;  2R2J A;  3ZFL A;  1PSQ A;  5F06 A;  2C3N A;  2K9F A;  4TR0 A;  3IC4 A;  1AQV A;  4OFT A;  1ZRP A;  2H74 A;  4HQS A;  1RK4 A;  3EU3 A;  3WD6 A;  4NHW A;  3PPU A;  2YAN A;  2ES7 A;  2HFD A;  2MMZ A;  1YF0 A;  2LS5 A;  3H1N A;  3M1G A;  4P3Y B;  5AN9 H;  4MLY A;  3F9U A;  1T9O A;  2H30 A;  4MNN A;  2VM1 A;  2C1Y A;  3UEM A;  1EWX A;  2GS3 A;  2N5B A;  2VM2 A;  3CXG A;  5JCG A;  3HKR A;  1Q4J A;  3NOF A;  2CZ2 A;  2F8F A;  1QMV A;  2PN8 A;  2JL4 A;  1ZMA A;  3EVI A;  4OCF A;  5DAL B;  4X1U A;  4MDC A;  3UJ1 A;  5H5Q A;  3VI5 A;  1JZD A;  4RUV A;  5KOX A;  4CY8 A;  2V6K A;  4FIW A;  5HFK A;  1SMW A;  2OBK A;  2RM5 A;  4XS4 B;  2YCD A;  1XXU A;  2CAI A;  3TKQ A;  5ECR B;  2EIR A;  3EUR A;  3C71 A;  2JI2 A;  4ZIL A;  1HYU A;  1YQ1 A;  1MDK A;  4GQC A;  6RXN A;  5ELG A;  1J08 A;  3BBY A;  5IMZ A;  3IPZ A;  4JU5 A;  4OMV A;  4TXO B;  2CVD A;  5L71 A;  1LBK A;  2B6M A;  4K9Z A;  1YK5 A;  2VD1 A;  5LNK e;  2F3M A;  3MSZ A;  2PGT A;  1FVJ A;  3EU4 A;  1H4O A;  4MF6 A;  1XFL A;  1ZZY A;  3Q18 A;  1SKW B;  4KSO A;  3WGD A;  2R0G A;  4I6X A;  3B0A B;  2KP1 A;  5KN0 A;  2GMG A;  3J7Y b;  1BED A;  4G0I A;  1KTE A;  2F9S A;  3KCM A;  5AN1 A;  3OR5 A;  1GL8 A;  3KH9 A;  1KNG A;  4K1F A;  5DAK B;  1SU9 A;  3L0H A;  2OE0 A;  1M2A A;  1PD2 1;  1OC8 A;  4G10 A;  4KB3 A;  2C0E A;  1GUL A;  1E8J A;  5CRW A;  2OA7 A;  3PKJ A;  1XWC A;  1T8E B;  2GZP A;  1TOF A;  1BJX A;  2WRT A;  1MDI A;  3TUE A;  3HJO A;  4KGI A;  1V98 A;  4POF A;  4TKY A;  3I6A A;  4XTS A;  1PX7 A;  3CTG A;  5EY6 A;  1DBY A;  4XRA A;  5D9V A;  3LW9 A;  1XWA A;  3W6G A;  3NZN A;  4E8E A;  2K6V A;  2DBC A;  2M4Y A;  1IW7 D;  2MS3 A;  3LPE B;  1TDI A;  3EIN A;  3TRQ A;  3Q6O A;  2IWT A;  5MFP A;  3TJK A;  2V0F A;  2H0I A;  2LEG A;  2LCQ A;  4L0U A;  1XOA A;  3KYV A;  1PN0 A;  5DCG A;  4HU7 A;  1NHO A;  4WF4 A;  1LKO A;  4AJ6 A;  2M6P A;  5MLC 3;  4ML6 A;  8RXN A;  1QCV A;  4QQ7 A;  1OE8 A;  1H75 A;  3ZML A;  4JE1 A;  3F63 A;  2IPA A;  4HEA 2;  1VZH A;  4WBJ A;  2FLS A;  5B8B A;  4AR3 A;  4FH8 A;  3CMI A;  3IK7 A;  4JAF A;  1GSY A;  4D73 B;  3DKS A;  3TKS C;  2NPB A;  5EVO A;  3TB2 A;  5J5N A;  4L5O A;  2XBI A;  5IOW A;  1W89 A;  1NXG A;  1GNW A;  1U3A A;  3A5I A;  3RYG A;  4MCU A;  2OAC A;  1WJV A;  4AHX A;  2H76 A;  2JI3 A;  2PVQ A;  4I5Q A;  4AHW A;  2HLS A;  4YQV A;  3H79 A;  4HQZ A;  2YWN A;  3TKS A;  4TXO A;  2IMI A;  2HZE B;  4HS1 A;  2F8A A;  4I8B A;  5IMA A;  1HNA A;  2MBT A;  3IAM 2;  1O73 A;  5C04 A;  2XJR A;  4K5R A;  5F8B A;  3TGZ A;  3GSS A;  3KYX A;  4MJB A;  4ZN1 B;  3ZIT A;  3KM6 A;  2QC7 A;  2M6O A;  2VL6 A;  2FWH A;  2JZT A;  4KCA A;  2B1L A;  3C1S A;  1J0F A;  3ERF A;  2HZF A;  1VF3 A;  2L59 A;  3LG6 A;  2RII A;  2LRN A;  3VFI A;  4PQ1 A;  4CY6 A;  4XXB B;  1FO5 A;  5IMV A;  5RXN A;  2ERJ A;  2DJJ A;  5DAK A;  1OC9 B;  2J9H A;  1Z6N A;  1A2M A;  3HY2 A;  4WR5 A;  3NFP I;  4JRR A;  1SJ6 A;  4IVF A;  2VAF A;  3GMF A;  4WF5 A;  2C8U A;  5GAD c;  2IL3 A;  2OAD A;  2VIM A;  5AIV A;  1O8W A;  2IIY A;  4I97 A;  9GSS A;  1CAD A;  1AC1 A;  4K6X A;  2M80 A;  2LUS A;  2AHE A;  4ZL8 A;  3NIV A;  2GSQ A;  2D2Z A;  1WE0 A;  1AQW A;  5AI3 A;  4K0N A;  1QYB A;  1YDK A;  1NM3 A;  3APS A;  4KE3 A;  4EDZ A;  3FR3 A;  4AF2 A;  4WXT A;  1GWC A;  2YN1 A;  2EIO A;  1T4Y A;  4CDO A;  3FYG A;  1JYB A;  2CT6 A;  2CX3 A;  2VCX A;  3U5R E;  3IAS 2;  3KP9 A;  4H86 A;  4WR4 A;  2RM6 A;  4K7N A;  1PMT A;  1EGR A;  4N30 A;  2GDR A;  1GRX A;  3C73 A;  4YH2 A;  3TJF A;  4F0C A;  3D6I A;  3UIW A;  4XGH A;  2C6A A;  4E8H A;  5ECS A;  2VL2 C;  3VWX A;  4JR4 A;  4D73 A;  4ZN3 B;  4Q5N A;  1Z6M A;  5BMU A;  3SS2 A;  4EL1 A;  1BQ8 A;  1Y6E A;  1FW1 A;  2DSX A;  3MYD A;  4V1A p;  1G6Y A;  2LJK A;  4K5S A;  1XCC A;  3JCM L;  1OVN A;  4Z7X A;  19GS A;  2L6C A;  2R6K A;  1XWK A;  3ZMK A;  3LGC A;  1R5P A;  4AR6 A;  4TRX A;  1ML6 A;  5FHI A;  4XS6 A;  2HZE A;  3KYW A;  1E2Y A;  4TOP A;  3KXO A;  2CR8 A;  5INY A;  5JWO B;  1TK8 B;  3IXR A;  2FHE A;  2WFC A;  2P0G A;  5FT3 A;  1Z5Y E;  2A6H D;  4BA7 A;  2H0H A;  2H6Y A;  6GSU A;  4HJM A;  5IQY A;  17GS A;  2CX4 A;  3LSZ A;  2O8V B;  1K0O A;  1K0M A;  1T9Q A;  2GSR A;  4KH7 A;  2MMO A;  3N9J A;  1QUW A;  3SWL A;  3EC3 A;  4JAG A;  3F4R A;  2B1K A;  3GUR A;  2XJV A;  3QR6 A;  1NXE A;  3FK8 A;  1BG5 A;  3WT2 A;  2RUF A;  3U6V A;  5ECH B;  1OC9 A;  4B8C D;  4N10 A;  2ZUP A;  5CRD A;  1KBN A;  4J57 E;  3ZZX A;  3EWL A;  1B8X A;  1F6M C;  1Z9H A;  3RPP A;  5IO2 A;  4PTS A;  2PU9 C;  2H1G A;  3MAK A;  1U87 A;  1XBS A;  3G9B A;  4RQR A;  1X5C A;  3VWW A;  1USB A;  3DIE A;  3UL3 A;  2GT6 A;  3HHV A;  3CSJ A;  2MBS A;  3GX8 A;  4KW6 A;  1YF1 A;  1TK0 B;  2GT5 A;  4GST A;  3ZLP A;  4LL1 B;  1NNQ A;  2IMK A;  4PXO A;  1R0J A;  1WPI A;  5F05 A;  1MD4 A;  4ACS A;  8GSS A;  1X0R A;  2J23 A;  3H93 A;  4K7I A;  1EV9 A;  4ZL7 A;  4NV2 A;  2OE3 A;  5HR1 A;  1K0N A;  4ZL9 A;  1C72 A;  1WRY A;  5GST A;  4POG A;  4NV5 A;  2O7K A;  4ZB6 A;  1TRU A;  4HI7 A;  3VLN A;  3GRX A;  5G2Z A;  2KP2 A;  1FB0 A;  2KHP A;  1ZYQ B;  5DQS A;  3WGE A;  1WIK A;  3ISO A;  3TKS E;  2ZIX A;  4V19 6;  5J41 A;  2WUL A;  4G0K A;  2NYD A;  5KN2 A;  5CRH A;  3IA1 A;  2CKA A;  1K0C A;  5B8A A;  4HU9 A;  1T3B A;  1OYJ A;  2H73 A;  1VF4 A;  5K2M E;  1GTB A;  1C09 A;  2GST A;  4EXJ A;  1WOU A;  5J9B A;  2HRK A;  4ZBA A;  3HDC A;  2TRC P;  1K0D A;  2FWG A;  3HZ4 A;  5D9X A;  4F9Z A;  2VL9 A;  1JZW A;  4G0L A;  2BE5 D;  3WWL A;  1FHM A;  4FO5 A;  1XZO A;  2H70 A;  1O7U A;  2HE3 A;  4LL4 B;  1B13 A;  5CP1 A;  2O89 A;  1JFU A;  2AV4 A;  2QL0 A;  3H4K A;  2CAQ A;  5A5K A;  3J7Z 1;  1R7H A;  2LKU A;  3QCP A;  3QQC E;  3FRC A;  5J9C A;  3UVT A;  1ST9 A;  2C6B A;  5ECK B;  5CRG A;  2P31 A;  3M9J A;  1LKM A;  4WET A;  1PN9 A;  4LA1 A;  4O5R A;  1M7T A;  4EC0 A;  1SL2 B;  2H19 A;  4ZXG A;  1ZL9 A;  5JVG 1;  4AJ8 A;  1K3O A;  2VO4 A;  4WFN 1;  2YZH A;  3F4T A;  3GV1 A;  2PWJ A;  3AY8 A;  3QFA C;  2YPM A;  5IPG A;  1SYR A;  5D73 A;  4MJA A;  4HOJ A;  1XVW A;  3GL5 A;  5EIN C;  2C0F A;  4KSM A;  1GNE A;  4BVX A;  1GSQ A;  1V57 A;  2EIQ A;  1RYQ A;  4DSQ A;  2IME A;  3LEF A;  2VCZ A;  2PER A;  2B5E A;  3DML A;  3I9V 2;  3G7Y A;  5D8I A;  2MMN A;  5HR3 A;  1B4Q A;  3TJJ A;  1XW6 A;  4KUN A;  2ZCT A;  1R26 A;  1X5E A;  2YWM A;  2H75 A;  2X8C A;  2R3X A;  2P5Q A;  4G9H A;  1U88 A;  4F2I A;  3P8B A;  3DYR A;  1JLV A;  4GS7 D;  2ALB A;  3IBH A;  2CQ9 A;  1SJZ A;  4OD7 A;  5AI2 A;  2LST A;  3GN3 A;  1YZX A;  5DBQ A;  1GSU A;  3VPB E;  2FGX A;  3G7J A;  1BQ7 A;  5HR0 A;  2N5A A;  3A2X A;  1I5G A;  2P5R A;  1AIU A;  3PWF A;  4L5L A;  1RYT A;  2ON7 A;  4EIQ A;  2C0G A;  3US3 A;  3DD3 A;  3LOR A;  2YV7 A;  1GUH A;  1QXH A;  5G1L A;  4DVC A;  1LJR A;  2L4C A;  4IP1 A;  4IS0 A;  2V41 A;  3GUS A;  3C8E A;  1BRF A;  3KYY A;  3KMN A;  2YOI A;  2I4A A;  2JAD A;  4JAD A;  3ZIJ A;  1OE7 A;  1JHB A;  2LQQ A;  1LKP A;  1YUX A;  1UN2 A;  2C4J A;  2CKC A;  3D22 A;  2R0C A;  4AR4 A;  1ZCP A;  3L9V A;  2GLR A;  3KGK A;  14GS A;  1SEN A;  2H6Z A;  4MH3 A;  4ILF A;  3ZRD A;  1JZR A;  3F8U A;  4EIP A;  5DM6 1;  1BAY A;  3N5O A;  3QOU A;  1XW9 A;  1RQM A;  1GSF A;  2R37 A;  5A4U A;  4TPU A;  2H71 A;  4HUA A;  2XJS A;  3IV4 A;  3GKN A;  2O85 A;  4TN8 A;  3HXS A;  3BCK A;  1FVK A;  3HZ8 A;  4X43 A;  2X49 A;  3I43 A;  5D9T A;  3GH6 A;  1G7O A;  2LV3 A;  5EL8 A;  3F4S A;  4U67 1;  2BMX A;  3IOS A;  3D4T A;  3GKM A;  2LRC A;  4DEJ A;  3VWU A;  2JSY A;  1GUM A;  1TJD A;  4X0X A;  2PVO C;  2YZU A;  4L0W A;  1GLQ A;  4IQ1 A;  4Z2T A;  3PH9 A;  2YJ7 A;  4YAV A;  2GSS A;  5IMF A;  3TRP A;  1BFY A;  2GZZ A;  2M4V A;  1GSS A;  3HVS A;  5DAL A;  1URM A;  2FNO A;  3ZIV A;  3C1R A;  4AJ7 A;  2VLT A;  1VF1 A;  2H12 A;  3I69 A;  1M0U A;  3MNG A;  3QAV A;  5ECM B;  4EO3 A;  1OAZ A;  5ECQ B;  4KCE A;  4XS4 A;  1SYX A;  4AI2 A;  4PUF C;  4PGT A;  5ECO B;  4GCI A;  5F07 A;  5D93 A;  4K2X A;  5JWR B;  4IJI A;  1PKW A;  2H1A A;  3A3T A;  4YKF A;  5HQP A;  1TU7 A;  2A2R A;  2FD3 A;  6GSV A;  2YNX A;  4TXV A;  2PVE A;  2DMM A;  2J9U B;  4EUY A;  2YWI A;  4PQI A;  4EE0 A;  3R3E A;  4ZBD A;  2C0D A;  2BTO T;  1A8L A;  2G0F A;  3E0U A;  5D9W A;  2K2D A;  5CO3 A;  2HR5 A;  2XC2 A;  4GQF A;  5MGN A;  3KD0 A;  3IU3 I;  1N2A A;  1CQG A;  4N0V A;  1TKD B;  3QFB C;  4OO4 A;  4TW5 A;  1S24 A;  3FZ5 A;  2X4A A;  4ZB9 A;  1Z7R A;  4AI3 A;  4JED A;  3UMA A;  1EEJ A;  3GKK A;  1ERW A;  2HNL A;  4K7O A;  2JU5 A;  3IR4 A;  1VF2 A;  1RB9 A;  2XBQ A;  5IO0 A;  4O92 A;  4MH2 A;  1SK1 A;  3BD2 A;  3L78 A;  3TOT A;  4CW9 A;  1A0F A;  5KN1 A;  4KA0 A;  3KTL A;  5C00 A;  4AI1 A;  5GAE c;  1XOB A;  2E2M A;  2XHF A;  5GAP D;  1B9X C;  2WZ9 A;  5G30 A;  4ISD A;  2X8H A;  3H8Q A;  2XJP A;  4MJC A;  3LXT A;  1HNC A;  2FUG 2;  3F6F A;  4DSR A;  1FOH A;  3F3Q A;  2GTU A;  3FZA A;  4BL7 B;  4O7H A;  5ECI B;  5FWG A;  1NHY A;  4V1A g;  3DVX A;  3UBK A;  2HSM A;  2CA8 A;  3IRA A;  1FOV A;  4J2F A;  1T4Z A;  2H1B A;  1FHE A;  1GP1 A;  4G6B A;  1YKA A;  2NVL A;  4TR1 B;  3EE2 A;  2YWO A;  2YP6 A;  5JCW A;  1EZK A;  3QAW A;  2H01 A;  1R0F A;  1HD2 A;  2HRN A;  4HJ2 A;  5ECP B;  4K0G A;  2I81 A;  1ACV A;  4KAE A;  2V2G A;  4QL9 A;  2DJK A;  4F0B A;  2V6O A;  2GGT A;  1JLW A;  3RHB A;  2E7P A;  1NSW A;  6GSX A;  3KEB A;  3BJ5 A;  3CRT A;  1EOH A;  2I9H A;  1ABA A;  1PQN A;  3D21 A;  1QFN A;  1JZO A;  3WWN B;  2JZS A;  4K9F A;  3MWH A;  4ECJ A;  2HSY A;  3ZVJ D;  1H7V A;  3APQ A;  1K0A A;  1R0H A;  2O5J D;  4IBP A;  3QAG A;  4RXN A;  4MZC A;  2VL2 A;  1XVQ A;  1XWB A;  4V2L A;  1SKR B;  4MPG A;  3UAP A;  3VPQ A;  5GSS A;  5DJL A;  6GSW A;  3LYK A;  2JAC A;  3GA4 A;  1SL0 B;  3GX0 A;  3VUR A;  3CYN A;  1GSE A;  3VI7 A;  2ZNM A;  4NXI A;  1X9W B;  3J7Y k;  4GSS A;  1XW5 A;  4GTU A;  4FYC A;  3A2V A;  1K3L A;  3QMX A;  4KDX A;  2CVB A;  1G0T A;  1O8X A;  1M9A A;  1PRX A;  2VOC A;  5G1K A;  1K0B A;  1UA5 A;  4L8E A;  3O6T A;  1DSB A;  3CTF A;  4MK3 A;  1A2L A;  3LWA A;  1AUC A;  20GS A;  1X9S B;  3M9K A;  2LJA A;  3LXZ A;  3EPT A;  3HVV A;  3EYT A;  1G6W A;  5H1S c;  1FHH A;  1GTA A;  4IJ3 A;  3W8S A;  3A2W A;  5IY0 A;  2B5Y A;  4ULX A;  5IMD A;  4N11 A;  3DXB A;  1PA3 A;  2HI7 A;  2Z3R B;  1U6T A;  5DM7 1;  5IIZ A;  3KJY A;  4PQH A;  4MZW A;  4FQU A;  3RZ6 A;  3HVX A;  3RAZ A;  3ZYW A;  1PKZ A;  1DUG A;  1R4W A;  2PPT A;  4POL A;  1GH2 A;  5B6M A;  3CBU A;  2HRF A;  4YWM A;  4JZQ A;  5KEJ A;  3L9U A;  4OFN A;  1A0R P;  1XWG A;  3DVW A;  4BL7 A;  2LNS A;  1OWC A;  1VCX A;  1DVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...