2PPTA

Crystal structure of thioredoxin-2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
149
structure length
149
Chain Sequence
MMGAKMAESLRLTCLACGQANKVPSDRLAAGPKCGICGAGLITGKVAGIDPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords thioredoxin-2
publication title Crystal Structure of thioredoxin-2
rcsb
source organism Rhodobacter capsulatus
total genus 39
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2007-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.140 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2pptA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pptA02
2ON5A 2YN1A 1WJKA 3ZIVA 1BG5A 1B4PA 4MH2A 1A0FA 4XTSA 5ENUA 4MH3A 4JBBA 1XOBA 3HVXA 4PQ1A 2H0IA 3QAWA 3ZZXA 3IAM2 2HZEA 2KP2A 1SKSB 3VPTA 2IMEA 2ES7A 2LTKA 4ZXGA 4HJMA 3RPPA 1GSQA 2HFDA 5HR3A 2JZRA 4MZCA 1B9YC 3TKSE 2FWGA 3Q74A 4WBJA 2M80A 2RM6A 4KH7A 5DQSA 2X8HA 3TUEA 2CVBA 4IKHA 2I4AA 1T4YA 5IO0A 1GLPA 4ECCA 3KMNA 5C00A 1SJIA 1OAZA 1V98A 5J4UA 4NAXA 1W89A 3PH9A 1GUHA 4BL7A 3TKPA 2M72A 3HA9A 1PL1A 3DWVA 3GH9A 4NHWA 2LJRA 3GSTA 1I9DA 1TRWA 4MF6A 2GVPA 4DSSA 1A0RP 1A2MA 1HYUA 4IHUA 2E0QA 5DAKA 3HZ4A 1G7EA 4XHMA 4N0VA 2WS2A 2VL9A 3FK8A 1ERTA 2OADA 1WIKA 2L5OA 1YF0A 4PUFC 4AF2A 5EY6A 1NHOA 3N9JA 1SU9A 4WXTA 1TU7A 4MDCA 2HNLA 1DE2A 1GNEA 1KBNA 1CQHA 2DJJA 3IV4A 3AY8A 1JZWA 2KHPA 4K7IA 4KDUA 1EOHA 4AJ7A 2YJHA 3RHBA 3TKSC 2VD1A 3HDCA 3W8SA 1BAYA 5CP1A 1PX7A 3A3TA 1ERUA 13GSA 1IYHA 5D8IA 4F0BA 2LV3A 3F0IA 2CVDA 3TDGA 2JU5A 2AUVA 3ZLPA 2GZYA 4NMUA 4N10A 1XBSA 4HOJA 6GSVA 4KA0A 1Z5YE 5IOWA 1AQWA 2EIRA 3GKMA 3HD5A 3TJBA 3BCKA 5DALB 3M0FA 4BWQA 2RLIA 3GFKA 1Y6EA 2LJAA 3L9VA 4P3YB 3UIWA 1G0TA 5JCGA 4TKYA 1U88A 1ML6A 2X64A 1GH2A 4ILFA 2K18A 2LQQA 4TXOB 4J56E 1TI1A 4N0ZA 2FD3A 2DIYA 4J57E 3ZREA 4MJBA 1PMTA 2K6VA 1YQ1A 1M2AA 4MJEA 2X8CA 4ZB9A 2YZUA 1TU8A 2LRNA 3L78A 1GSEA 3ME7A 1M2BA 3EWLA 1K0CA 4TN8A 1QGVA 3VWUA 5AGYA 1YEPA 1ZCPA 1T4ZA 1V9WA 3TKQA 4I5QA 1FVJA 1TXXA 3UBLA 2BTOT 2H66A 2VD0A 3MSZA 3ZVJD 4MABA 1EEJA 1W4VA 20GSA 5ELGA 2V32A 2HT9A 2YV9A 3ISOA 4ZB6A 3H79A 4Q5FA 1ZL9A 1YDKA 4QL7A 2E2MA 5IO2A 1K0DA 5D9TA 1WOUA 2B5YA 3FR3A 4ZL7A 5ECHB 4ECIA 4IQ1A 3IHQA 3HVVA 3CTFA 4ID0A 2N5AA 1QK8A 2HRNA 3MDKA 2VLTA 4KCEA 2PGTA 3KH9A 1HD2A 2B6MA 2MBTA 2CQ9A 4HU9A 4I6XA 1YF1A 3UARA 1VF3A 3GIXA 3RAZA 3A2VA 1GTIA 5IPGA 3DIEA 1GP1A 2AHEA 4I97A 3O6TA 4ZB8A 4I2UA 1U3IA 3TJFA 2MMAA 2EIOA 6GSXA 4EF0A 4PXOA 2OE1A 1B48A 2FLSA 4HQSA 1H75A 3M1GA 3GN3A 1WWJA 1EP7A 4Q5QA 4G2EA 2J9UB 2YV7A 1K3OA 2REMA 1BEDA 2P31A 1ZYQB 2VUPA 1M9AA 4WF4A 1X5CA 2H1AA 2PUKC 4EC0A 2K8VA 4AGSA 3U6VA 1MDKA 1S3CA 3HKRA 1YZXA 3ZITA 1GTUA 3UL3A 1ZOFA 3QPMA 3EE2A 3GNJA 3C7MA 4GLTA 1GRXA 1WE0A 2R2JA 2HE3A 1PL2A 3EMPA 3IA1A 1TKDB 3TRPA 4MF5A 2L4CA 4ZBDA 1MD3A 1R4WA 4JRRA 2DMMA 5ID2A 5A4WA 5G1KA 4J2FA 3TRQA 1SKWB 5CRHA 3HJOA 2VLVA 8GSSA 2VCZA 1GTAA 3HY2A 1M9BA 4XXBB 2H8LA 3LGCA 3O76A 3M8NA 3FZ4A 1AUCA 1FO5A 2CV4A 4O92A 3KTLA 4BVXA 2OKAA 4HU7A 1XXUA 1PKWA 3FYGA 2O8VB 3HVSA 4IELA 4WBRD 3V1WA 1XFLA 1ERWA 1R5AA 3QCPA 4NV5A 2BJXA 2YCDA 3HZ8A 4KE3A 3LYKA 1Z9HA 5EL8A 3C71A 1F9MA 2NDOA 1OE7A 1JZOA 3A2WA 4FO5A 4OCEA 4D73B 3UVHA 2F8AA 3DKSA 1TRSA 4K8MA 2CX4A 1XWKA 3IRAA 4EO3A 2R5GA 4K1FA 1JLVA 4JU5A 1OC9A 3DRNA 3LEFA 5KN0A 1FB0A 1SYXA 2FWHA 4K6XA 3WGDA 5J9CA 2LRTA 1VF2A 1LU4A 5CAXA 3VWWA 2H72A 3M9JA 1FW1A 1K3YA 5CREA 3FRCA 3TB2A 3HXSA 5B6MA 2NTOA 2MMOA 3EU3A 4F82A 5CO3A 2MZCA 1BX9A 5B7CA 2OE0A 1GLQA 3QAVA 3KP9A 2G2QA 1NM3A 3G7YA 1FG4A 2YPMA 3G9BA 1OKDA 3ZL5A 3TOTA 4K9ZA 4YAPA 1TK5B 5KN2A 2GZPA 3C8EA 1M7TA 4GXZA 1ST9A 4MK3A 2C6BA 3IBHA 5GAPD 4L0UA 3G7IA 4HI7A 3FR6A 2L57A 3DVXA 4GSTA 4L5LA 1XPVA 4TR3A 3QFAC 5B6NA 5HFGA 4E8EA 1USBA 3HCZA 2JACA 5A4UA 1EP8A 2H19A 2VO4A 3VK9A 3IDVA 3TKSA 2GTUA 2XC2A 5E59A 3D4MA 2YWOA 7GSSA 2PPTA 4K0NA 2OA7A 2YZHA 3VLNA 5CNWA 3LSZA 1FOVA 2LJKA 4CW9A 3GKNA 1N2AA 1ABAA 2ZNMA 3US3A 4TRXA 2BMXA 5IMDA 1FAAA 2O7KA 1WP0A 4ECBA 1Y25A 3P2AA 4PURA 2DSAA 4GSNA 3F3RA 4BA7A 3BBYA 1B8XA 4ML6A 17GSA 3EYTA 2R37A 5E4WA 3NIVA 1AAZA 3O3TA 5IIZA 1J0FA 1RK4A 3HHVA 5J3RA 3I69A 3P7XA 3IC4A 2AJQB 2CA8A 3LQ7A 1TK0B 2NPBA 3RBTA 5FHIA 4TVEA 2RUFA 3HYPA 3W6GA 5ECOB 3FHKA 3RHCA 5INYA 2IFQB 5LD0A 2VLUA 1GULA 2H1GA 14GSA 3QAGA 2VCQA 3C73A 3UOMA 1TTZA 2P5RA 3HJPA 4EVMA 3TJKA 2MYGA 1XVQA 1WRYA 5C04A 3G7JA 4WKWA 3TCOA 1V57A 1TRUA 3JCML 4X1UA 3CRUA 2DJ2A 1NW2A 2JSYA 2NBSA 4F0CA 3ERFA 1Q98A 3IAS2 3GH6A 2F51A 4XIHA 4TR1A 2C3QA 5ECSA 4OFTA 1GSUA 2H74A 4JR6A 3BJ5A 4K7OA 5G1LA 2HYXA 1UA5A 3EC3A 3H1NA 2H71A 1QQ2A 1XZOA 1M99A 4YQMA 1A2LA 1FB6A 1R5PA 3LWAA 3GURA 2QSIA 2FWFA 1X5DA 4XCSA 22GSA 4XS4B 4BWSA 2VAFA 4EXJA 4OWYA 5B8BA 3DVWA 3LYPA 3Q18A 2WGRA 5GAND 5DCGA 3ME8A 2IL3A 2O85A 4Q5RA 4GRFA 1GUMA 2F3MA 3DXBA 5CYYA 4JEDA 1K0AA 5ECPB 3BD2A 5JCUA 2PVOC 4RUVA 5L71A 1DE1A 5IPHA 1Z3EA 2DLXA 4IVFA 2HRFA 2Z9SA 1TW9A 2V6KA 5IMFA 4H86A 3QMXA 4FIWA 4CHSA 2OBIA 3ZFBA 2CZ3A 3IE3A 3GTUA 2PERA 1QMVA 3QOUA 1X5EA 4V1Ag 2IMDA 3WT2A 1TRVA 2B7JA 4QL9A 2TRXA 1G7OA 5FT3A 1MD4A 2HI7A 2H0HA 2HLSA 3APQA 1FHEA 4HZ2A 3FZAA 4ZBBA 1Q4JA 4IQAA 1X9SB 1V58A 5J41A 1UN2A 5H5RA 5KN3A 3WYWA 3ZMKA 1SJZA 2VCXA 4GWRA 3L9UA 5ABRA 3RDWA 3UMAA 3FZ9A 5F06A 4HUAA 2LNTA 1O8XA 1WPIA 3GUSA 1AQVA 1EWXA 4PGTA 2XBIA 4XS6A 1NHYA 1PA3A 2MMNA 2YWIA 2JADA 3D5JA 2FCHA 3IK7A 1QUWA 1S3AA 1XW9A 1Z6MA 2B7KA 2VIMA 1B9XC 1ON4A 3E3EA 3GKKA 4Q5NA 2GGTA 4OMVA 2WZ9A 1FVKA 5ELAA 2R6KA 2WFCA 2A2RA 4E8HA 3Q19A 4K0GA 4L5OA 2GT5A 1GSYA 2GQKA 4EL1A 1EZKA 2M46A 16GSA 4EE0A 4POLA 2KUCA 2VL2C 3FKFA 3VI5A 3F3QA 4IBPA 4KDYA 1S3DA 2ZCTA 1U6TA 4GF0A 3D6IA 1U3AA 2TRCP 5DQYA 5CRDA 3IPZA 1XWGA 2N5FA 3GMFA 1U87A 2LUSA 3GYKA 3L9SA 5DDLA 5ECMB 4N11A 1EOGA 4HS1A 4KX4A 1K0BA 3GKXA 1UC7A 2R4VA 4OFMA 4G19A 4HQZA 2C0DA 2GLRA 2CAQA 2I3YA 2V2GA 3VWVA 1SK2A 2WJUA 3D4TA 2I1UA 3TJJA 5D9VA 2HZEB 1N8JA 5ECIB 1ZYEA 2GQMA 4X0XA 4O7HA 3TKRA 3IOSA 3SBCA 1PQNA 1O85A 2R3XA 1MTCA 4HJ2A 5DJMA 2IN3A 2C0FA 4F03A 3U5RE 1DUGA 3QDNA 4BVYA 2C8UA 4XRDA 3APOA 2IWTA 3SWLA 1PX6A 4YH2A 2GT6A 4AJ8A 2CZ2A 1SK1A 4L0WA 3FR9A 4NHZA 1E2YA 2X8GA 3FY7A 2K8SA 2CT6A 4EDZA 1XWCA 1HNCA 5D9WA 3A2XA 2IMIA 1Z7PA 3CYNA 1NSWA 4JE1A 4DSSB 1MDIA 4MP4A 3LXZA 1SL2B 3MAKA 2RIIA 4NV2A 2V1MA 2YWNA 4KAEA 1Z6NA 3K8NA 1JFUA 2RM5A 5DAKB 5D9XA 5CRWA 5AIXA 4XRAA 1SYRA 2DC5A 2HSYA 1DSBA 3QR6A 4KB3A 2C80A 2PMTA 3DEXA 2OACA 1EGOA 1T00A 5LCZA 5DALA 2B1KA 5DCHA 4WR5A 4KW6A 3CSJA 5IQYA 1C72A 3I6AA 3IR4A 4EKZA 1O7UA 1I5GA 1RQMA 4RI6A 4TXOA 4MZWA 2KLXA 2O87A 1EEMA 1J9BA 4LL1B 1B4QA 3S9FA 3D21A 2CX3A 2LS5A 1LJRA 18GSA 3P8WA 2GS3A 4KCAA 2H6YA 2GSTA 4QQ7A 1QXHA 4NWYA 4MF7A 4ZIJA 5IMVA 4G9HA 5ECNB 1VGLA 2FUG2 3ED3A 4N30A 2FY6A 5D93A 2DIZA 3UJ1A 4KDXA 1F2EA 3TGZA 3UEMA 1T1VA 4NXIA 1PSQA 2YOIA 1KTEA 3VPQA 1K3LA 2AB6A 1GSFA 3GA4A 3B0AB 3F4RA 4GQCA 1RW1A 2VCTA 1YY7A 1JHBA 1YJ6A 2I9HA 5F05A 5D73A 2VM2A 3I9V2 1G6YA 2PVQA 3D0ZA 3F4SA 4O5RA 3KD0A 3FZ5A 1BYEA 3C1SA 2L4QA 2B1LA 3KXOA 1O81A 3ZIJA 1GSDA 2F8FA 2GDRA 2WDUA 4TXVA 4HZ4A 6GSYA 4MPFA 2KOKA 1A8YA 5A4VA 4IP6A 2P5QA 3CTGA 2C1YA 5IMCA 2VCVA 4DSRA 5G5FA 4GQFA 4HDEA 3CMIA 4ECJA 1SD8A 5F0GA 3WT1A 4TR0A 1VF4A 2IMKA 5JWQB 1SJ6A 3RPNA 2FA4A 5GZZB 2FWEA 5HFKA 5GSSA 4GSSA 4JR4A 2XBQA 2H75A 1EGRA 3VWXA 5GSTA 3IK9A 2QC7A 4EUYA 4JZQA 3KM6A 2YP6A 2PWJA 3CXGA 5IMAA 4POKA 1R26A 2YWMA 4ZBAA 3QD9A 3GSSA 2WB9A 2C3TA 2WULA 3F4TA 1K0OA 4RI7A 4KNDA 4F9ZA 2DBCA 2AYTA 3HJMA 4FYUA 3CSHA 3IXRA 2L59A 1PRXA 1OYJA 3KIJA 2XPDA 3F8UA 4MJAA 4O32A 1H4OA 1AQXA 3J7Yk 1BJXA 2V41A 5ECLB 5LNKe 3J7Yb 1X0RA 2IIYA 3B08B 1GTBA 5ECQB 3NOFA 1PD21 1XCCA 4MZBA 4LMWA 4ULXA 5AISA 5EVOA 2H1BA 3D22A 1O8WA 2GSSA 1X9MB 2VL2A 3VFIA 4IJ3A 3ZYWA 2CAIA 2QGVA 3KEBA 10GSA 6GSUA 1TI3A 3DD3A 1TJDA 1SL0B 3KP8A 5COHA 5HR1A 3GHAA 4FH8A 4KSMA 3DGQA 2FHEA 1HNBA 1XWBA 3KH7A 2B3SA 2F9SA 4LA1A 2FA8A 1GL8A 3LXTA 4KUNA 4TW5A 4D73A 5JCWA 5ID2B 2ON7A 4X43A 5F07A 1OC3A 6GSSA 1G6WA 1HNAA 3TOUA 4PQIA 4BPYA 4OO5A 1K0NA 3MNGA 2C0EA 2H6ZA 1AW9A 1M2DA 4OD7A 3F9UA 1GUKA 19GSA 3FW2A 3CSIA 1EV4A 1J08A 2WCIA 4K2DA 1ZMAA 2ALBA 5CRGA 5HR0A 4NPBA 1HQOA 5HQPA 2J9HA 12GSA 2G0FA 2LRCA 4PQHA 2DJ0A 3WD6A 1TDIA 5IM9A 4KGIA 5G31A 2JSZA 4PNGA 4OFNA 4GCIA 1GSSA 3P90A 3KZQA 1AIUA 5IOXA 2YANA 1OC9B 2GQLA 2EC4A 3UAPA 1E6BA 2QKEA 4YAVA 1PGTA 4WEYA 2H70A 3ZTLA 2CVKA 3NZNA 4V1Ap 1ZGNA 4CDOA 3GL3A 5D96A 2LSTA 2DJ1A 3GX0A 5EPFA 4IP1A 1SL1B 4GTUA 1OC8A 2FGXA 3WGXA 3I43A 3GL5A 2C3NA 4I2TA 5JWRB 2XHFA 2C6AA 3L0HA 4L8EA 3PR8A 4IGJA 2VM1A 1TOFA 4MLYA 3BCIA 2L6CA 3WGEA 2FNOA 2DJKA 3ZVJA 1O73A 3EMXA 2IPAA 3H4KA 1GWCA 2VOCA 3UBKA 1OKTA 4AJ6A 4WF5A 1F3BA 1T7PB 5HFIA 1AXDA 1OE8A 4MCUA 2HZFA 3PGTA 4WR4A 5A5KA 1XIYA 3F63A 2LEGA 2GSRA 2ZUPA 4LL4B 1JZDA 1SENA 3KJYA 1DBYA 1A8LA 2VL3A 3GRXA 2HXKA 3CRTA 2IJYA 2OJLA 4I8BA 4Z7XA 4V2MA 1V2AA 2JL4A 1MEKA 4DSQA 2EIQA 3W8JA 1UVZA 2PBJA 3L4NA 4MJCA 4G10A 4OO4A 3Q6OA 2B5EA 2HSHA 2MMZA 3VURA 2H73A 3CBUA 2WRTA 4FYCA 4EDYA 2JZTA 4XS1A 2IFQA 2L5LA 2D2ZA 1OVNA 4K7NA 2O89A 3LORA 2KP1A 6GSTA 1A24A 1K0MA 4DVCA 4YQVA 2J23A 3DMLA 2MBSA 3UVTA 2E2GA 2C0GA 2PU9C 3A5WA 11GSA 1SKRB 4ZL9A 3ZRDA 3EU4A 3TJGA 3GX8A 9GSSA 4WETA 1SK0A 1ILOA 2H0GA 4IJIA 4KSOA 5B8AA 2V6OA 4IW9A 3C1RA 4PNFA 3VI7A 4V2LA 1ZZYA 3N5OA 4POBA 3MWHA 3APSA 1MDJA 2H01A 5DVBA 4IS0A 4MPGA 2RUEA 3H93A 1M0UA 1F37A 3R2QA 2TIRA 2A2SA 4TR4A 3E0UA 3F6DA 4MMMA 4DEJA 4XS4A 1CQGA 2N5BA 1VRSD 1YKAA 3GV1A 1KEBA 5HR2A 3F6FA 4ISDA 4PUAA 4RQXA 2C4JA 1THOA 1LBKA 4LMVA 2LQOA 2H6XA 3M9KA 5DBQA 3FEUA 2GZZA 5H5QA 6GSWA 1A23A 2AAWA 3EVIA 5G5EA 5F8BA 1T3BA 1XWAA 1TP9A 5J9BA 1VF1A 3ERWA 3KGKA 4TR1B 3KCMA 4TOPA 1IYIA 4POMA 5FWGA 2XPEA 2YJ7A 2LNSA 2P0GA 1EV9A 3EURA 1T8EB 5H5SA 2A4VA 4ACSA 1X9WB 4RQRA 4IN0A 5AIVA 3ZMLA 1ERVA 1SD9A 5DJLA 5KEJA 2H1DA 1TK8B 4V2NA 3M3MA 2PN8A 4ZILA 2K9FA 3KTBA 1XW5A 4OCFA 2X99A 5ECKB 5AN1A 1PN9A 1F3AA 2YNXA 3KMOA 4LLRA 1AC1A 1XW6A 4HEA2 2OBKA 1QFNA 4FYBA 1JZRA 4F2IA 4YQUA 4PX1A 1PKZA 5J5NA 1A2JA 1XVWA 2B5XA 5IMZA 1V40A 1YKCA 2I81A 3QFBC 2VCWA 5ECRB 3GTUB 2GSQA 2JZSA 4ZL8A 1R7HA 2OE3A 3LFLA 3ERGA 2DJ3A 1XOAA 1THXA 2L6DA 3E9JB 3EINA 3TRXA 1WMJA 2LKUA 5KN1A 3LG6A 3PINA 2IMFA 1URMA 3BOAA 1O6JA 3LJRA 4MA9A 5JWOB 1BQ7A 1F6MC 2AV4A 3OR5A 5G30A 4ML1A 2E7PA 1Z7RA 3DYRA 3H8QA 1ACVA 1YEXA 2H76A 2H30A 3ZFLA 1GNWA 1KNGA 1JLWA 2DMLA 2NVLA 5G2ZA
chains in the Genus database with same CATH superfamily
2ON5A 2YN1A 3IU3I 1R0IA 1WJKA 3ZIVA 1BG5A 1B4PA 4MH2A 1A0FA 4XTSA 5ENUA 4MH3A 4JBBA 1XOBA 3HVXA 4PQ1A 2E2HL 1IW7D 5GAEc 2H0IA 3QAWA 3HOXL 2QA1A 3ZZXA 3IAM2 2HZEA 2KP2A 1SKSB 3VPTA 2IMEA 2ES7A 1VCXA 2LTKA 4A3DL 4ZXGA 3WWLA 4HJMA 3RPPA 1GSQA 2HFDA 5HR3A 2JZRA 4MZCA 1B9YC 3TKSE 1B71A 2FWGA 3Q74A 1H7VA 2M80A 4WBJA 2RM6A 4KH7A 1OWCA 3HAXC 5DQSA 2X8HA 3TUEA 2CVBA 4IKHA 2I4AA 1T4YA 5IO0A 1GLPA 4ECCA 3KMNA 5C00A 1SJIA 1OAZA 1V98A 5J4UA 4AYBP 1W89A 3KYXA 4NAXA 3GTOL 3PH9A 1GUHA 4BL7A 3TKPA 2M72A 3HA9A 1BQ9A 1PL1A 3DWVA 3GH9A 4NHWA 2LJRA 3GSTA 1I9DA 1TRWA 4MF6A 2GVPA 4DSSA 1A0RP 5MFZA 1A2MA 1HYUA 4GS7D 4IHUA 2E0QA 5DAKA 3HZ4A 1G7EA 4XHMA 3A44A 3HOVL 4N0VA 2WS2A 2A6HD 1PN0A 1RDVA 4BVYB 2VL9A 3FK8A 1ODHA 1ERTA 2OADA 1Y1VL 1WIKA 2L5OA 3S1QL 1YF0A 2R93L 4PUFC 5C3EL 4AF2A 1NHOA 5EY6A 3N9JA 1SU9A 4AR6A 4WXTA 1TU7A 4MDCA 2HNLA 1DE2A 4ICYA 4QIWP 1GNEA 1IRNA 5AI3A 1KBNA 1CQHA 2DJJA 3IV4A 3AY8A 1JZWA 2KHPA 4K7IA 4KDUA 4O5QA 1EOHA 4AJ7A 2YJHA 2R7ZL 3RHBA 3TKSC 2VD1A 3HDCA 2AUSB 3W8SA 3GTQL 1BAYA 1PX7A 5CP1A 3A3TA 1ERUA 13GSA 1IYHA 5D8IA 4F0BA 2LV3A 3F0IA 2CVDA 3TDGA 2JU5A 2AUVA 2EY4E 1Y1WL 3ZLPA 2GZYA 4NMUA 4N10A 1XBSA 4HOJA 6GSVA 4KA0A 1Z5YE 5IOWA 1AQWA 1TWAL 2EIRA 3GKMA 3HD5A 3PO2L 3TJBA 3BCKA 5DALB 3M0FA 4BWQA 2RLIA 3GFKA 1Y6EA 2LJAA 3L9VA 4P3YB 3UIWA 1G0TA 5JCGA 4TKYA 1U88A 1ML6A 2X64A 1GH2A 4ILFA 2K18A 2LQQA 1S24A 4TXOB 4J56E 1TI1A 4N0ZA 2FD3A 2DIYA 4J57E 3ZREA 4MJBA 1PMTA 2K6VA 1YQ1A 1I6HL 1M2AA 4MJEA 2X8CA 4ZB9A 2YZUA 5GAGc 1TU8A 2LRNA 3L78A 1GSEA 3ME7A 1M2BA 3EWLA 2DKHA 1B13A 1RWDA 5M3FL 1K0CA 4TN8A 1QGVA 3LWPB 3VWUA 5AGYA 2HSMA 2R0CA 1YEPA 1DVBA 1ZCPA 1T4ZA 1V9WA 3R3EA 3TKQA 4I5QA 3LWQB 1FVJA 1TXXA 3UBLA 1PZXA 2BTOT 2H66A 1CAAA 2VD0A 3MSZA 3ZVJD 4MABA 1EEJA 2Y0SP 1W4VA 20GSA 5ELGA 2V32A 2HT9A 2YV9A 3HOWL 3ISOA 4ZB6A 3H79A 4AI1A 4Q5FA 1ZL9A 1YDKA 4QL7A 2E2MA 5IO2A 1K0DA 5D9TA 5KOXA 1WOUA 2B5YA 3FR3A 4ZL7A 5ECHB 4ECIA 4IQ1A 3IHQA 3HVVA 4JADA 3CTFA 4ID0A 4POGA 2N5AA 1QK8A 2R92L 2HRNA 3MDKA 2VLTA 4KCEA 2PGTA 4Z2UA 3H3VM 2YU9L 3KH9A 1HD2A 2B6MA 2MBTA 2CQ9A 4HU9A 4I6XA 1YF1A 1BQ8A 3UARA 1VF3A 3GIXA 3RAZA 3A2VA 1GTIA 1R0GA 3KYUA 5IPGA 3DIEA 4AHXA 1GP1A 2AHEA 4I97A 4AR3A 3O6TA 4ZB8A 2AQCA 4I2UA 1U3IA 2O5JD 3TJFA 2MMAA 2EIOA 1PFVA 6GSXA 2HVYC 4EF0A 4PXOA 2OE1A 1B48A 2FLSA 4HQSA 1H75A 3M1GA 3GN3A 1WWJA 1EP7A 4Q5QA 4G2EA 5M5WL 2J9UB 1NXGA 2YV7A 1K3OA 2REMA 1BEDA 2P31A 1ZYQB 4Y7NL 2VUPA 1M9AA 4WF4A 1X5CA 2H1AA 2PUKC 4EC0A 2K8VA 4AGSA 3U6VA 1MDKA 1S3CA 2JA7L 3HKRA 3H0GL 1YZXA 4C3IL 3ZITA 1GTUA 2M4VA 4AHZA 3UL3A 1ZOFA 4AI0A 3QPMA 5EIOC 3EE2A 3GNJA 3C7MA 4GLTA 1GRXA 1WE0A 1NNQA 2R2JA 2HE3A 1PL2A 2L0ZA 3EMPA 3IA1A 1TKDB 3TRPA 5IYCL 4A3BL 4MF5A 2L4CA 4ZBDA 1MD3A 1R4WA 4JRRA 3FDJA 2DMMA 5ID2A 5IYDL 5A4WA 5G1KA 4J2FA 3TRQA 1SKWB 5CRHA 3HJOA 1SMWA 2VLVA 8GSSA 2VCZA 4G0KA 1GTAA 4O5UA 4YKGA 2Z3QB 3HY2A 1M9BA 4XXBB 2H8LA 3LGCA 3M8NA 3O76A 3FZ4A 1AUCA 1FO5A 2CV4A 4O92A 3KTLA 4EIQA 4BVXA 2OKAA 4HU7A 2LCQA 2ERJA 1XXUA 4LHLA 1PKWA 3FYGA 2O8VB 1QQTA 5DM71 3HVSA 1VZIA 4IELA 4WBRD 3V1WA 1XFLA 1ERWA 1R5AA 1IU5A 3QCPA 3KYVA 1I3QL 2XJUA 4NV5A 2BJXA 2B63L 2YCDA 3HZ8A 4KE3A 3LYKA 1I50L 1Z9HA 5EL8A 3C71A 1YK5A 1F9MA 2NDOA 1OE7A 1JZOA 3A2WA 4FO5A 4OCEA 4D73B 3UVHA 1R0HA 2F8AA 3DKSA 1TRSA 4K8MA 2CX4A 1XWKA 3IRAA 4EO3A 2R5GA 4K1FA 1JLVA 4JU5A 1OC9A 3DRNA 3LEFA 5KN0A 2QA2A 1FB0A 3HOYL 1SYXA 2FWHA 4K6XA 2V0EA 3WGDA 2A68D 5J9CA 3EPTA 2LRTA 1RYTA 1VF2A 1LU4A 3S1RL 5CAXA 3VWWA 2H72A 3M9JA 1FW1A 1K3YA 5CREA 3FRCA 3TB2A 3HXSA 5B6MA 2NTOA 2MMOA 3EU3A 4F82A 5CO3A 2MZCA 1BX9A 5B7CA 2OE0A 1GLQA 3QAVA 3FMWA 2A2PA 3KP9A 2G2QA 2X49A 1NM3A 3G7YA 1ZRPA 2JA8L 1FG4A 2XJTA 2CR8A 2KKDA 2YPMA 3G9BA 1OKDA 3ZL5A 3K7AL 3TOTA 4K9ZA 4YAPA 1TK5B 2PMZP 5KN2A 2GZPA 3C8EA 1M7TA 3RZ6A 4GXZA 2VUML 1ST9A 1B2OA 2C6BA 2M6OA 3IBHA 4MK3A 5GAPD 4L0UA 3G7IA 4HI7A 3FR6A 2E2JL 2L57A 3DVXA 4GSTA 1T9QA 4L5LA 3LWRB 1XPVA 3QFAC 4TR3A 5B6NA 5HFGA 4E8EA 1USBA 3HCZA 5M5XL 2JACA 3LPEB 1EP8A 2H19A 5A4UA 2VO4A 3VK9A 3IDVA 3TKSA 2GTUA 2XC2A 5E59A 3D4MA 2YWOA 7GSSA 1B2JA 1YK4A 1BRFA 2PPTA 4K0NA 2OA7A 2YZHA 3VLNA 5CNWA 3LSZA 1FOVA 2LJKA 1CADA 4CW9A 3GKNA 1N2AA 5K2ME 1RYQA 1ABAA 2ZNMA 3US3A 4TRXA 2BMXA 5IMDA 1FAAA 2O7KA 1WP0A 1OWBA 1RDGA 3S2HL 4ECBA 5C4JL 1Y25A 3A5IA 3P2AA 4PURA 2DSAA 4GSNA 3F3RA 4YWLA 4BA7A 3BBYA 1B8XA 4ML6A 3GTPL 17GSA 3EYTA 2R37A 5E4WA 3NIVA 1AAZA 3O3TA 5IIZA 1J0FA 1RK4A 3HHVA 5J3RA 3I69A 3P7XA 3IC4A 2AJQB 2CA8A 4G0IA 1SFOL 3LQ7A 1TK0B 2DSXA 4AR5A 2NPBA 4K9FA 3HOUL 3RBTA 5FHIA 4TVEA 2RUFA 3HYPA 3W6GA 5ECOB 3FHKA 2NVTL 3RHCA 5INYA 2IFQB 2WB1P 5LD0A 2WAQP 2VLUA 7RXNA 1GULA 2H1GA 14GSA 3QAGA 2VCQA 4KF9A 3C73A 3UOMA 2Z3RB 1TTZA 2P5RA 3HJPA 4EVMA 3TJKA 2MYGA 1XVQA 1WRYA 5C04A 3G7JA 4E6YA 4WKWA 3TCOA 2GMGA 1V57A 1TRUA 4Y52L 3JCML 4X1UA 3CRUA 2DJ2A 1NW2A 3PO3L 2JSYA 2NBSA 4F0CA 3ERFA 1Q98A 1C09A 3IAS2 3GH6A 3J7Z1 2F51A 3CQFA 4TR1A 4XIHA 2C3QA 5ECSA 3H9CA 4OFTA 1GSUA 2H74A 4JAGA 4JR6A 3BJ5A 4K7OA 5G1LA 2NVQL 2HYXA 1UA5A 3EC3A 3H1NA 3RZTA 3M3YL 2H71A 1QQ2A 1XZOA 1M99A 1ZYPA 4YQMA 1A2LA 1FB6A 1R5PA 3PWFA 3LWAA 3GURA 1DX8A 2QSIA 2FWFA 1X5DA 4XCSA 22GSA 4XS4B 4BWSA 4A3GL 2VAFA 4EXJA 4OWYA 1PFOA 5B8BA 3DVWA 3LYPA 1E8JA 3Q18A 2WGRA 5GAND 5DCGA 3ME8A 2IL3A 2BE5D 2O85A 4Q5RA 4GRFA 1GUMA 2F3MA 3DXBA 5IP7L 3NFPI 5CYYA 4JEDA 1K0AA 5ECPB 3BD2A 5JCUA 2PVOC 4RUVA 5L71A 1DE1A 5IPHA 1Z3EA 2DLXA 4IVFA 4BBRL 2HRFA 2Z9SA 1TW9A 2V6KA 5IMFA 4H86A 3QMXA 4FIWA 4JAFA 4CHSA 2OBIA 3ZFBA 2CZ3A 3IE3A 3GTUA 2PERA 1QMVA 3QOUA 5C4XL 1X5EA 4V1Ag 2IMDA 3WT2A 1TRVA 2B7JA 4QL9A 2TRXA 1G7OA 5FT3A 1MD4A 2HI7A 2H0HA 3PKJA 4TVMA 4TPUA 2HLSA 3APQA 2JI2A 1FHEA 4HZ2A 3H97A 3S1NL 3FZAA 4ZBBA 1Q4JA 4IQAA 1X9SB 4A3JL 1V58A 5J41A 1UN2A 5H5RA 4EIPA 3WYWA 4WFN1 3ZMKA 5KN3A 1WCML 1SJZA 2VCXA 4GWRA 3L9UA 5ABRA 2JA5L 3RDWA 2E2IL 3UMAA 2JA6L 3FZ9A 5F06A 4HUAA 2LNTA 1O8XA 3RZOL 1WPIA 3GUSA 1AQVA 1EWXA 4PGTA 1XG8A 2XBIA 4XS6A 1NHYA 4ME3A 1IROA 1PA3A 2MMNA 3GTML 3I4ML 2YWIA 3LWOB 2JADA 3QQCE 3D5JA 1PFUA 2FCHA 3IK7A 1QUWA 1S3AA 1XW9A 1Z6MA 2B7KA 2VIMA 1B9XC 1ON4A 3E3EA 5DM61 1ZYNA 3GKKA 4Q5NA 2GGTA 4OMVA 2WZ9A 1FVKA 5ELAA 2R6KA 2WFCA 2A2RA 4E8HA 3Q19A 4K0GA 4L5OA 2GT5A 1GSYA 2GQKA 4EL1A 1EZKA 2M46A 16GSA 4EE0A 4POLA 4A3ML 2KUCA 2VL2C 3FKFA 3VI5A 3F3QA 4IBPA 4KDYA 1S3DA 2ZCTA 1U6TA 4GF0A 3D6IA 1U3AA 1M3IA 2TRCP 4A5PA 5DQYA 2RFKB 4Z2TA 4K5SA 5CRDA 5H1Sc 3IPZA 1XWGA 2N5FA 3GMFA 1M3JA 1U87A 2LUSA 3GYKA 3L9SA 5DDLA 5ECMB 4N11A 1EOGA 4HS1A 4YWMA 4C2M1 4KX4A 1K0BA 3GKXA 1UC7A 2R4VA 4OFMA 4G19A 4HQZA 2C0DA 2GLRA 2CAQA 2I3YA 2V2GA 3VWVA 1SK2A 1JYBA 2WJUA 2I1UA 3D4TA 3TJJA 5D9VA 2HZEB 1N8JA 5ECIB 8RXNA 1ZYEA 2GQMA 4X0XA 4A3CL 4O7HA 1YUZA 3TKRA 3IOSA 3SBCA 4A3KL 5KOWA 1PQNA 1O85A 2R3XA 1MTCA 3QVDA 5BMUA 4HJ2A 5DJMA 4AHWA 1LKMA 2IN3A 2C0FA 4F03A 3U5RE 1DUGA 4RXNA 3QDNA 4BVYA 2C8UA 4XRDA 3APOA 2IWTA 3SWLA 1PX6A 4YH2A 2GT6A 4AJ8A 2CZ2A 1SK1A 4L0WA 3FR9A 1QCVA 4G0LA 4BBSL 4NHZA 1E2YA 5MGNA 4A3IL 2X8GA 3FY7A 2K8SA 2CT6A 4BL7B 4EDZA 1XWCA 1HNCA 5D9WA 3A2XA 4C3HL 2IMIA 1Z7PA 3CYNA 3SS2A 1NSWA 4JE1A 5MF6A 4DSSB 1MDIA 4MP4A 1F4LA 3LXZA 1SL2B 3MAKA 2RIIA 4NV2A 2V1MA 2YWNA 4KAEA 1Z6NA 1SMUA 3WWNB 1JFUA 3K8NA 2RM5A 5DAKB 5D9XA 5CRWA 2B5ID 5AIXA 3PKIA 4XRAA 4FQUA 1SYRA 2V3BB 2DC5A 5IP9L 2HSYA 1DSBA 3QR6A 4KB3A 2C80A 2PMTA 3DEXA 2OACA 1VZHA 1EGOA 1T00A 5LCZA 5DALA 4A93L 2B1KA 5DCHA 4WR5A 4KW6A 3CSJA 5IQYA 1C72A 3I6AA 3IR4A 4EKZA 1O7UA 1I5GA 2X4AA 1RQMA 4RI6A 2KN9A 4TXOA 4MZWA 2KLXA 2O87A 1R9TL 5AN9H 1EEMA 1J9BA 4LL1B 1B4QA 3S9FA 1T9OA 3D21A 4XGHA 2CX3A 2LS5A 1LJRA 18GSA 3P8WA 2GS3A 4KCAA 2H6YA 2GSTA 4QQ7A 1QXHA 4NWYA 4MF7A 4ZIJA 5IMVA 4G9HA 5ECNB 1VGLA 2FUG2 3ED3A 4N30A 2NVXL 2FY6A 5D93A 2R0PA 2DIZA 2ERSA 3UJ1A 4UY81 4KDXA 1F2EA 3TGZA 3UEMA 1T1VA 4NXIA 1PSQA 2A6ED 2YOIA 1KTEA 3VPQA 1K3LA 2AB6A 1GSFA 3GA4A 3B0AB 3F4RA 4GQCA 1RW1A 2VCTA 1YY7A 1JHBA 1YJ6A 2I9HA 2ZIXA 5F05A 5D73A 2VM2A 3I9V2 4BY1L 1G6YA 1BE7A 3S14L 2PVQA 3FKIL 3D0ZA 3F4SA 3KD0A 4O5RA 3FZ5A 1LTLA 1BYEA 3C1SA 2M4YA 2L4QA 4ZN1B 2B1LA 3KXOA 1O81A 3ZIJA 3CQZL 1GSDA 2XJSA 2F8FA 2GDRA 2WDUA 4TXVA 4HZ4A 6GSYA 1FOHA 4MPFA 2KOKA 1A8YA 3GTKL 5A4VA 4IP6A 2P5QA 3CTGA 2C1YA 3I4NL 5IMCA 2VCVA 4DSRA 5G5FA 4GQFA 2XJRA 1BFYA 3RYGA 4HDEA 3CMIA 4ECJA 1SD8A 5F0GA 3WT1A 4TR0A 3J7Y1 1VF4A 2IMKA 2V0FA 3MPSA 5JWQB 1SJ6A 3RPNA 2FA4A 1SMMA 5GZZB 2FWEA 2XJVA 5HFKA 3GTJL 5GSSA 4PTSA 4GSSA 4JR4A 4CY8A 4A3EL 2XBQA 2H75A 1EGRA 3VWXA 5GSTA 3IK9A 2QC7A 4EUYA 4JZQA 3KM6A 2YP6A 2PWJA 3CXGA 5IMAA 4V196 4POKA 1R26A 2YWMA 4ZBAA 3QD9A 4G6BA 3GSSA 2WB9A 4AI3A 5JVG1 2C3TA 5EINC 2WULA 3F4TA 1IU6A 1K0OA 4RI7A 4KNDA 5MFPA 4F9ZA 1S2ZA 1Z92B 2AYTA 2DBCA 1T9PA 3HJMA 4FYUA 4JAEA 3CSHA 3IXRA 2L59A 1PRXA 1OYJA 3KIJA 2XPDA 3F8UA 4MJAA 4O32A 1H4OA 1AQXA 3J7Yk 1BJXA 2MS3A 2V41A 5ECLB 5LNKe 3J7Yb 1X0RA 3PIP1 2RDVA 4U671 2IIYA 3B08B 3HJWB 1GTBA 5ECQB 4C3JL 3NOFA 1PD21 1XCCA 4MZBA 4LMWA 4ULXA 5AISA 3S17L 5EVOA 2H1BA 3S16L 3D22A 1O8WA 2GSSA 1X9MB 2VL2A 3VFIA 4IJ3A 3ZYWA 2CAIA 2QGVA 3KEBA 10GSA 6GSUA 3S1ML 1TI3A 3DD3A 3HVNA 4POFA 1TJDA 1SL0B 3KP8A 5COHA 5HR1A 3GHAA 4FH8A 4KSMA 3DGQA 2FHEA 1HNBA 5GAHc 1XWBA 3LW9A 3KH7A 1PFWA 2B3SA 2F9SA 4LA1A 2FA8A 1GL8A 2R0GA 3LXTA 4MNNA 4KUNA 4TW5A 3LWVB 4D73A 5JCWA 5ID2B 3PZAA 3P8BA 2ON7A 4X43A 5F07A 1OC3A 1R0FA 6GSSA 4X4JA 4YKFA 1G6WA 1HNAA 3TOUA 4PQIA 4BPYA 4OO5A 1K0NA 3MNGA 2HR5A 2C0EA 2H6ZA 3MSUA 1AW9A 1M2DA 4OD7A 3F9UA 2M6PA 1GUKA 4BVXB 19GSA 3FW2A 3CSIA 1EV4A 1J08A 2WCIA 4K2DA 1ZMAA 2ALBA 3IHGA 5CRGA 5HR0A 4NPBA 1VZGA 2K2DA 1HQOA 5HQPA 3MIXA 2J9HA 12GSA 2G0FA 2LRCA 4PQHA 2DJ0A 3WD6A 1TDIA 5IM9A 3RZDL 4KGIA 5G31A 4A3LL 2JSZA 4PNGA 3PL5A 1RB9A 4OFNA 4GCIA 1GSSA 2DKIA 3P90A 3KZQA 1AIUA 5IOXA 2YANA 1OC9B 2GQLA 2EC4A 3UAPA 3HJYB 1E6BA 4A3FL 2QKEA 4YAVA 1PGTA 4WEYA 2H70A 1WJVA 1FHMA 3ZTLA 2CVKA 3NZNA 4V1Ap 1ZGNA 4CDOA 3GL3A 3H99A 5D96A 2LSTA 2DJ1A 3GX0A 2CKAA 5EPFA 4IP1A 3KYYA 2NVYL 1SL1B 4GTUA 1OC8A 2FGXA 3WGXA 4CY6A 2QL0A 1TWCL 3GL5A 3I43A 2C3NA 4I2TA 5JWRB 2XHFA 2A4HA 2C6AA 3L0HA 4L8EA 3PR8A 4IGJA 2VM1A 5AI2A 1TOFA 4K2XA 4MLYA 3BCIA 2L6CA 5M5YL 3WGEA 2FNOA 2DJKA 3ZVJA 1O73A 3EMXA 2IPAA 5C44L 3H4KA 1GWCA 2VOCA 3UBKA 1OKTA 4AJ6A 4WF5A 1F3BA 1T7PB 5HFIA 1AXDA 1OE8A 4MCUA 4ZN3B 2HZFA 3PGTA 4WR4A 1XIYA 5A5KA 3PIO1 3F63A 2LEGA 2GSRA 2ZUPA 4LL4B 1JZDA 2UZ8A 1SENA 3KJYA 3K35A 1DBYA 1S3RA 1A8LA 2VL3A 3GRXA 1NXEA 2HXKA 3CRTA 2IJYA 2OJLA 4I8BA 4Z7XA 4V2MA 1V2AA 4X6AL 2JL4A 1MEKA 4DSQA 2EIQA 3W8JA 1UVZA 2PBJA 3L4NA 3MYDA 4MJCA 4G10A 4OO4A 3GTGL 3Q6OA 2B5EA 2HSHA 2MMZA 3VURA 2H73A 4AHYA 3CBUA 2WRTA 4FYCA 2APOB 2XJQA 3S2DL 3H9BA 3KYWA 4EDYA 2JZTA 4XS1A 2IFQA 2L5LA 2D2ZA 1OVNA 4K7NA 2O89A 4B8CD 3LORA 2KP1A 4BXXL 6GSTA 1A24A 1K0MA 4DVCA 4YQVA 2HRAA 2J23A 3S15L 3DMLA 5FLML 2CKCA 1QYBA 2MBSA 3UVTA 2E2GA 2C0GA 2PU9C 3A5WA 11GSA 1SKRB 5JVH1 2PYAA 1LKOA 4ZL9A 3ZRDA 3EU4A 3TJGA 3GX8A 9GSSA 4WETA 1SK0A 1ILOA 2PSMC 2H0GA 4IJIA 4KSOA 5B8AA 2V6OA 2XJPA 4IW9A 2JI1A 3C1RA 4PNFA 3VI7A 4V2LA 1R0JA 4AR4A 1ZZYA 3N5OA 4BY7L 4POBA 3MWHA 3APSA 1MDJA 2H01A 5DVBA 3MQKB 4IS0A 4MPGA 2RUEA 5BRTA 3H93A 1M0UA 1F37A 3R2QA 2TIRA 2A2SA 4TR4A 3E0UA 1TWGL 3F6DA 4MMMA 4DEJA 4XS4A 1CQGA 2N5BA 1VRSD 1TWFL 1YKAA 3GV1A 1KEBA 4Z2RA 5HR2A 3F6FA 4ISDA 4PUAA 1K83L 4RQXA 2C4JA 1THOA 1LBKA 4LMVA 2LQOA 2H6XA 3M9KA 5DBQA 1TWHL 3FEUA 2GZZA 5H5QA 6GSWA 1A23A 2AAWA 3EVIA 5G5EA 5F8BA 1T3BA 1PFYA 1P7PA 2AYJA 1YV1A 1XWAA 1TP9A 5J9BA 1VF1A 3ERWA 3KGKA 4TR1B 6RXNA 3KCMA 2PVEA 4TOPA 1IYIA 4POMA 5FWGA 2XPEA 4AI2A 2YJ7A 2LNSA 2P0GA 2A69D 1EV9A 3EURA 1T8EB 5H5SA 5FJ8L 2A4VA 4ACSA 1X9WB 4RQRA 4IN0A 2H12A 5AIVA 3HKZP 3ZMLA 4HSCX 1ERVA 4LHNA 1SD9A 5DJLA 5KEJA 2H1DA 1TK8B 5IYBL 4V2NA 3M3MA 2PN8A 4ZILA 2K9FA 3KTBA 5IY0A 1XW5A 4OCFA 2X99A 5RXNA 5ECKB 5AN1A 1PN9A 1F3AA 2YNXA 3KMOA 4LLRA 1AC1A 3JR7A 5GADc 1XW6A 4HEA2 4K5RA 1YUXA 2OBKA 2JI3A 1QFNA 4FYBA 1JZRA 2VL6A 4F2IA 3GTLL 4YQUA 1S30A 4PX1A 1PKZA 5J5NA 1A2JA 1XVWA 2B5XA 5IMZA 1V40A 1YKCA 3LNLA 5MLC3 2I81A 3QFBC 2VCWA 3M4OL 5ECRB 5M3ML 3GTUB 2GSQA 2JZSA 4ZL8A 3ZG6A 1R7HA 2OE3A 3LFLA 3ERGA 4USSA 2DJ3A 1XOAA 1THXA 2L6DA 3E9JB 3EINA 3TRXA 1WMJA 2LKUA 5KN1A 3LG6A 1FHHA 3PINA 2HRKA 2IMFA 1URMA 3BOAA 1O6JA 3LJRA 4MA9A 1LKPA 5JWOB 1BQ7A 1F6MC 3IC8A 2AV4A 3OR5A 5G30A 4ML1A 2E7PA 2NYDA 1Z7RA 4BIKA 3DYRA 3H8QA 1ACVA 1YEXA 3VPBE 2H76A 2H30A 3ZFLA 2PVXA 1GNWA 3HOZL 1KNGA 1JLWA 2DMLA 3PPUA 2NVLA 5G2ZA
chains in the Genus database with same CATH topology
2ON5A 2YN1A 3IU3I 1R0IA 1WJKA 3ZIVA 1BG5A 1B4PA 4MH2A 1A0FA 4XTSA 5ENUA 4MH3A 4JBBA 1XOBA 3HVXA 4PQ1A 1IW7D 5GAEc 2H0IA 3QAWA 2QA1A 3ZZXA 3IAM2 2HZEA 2KP2A 1SKSB 3VPTA 2IMEA 2ES7A 1VCXA 2LTKA 4ZXGA 3WWLA 4HJMA 3RPPA 1GSQA 2HFDA 5HR3A 2JZRA 4MZCA 1B9YC 3TKSE 1B71A 2FWGA 3Q74A 1H7VA 2M80A 4WBJA 2RM6A 4KH7A 1OWCA 5DQSA 2X8HA 3TUEA 2CVBA 4IKHA 2I4AA 1T4YA 5IO0A 1GLPA 4ECCA 3KMNA 5C00A 1SJIA 1OAZA 1V98A 5J4UA 4NAXA 1W89A 3KYXA 3PH9A 1GUHA 4BL7A 3TKPA 2M72A 3HA9A 1BQ9A 1PL1A 3DWVA 3GH9A 4NHWA 2LJRA 3GSTA 1I9DA 1TRWA 4MF6A 2GVPA 4DSSA 1A0RP 5MFZA 1A2MA 1HYUA 4GS7D 4IHUA 2E0QA 5DAKA 3HZ4A 1G7EA 4XHMA 3A44A 4N0VA 2WS2A 2A6HD 1PN0A 1RDVA 4BVYB 2VL9A 3FK8A 1ODHA 1ERTA 2OADA 1WIKA 2L5OA 1YF0A 4PUFC 4AF2A 1NHOA 5EY6A 3N9JA 1SU9A 4AR6A 4WXTA 1TU7A 4MDCA 2HNLA 1DE2A 4ICYA 1GNEA 1IRNA 5AI3A 1KBNA 1CQHA 2DJJA 3IV4A 3AY8A 1JZWA 2KHPA 4K7IA 4KDUA 4O5QA 1EOHA 4AJ7A 2YJHA 3RHBA 3TKSC 2VD1A 3HDCA 3W8SA 1BAYA 1PX7A 5CP1A 3A3TA 1ERUA 13GSA 1IYHA 5D8IA 4F0BA 2LV3A 3F0IA 2CVDA 3TDGA 2JU5A 2AUVA 3ZLPA 2GZYA 4NMUA 4N10A 1XBSA 4HOJA 6GSVA 4KA0A 1Z5YE 5IOWA 1AQWA 2EIRA 3GKMA 3HD5A 3TJBA 3BCKA 5DALB 3M0FA 4BWQA 2RLIA 3GFKA 1Y6EA 2LJAA 3L9VA 4P3YB 3UIWA 1G0TA 5JCGA 4TKYA 1U88A 1ML6A 2X64A 1GH2A 4ILFA 2K18A 2LQQA 1S24A 4TXOB 4J56E 1TI1A 4N0ZA 2FD3A 2DIYA 4J57E 3ZREA 4MJBA 1PMTA 2K6VA 1YQ1A 1M2AA 4MJEA 2X8CA 4ZB9A 2YZUA 5GAGc 1TU8A 2LRNA 3L78A 1GSEA 3ME7A 1M2BA 3EWLA 2DKHA 1B13A 1RWDA 1K0CA 4TN8A 1QGVA 3VWUA 5AGYA 2HSMA 2R0CA 1YEPA 1DVBA 1ZCPA 1T4ZA 1V9WA 3R3EA 3TKQA 4I5QA 1FVJA 1TXXA 3UBLA 2BTOT 2H66A 1CAAA 2VD0A 3MSZA 3ZVJD 4MABA 1EEJA 1W4VA 20GSA 5ELGA 2V32A 2HT9A 2YV9A 3ISOA 4ZB6A 3H79A 4AI1A 4Q5FA 1ZL9A 1YDKA 4QL7A 2E2MA 5IO2A 1K0DA 5D9TA 5KOXA 1WOUA 2B5YA 3FR3A 4ZL7A 5ECHB 4ECIA 4IQ1A 3IHQA 3HVVA 4JADA 3CTFA 4ID0A 4POGA 2N5AA 1QK8A 2HRNA 3MDKA 2VLTA 4KCEA 2PGTA 4Z2UA 3KH9A 1HD2A 2B6MA 2MBTA 2CQ9A 4HU9A 4I6XA 1YF1A 1BQ8A 3UARA 1VF3A 3GIXA 3RAZA 3A2VA 1GTIA 1R0GA 3KYUA 5IPGA 3DIEA 4AHXA 1GP1A 2AHEA 4I97A 4AR3A 3O6TA 4ZB8A 4I2UA 1U3IA 2O5JD 3TJFA 2MMAA 2EIOA 6GSXA 4EF0A 4PXOA 2OE1A 1B48A 2FLSA 4HQSA 1H75A 3M1GA 3GN3A 1WWJA 1EP7A 4Q5QA 4G2EA 2J9UB 1NXGA 2YV7A 1K3OA 2REMA 1BEDA 2P31A 1ZYQB 2VUPA 1M9AA 4WF4A 1X5CA 2H1AA 2PUKC 4EC0A 2K8VA 4AGSA 3U6VA 1MDKA 1S3CA 3HKRA 1YZXA 3ZITA 1GTUA 2M4VA 4AHZA 3UL3A 1ZOFA 4AI0A 3QPMA 5EIOC 3EE2A 3GNJA 3C7MA 4GLTA 1GRXA 1WE0A 1NNQA 2R2JA 2HE3A 1PL2A 2L0ZA 3EMPA 3IA1A 1TKDB 3TRPA 4MF5A 2L4CA 4ZBDA 1MD3A 1R4WA 4JRRA 2DMMA 5ID2A 5A4WA 5G1KA 4J2FA 3TRQA 1SKWB 5CRHA 3HJOA 1SMWA 2VLVA 8GSSA 2VCZA 4G0KA 1GTAA 4O5UA 4YKGA 2Z3QB 3HY2A 1M9BA 4XXBB 2H8LA 3LGCA 3O76A 3M8NA 3FZ4A 1AUCA 1FO5A 2CV4A 4O92A 3KTLA 4EIQA 4BVXA 2OKAA 4HU7A 2LCQA 2ERJA 1XXUA 4LHLA 1PKWA 3FYGA 2O8VB 5DM71 3HVSA 1VZIA 4IELA 4WBRD 3V1WA 1XFLA 1ERWA 1R5AA 1IU5A 3QCPA 3KYVA 2XJUA 4NV5A 2BJXA 2YCDA 3HZ8A 4KE3A 3LYKA 1Z9HA 5EL8A 3C71A 1YK5A 1F9MA 2NDOA 1OE7A 1JZOA 3A2WA 4FO5A 4OCEA 4D73B 3UVHA 1R0HA 2F8AA 3DKSA 1TRSA 4K8MA 2CX4A 1XWKA 3IRAA 4EO3A 2R5GA 4K1FA 1JLVA 4JU5A 1OC9A 3DRNA 3LEFA 5KN0A 2QA2A 1FB0A 1SYXA 2FWHA 4K6XA 2V0EA 3WGDA 2A68D 5J9CA 3EPTA 2LRTA 1RYTA 1VF2A 1LU4A 5CAXA 3VWWA 2H72A 3M9JA 1FW1A 1K3YA 5CREA 3FRCA 3TB2A 3HXSA 5B6MA 2NTOA 2MMOA 3EU3A 4F82A 5CO3A 2MZCA 1BX9A 5B7CA 2OE0A 1GLQA 3QAVA 3FMWA 2A2PA 3KP9A 2G2QA 2X49A 1NM3A 3G7YA 1ZRPA 1FG4A 2XJTA 2CR8A 2KKDA 2YPMA 3G9BA 1OKDA 3ZL5A 3TOTA 4K9ZA 4YAPA 1TK5B 5KN2A 2GZPA 3C8EA 1M7TA 3RZ6A 4GXZA 1ST9A 1B2OA 2C6BA 2M6OA 3IBHA 4MK3A 5GAPD 4L0UA 3G7IA 4HI7A 3FR6A 2L57A 3DVXA 4GSTA 1T9QA 4L5LA 1XPVA 4TR3A 3QFAC 5B6NA 5HFGA 4E8EA 1USBA 3HCZA 2JACA 3LPEB 1EP8A 2H19A 5A4UA 2VO4A 3VK9A 3IDVA 3TKSA 2GTUA 2XC2A 5E59A 3D4MA 2YWOA 7GSSA 1B2JA 1YK4A 1BRFA 2PPTA 4K0NA 2OA7A 2YZHA 3VLNA 5CNWA 3LSZA 1FOVA 2LJKA 1CADA 4CW9A 3GKNA 1N2AA 5K2ME 1RYQA 1ABAA 2ZNMA 3US3A 4TRXA 2BMXA 5IMDA 1FAAA 2O7KA 1WP0A 1OWBA 1RDGA 4ECBA 1Y25A 3A5IA 3P2AA 4PURA 2DSAA 4GSNA 3F3RA 4YWLA 4BA7A 3BBYA 1B8XA 4ML6A 17GSA 3EYTA 2R37A 5E4WA 3NIVA 1AAZA 3O3TA 5IIZA 1J0FA 1RK4A 3HHVA 5J3RA 3I69A 3P7XA 3IC4A 2AJQB 2CA8A 4G0IA 3LQ7A 1TK0B 2DSXA 4AR5A 2NPBA 4K9FA 3RBTA 5FHIA 4TVEA 2RUFA 3HYPA 3W6GA 5ECOB 3FHKA 3RHCA 5INYA 2IFQB 5LD0A 2VLUA 7RXNA 1GULA 2H1GA 14GSA 3QAGA 2VCQA 4KF9A 3C73A 3UOMA 2Z3RB 1TTZA 2P5RA 3HJPA 4EVMA 3TJKA 2MYGA 1XVQA 1WRYA 5C04A 3G7JA 4E6YA 4WKWA 3TCOA 2GMGA 1V57A 1TRUA 3JCML 4X1UA 3CRUA 2DJ2A 1NW2A 2JSYA 2NBSA 4F0CA 3ERFA 1Q98A 1C09A 3IAS2 3J7Z1 2F51A 3GH6A 4XIHA 4TR1A 2C3QA 5ECSA 4OFTA 1GSUA 2H74A 4JAGA 4JR6A 3BJ5A 4K7OA 5G1LA 2HYXA 1UA5A 3EC3A 3H1NA 3RZTA 2H71A 1QQ2A 1XZOA 1M99A 1ZYPA 4YQMA 1A2LA 1FB6A 1R5PA 3PWFA 3LWAA 3GURA 1DX8A 2QSIA 2FWFA 1X5DA 4XCSA 22GSA 4XS4B 4BWSA 2VAFA 4EXJA 4OWYA 5B8BA 3DVWA 3LYPA 1E8JA 3Q18A 2WGRA 5GAND 5DCGA 3ME8A 2IL3A 2BE5D 2O85A 4Q5RA 4GRFA 1GUMA 2F3MA 3DXBA 3NFPI 5CYYA 4JEDA 1K0AA 5ECPB 3BD2A 5JCUA 2PVOC 4RUVA 5L71A 1DE1A 5IPHA 1Z3EA 2DLXA 4IVFA 2HRFA 2Z9SA 1TW9A 2V6KA 5IMFA 4H86A 3QMXA 4FIWA 4JAFA 4CHSA 2OBIA 3ZFBA 2CZ3A 3IE3A 3GTUA 2PERA 1QMVA 3QOUA 1X5EA 4V1Ag 2IMDA 3WT2A 1TRVA 2B7JA 4QL9A 2TRXA 1G7OA 5FT3A 1MD4A 2HI7A 2H0HA 3PKJA 4TVMA 4TPUA 2HLSA 3APQA 2JI2A 1FHEA 4HZ2A 3FZAA 4ZBBA 1Q4JA 4IQAA 1X9SB 1V58A 5J41A 1UN2A 5H5RA 4EIPA 3WYWA 4WFN1 3ZMKA 5KN3A 1SJZA 2VCXA 4GWRA 3L9UA 5ABRA 3RDWA 3UMAA 3FZ9A 5F06A 4HUAA 2LNTA 1O8XA 1WPIA 3GUSA 1AQVA 1EWXA 4PGTA 2XBIA 4XS6A 1NHYA 4ME3A 1IROA 1PA3A 2MMNA 2YWIA 2JADA 3QQCE 3D5JA 2FCHA 3IK7A 1QUWA 1S3AA 1XW9A 1Z6MA 2B7KA 2VIMA 1B9XC 1ON4A 3E3EA 5DM61 1ZYNA 3GKKA 4Q5NA 2GGTA 4OMVA 2WZ9A 1FVKA 5ELAA 2R6KA 2WFCA 2A2RA 4E8HA 3Q19A 4K0GA 4L5OA 2GT5A 1GSYA 2GQKA 4EL1A 1EZKA 2M46A 16GSA 4EE0A 4POLA 2KUCA 2VL2C 3FKFA 3VI5A 3F3QA 4IBPA 4KDYA 1S3DA 2ZCTA 1U6TA 4GF0A 3D6IA 1U3AA 2TRCP 4A5PA 5DQYA 4Z2TA 4K5SA 5CRDA 5H1Sc 3IPZA 1XWGA 2N5FA 3GMFA 1U87A 2LUSA 3GYKA 3L9SA 5DDLA 5ECMB 4N11A 1EOGA 4HS1A 4YWMA 4KX4A 1K0BA 3GKXA 1UC7A 2R4VA 4OFMA 4G19A 4HQZA 2C0DA 2GLRA 2CAQA 2I3YA 2V2GA 3VWVA 1SK2A 1JYBA 2WJUA 2I1UA 3D4TA 3TJJA 5D9VA 2HZEB 1N8JA 5ECIB 8RXNA 1ZYEA 2GQMA 4X0XA 4O7HA 1YUZA 3TKRA 3IOSA 3SBCA 5KOWA 1PQNA 1O85A 2R3XA 1MTCA 3QVDA 5BMUA 4HJ2A 5DJMA 4AHWA 1LKMA 2IN3A 2C0FA 4F03A 3U5RE 1DUGA 4RXNA 3QDNA 4BVYA 2C8UA 4XRDA 3APOA 2IWTA 3SWLA 1PX6A 4YH2A 2GT6A 4AJ8A 2CZ2A 1SK1A 4L0WA 3FR9A 1QCVA 4G0LA 4NHZA 1E2YA 5MGNA 2X8GA 3FY7A 2K8SA 2CT6A 4BL7B 4EDZA 1XWCA 1HNCA 5D9WA 3A2XA 2IMIA 1Z7PA 3CYNA 3SS2A 1NSWA 4JE1A 5MF6A 4DSSB 1MDIA 4MP4A 3LXZA 1SL2B 3MAKA 2RIIA 4NV2A 2V1MA 2YWNA 4KAEA 1Z6NA 1SMUA 3WWNB 1JFUA 3K8NA 2RM5A 5DAKB 5D9XA 5CRWA 2B5ID 5AIXA 3PKIA 4XRAA 4FQUA 1SYRA 2V3BB 2DC5A 2HSYA 1DSBA 3QR6A 4KB3A 2C80A 2PMTA 3DEXA 2OACA 1VZHA 1EGOA 1T00A 5LCZA 5DALA 2B1KA 5DCHA 4WR5A 4KW6A 3CSJA 5IQYA 1C72A 3I6AA 3IR4A 4EKZA 1O7UA 1I5GA 2X4AA 1RQMA 4RI6A 2KN9A 4TXOA 4MZWA 2KLXA 2O87A 5AN9H 1EEMA 1J9BA 4LL1B 1B4QA 3S9FA 1T9OA 3D21A 4XGHA 2CX3A 2LS5A 1LJRA 18GSA 3P8WA 2GS3A 4KCAA 2H6YA 2GSTA 4QQ7A 1QXHA 4NWYA 4MF7A 4ZIJA 5IMVA 4G9HA 5ECNB 1VGLA 2FUG2 3ED3A 4N30A 2FY6A 5D93A 2R0PA 2DIZA 2ERSA 3UJ1A 4UY81 4KDXA 1F2EA 3TGZA 3UEMA 1T1VA 4NXIA 1PSQA 2A6ED 2YOIA 1KTEA 3VPQA 1K3LA 2AB6A 1GSFA 3GA4A 3B0AB 3F4RA 4GQCA 1RW1A 2VCTA 1YY7A 1JHBA 1YJ6A 2I9HA 2ZIXA 5F05A 5D73A 2VM2A 3I9V2 1G6YA 1BE7A 2PVQA 3D0ZA 3F4SA 3KD0A 4O5RA 3FZ5A 1LTLA 1BYEA 3C1SA 2M4YA 2L4QA 4ZN1B 2B1LA 3KXOA 1O81A 3ZIJA 1GSDA 2XJSA 2F8FA 2GDRA 2WDUA 4TXVA 4HZ4A 6GSYA 1FOHA 4MPFA 2KOKA 1A8YA 5A4VA 4IP6A 2P5QA 3CTGA 2C1YA 5IMCA 2VCVA 4DSRA 5G5FA 4GQFA 2XJRA 1BFYA 3RYGA 4HDEA 3CMIA 4ECJA 1SD8A 5F0GA 3WT1A 4TR0A 3J7Y1 1VF4A 2IMKA 2V0FA 3MPSA 5JWQB 1SJ6A 3RPNA 2FA4A 1SMMA 5GZZB 2FWEA 2XJVA 5HFKA 5GSSA 4PTSA 4GSSA 4JR4A 4CY8A 2XBQA 2H75A 1EGRA 3VWXA 5GSTA 3IK9A 2QC7A 4EUYA 4JZQA 3KM6A 2YP6A 2PWJA 3CXGA 5IMAA 4V196 4POKA 1R26A 2YWMA 4ZBAA 3QD9A 4G6BA 3GSSA 2WB9A 4AI3A 5JVG1 2C3TA 5EINC 2WULA 3F4TA 1IU6A 1K0OA 4RI7A 4KNDA 5MFPA 4F9ZA 1S2ZA 1Z92B 2AYTA 2DBCA 1T9PA 3HJMA 4FYUA 4JAEA 3CSHA 3IXRA 2L59A 1PRXA 1OYJA 3KIJA 2XPDA 3F8UA 4MJAA 4O32A 1H4OA 1AQXA 3J7Yk 1BJXA 2MS3A 2V41A 5ECLB 5LNKe 3J7Yb 1X0RA 3PIP1 2RDVA 4U671 2IIYA 3B08B 1GTBA 5ECQB 3NOFA 1PD21 1XCCA 4MZBA 4LMWA 4ULXA 5AISA 5EVOA 2H1BA 3D22A 1O8WA 2GSSA 1X9MB 2VL2A 3VFIA 4IJ3A 3ZYWA 2CAIA 2QGVA 3KEBA 10GSA 6GSUA 1TI3A 3DD3A 4POFA 1TJDA 1SL0B 3KP8A 5COHA 5HR1A 3GHAA 4FH8A 4KSMA 3DGQA 2FHEA 1HNBA 5GAHc 1XWBA 3LW9A 3KH7A 2B3SA 2F9SA 4LA1A 2FA8A 1GL8A 2R0GA 3LXTA 4MNNA 4KUNA 4TW5A 4D73A 5JCWA 5ID2B 3PZAA 3P8BA 2ON7A 4X43A 5F07A 1OC3A 1R0FA 6GSSA 4X4JA 4YKFA 1G6WA 1HNAA 3TOUA 4PQIA 4BPYA 4OO5A 1K0NA 3MNGA 2HR5A 2C0EA 2H6ZA 3MSUA 1AW9A 1M2DA 4OD7A 3F9UA 2M6PA 1GUKA 4BVXB 19GSA 3FW2A 3CSIA 1EV4A 1J08A 2WCIA 4K2DA 1ZMAA 2ALBA 3IHGA 5CRGA 5HR0A 4NPBA 1VZGA 2K2DA 1HQOA 5HQPA 3MIXA 2J9HA 12GSA 2G0FA 2LRCA 4PQHA 2DJ0A 3WD6A 1TDIA 5IM9A 4KGIA 5G31A 2JSZA 4PNGA 1RB9A 4OFNA 4GCIA 1GSSA 2DKIA 3P90A 3KZQA 1AIUA 5IOXA 2YANA 1OC9B 2GQLA 2EC4A 3UAPA 1E6BA 2QKEA 4YAVA 1PGTA 4WEYA 2H70A 1WJVA 1FHMA 3ZTLA 2CVKA 3NZNA 4V1Ap 1ZGNA 4CDOA 3GL3A 5D96A 2LSTA 2DJ1A 3GX0A 2CKAA 5EPFA 4IP1A 3KYYA 1SL1B 4GTUA 1OC8A 2FGXA 3WGXA 4CY6A 2QL0A 3I43A 3GL5A 2C3NA 4I2TA 5JWRB 2XHFA 2A4HA 2C6AA 3L0HA 4L8EA 3PR8A 4IGJA 2VM1A 5AI2A 1TOFA 4K2XA 4MLYA 3BCIA 2L6CA 3WGEA 2FNOA 2DJKA 3ZVJA 1O73A 3EMXA 2IPAA 3H4KA 1GWCA 2VOCA 3UBKA 1OKTA 4AJ6A 4WF5A 1F3BA 1T7PB 5HFIA 1AXDA 1OE8A 4MCUA 4ZN3B 2HZFA 3PGTA 4WR4A 1XIYA 5A5KA 3PIO1 3F63A 2LEGA 2GSRA 2ZUPA 4LL4B 1JZDA 2UZ8A 1SENA 3KJYA 3K35A 1DBYA 1A8LA 2VL3A 3GRXA 1NXEA 2HXKA 3CRTA 2IJYA 2OJLA 4I8BA 4Z7XA 4V2MA 1V2AA 2JL4A 1MEKA 4DSQA 2EIQA 3W8JA 1UVZA 2PBJA 3L4NA 3MYDA 4MJCA 4G10A 4OO4A 3Q6OA 2B5EA 2HSHA 2MMZA 3VURA 2H73A 4AHYA 3CBUA 2WRTA 4FYCA 2XJQA 3KYWA 4EDYA 2JZTA 4XS1A 2IFQA 2L5LA 2D2ZA 1OVNA 4K7NA 2O89A 4B8CD 3LORA 2KP1A 6GSTA 1A24A 1K0MA 4DVCA 4YQVA 2HRAA 2J23A 3DMLA 2CKCA 1QYBA 2MBSA 3UVTA 2E2GA 2C0GA 2PU9C 3A5WA 11GSA 1SKRB 5JVH1 2PYAA 1LKOA 4ZL9A 3ZRDA 3EU4A 3TJGA 3GX8A 9GSSA 4WETA 1SK0A 1ILOA 2PSMC 2H0GA 4IJIA 4KSOA 5B8AA 2V6OA 2XJPA 4IW9A 2JI1A 3C1RA 4PNFA 3VI7A 4V2LA 1R0JA 4AR4A 1ZZYA 3N5OA 4POBA 3MWHA 3APSA 1MDJA 2H01A 5DVBA 4IS0A 4MPGA 2RUEA 5BRTA 3H93A 1M0UA 1F37A 3R2QA 2TIRA 2A2SA 4TR4A 3E0UA 3F6DA 4MMMA 4DEJA 4XS4A 1CQGA 2N5BA 1VRSD 1YKAA 3GV1A 1KEBA 4Z2RA 5HR2A 3F6FA 4ISDA 4PUAA 4RQXA 2C4JA 1THOA 1LBKA 4LMVA 2LQOA 2H6XA 3M9KA 5DBQA 3FEUA 2GZZA 5H5QA 6GSWA 1A23A 2AAWA 3EVIA 5G5EA 5F8BA 1T3BA 2AYJA 1YV1A 1XWAA 1TP9A 5J9BA 1VF1A 3ERWA 3KGKA 4TR1B 6RXNA 3KCMA 2PVEA 4TOPA 1IYIA 4POMA 5FWGA 2XPEA 4AI2A 2YJ7A 2LNSA 2P0GA 2A69D 1EV9A 3EURA 1T8EB 5H5SA 2A4VA 4ACSA 1X9WB 4RQRA 4IN0A 2H12A 5AIVA 3ZMLA 1ERVA 4LHNA 1SD9A 5DJLA 5KEJA 2H1DA 1TK8B 4V2NA 3M3MA 2PN8A 4ZILA 2K9FA 3KTBA 5IY0A 1XW5A 4OCFA 2X99A 5RXNA 5ECKB 5AN1A 1PN9A 1F3AA 2YNXA 3KMOA 4LLRA 1AC1A 5GADc 1XW6A 4HEA2 4K5RA 1YUXA 2OBKA 2JI3A 1QFNA 4FYBA 1JZRA 2VL6A 4F2IA 4YQUA 1S30A 4PX1A 1PKZA 5J5NA 1A2JA 1XVWA 2B5XA 5IMZA 1V40A 1YKCA 3LNLA 5MLC3 2I81A 3QFBC 2VCWA 5ECRB 3GTUB 2GSQA 2JZSA 4ZL8A 3ZG6A 1R7HA 2OE3A 3LFLA 3ERGA 4USSA 2DJ3A 1XOAA 1THXA 2L6DA 3E9JB 3EINA 3TRXA 1WMJA 2LKUA 5KN1A 3LG6A 1FHHA 3PINA 2HRKA 2IMFA 1URMA 3BOAA 1O6JA 3LJRA 4MA9A 1LKPA 5JWOB 1BQ7A 1F6MC 3IC8A 2AV4A 3OR5A 5G30A 4ML1A 2E7PA 2NYDA 1Z7RA 3DYRA 3H8QA 1ACVA 1YEXA 3VPBE 2H76A 2H30A 3ZFLA 2PVXA 1GNWA 1KNGA 1JLWA 2DMLA 3PPUA 2NVLA 5G2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ON5 A;  2YN1 A;  1WJK A;  3ZIV A;  1BG5 A;  1B4P A;  4MH2 A;  1A0F A;  4XTS A;  5ENU A;  4MH3 A;  4JBB A;  1XOB A;  3HVX A;  4PQ1 A;  2H0I A;  3QAW A;  3ZZX A;  3IAM 2;  2HZE A;  2KP2 A;  1SKS B;  3VPT A;  2IME A;  2ES7 A;  2LTK A;  4ZXG A;  4HJM A;  3RPP A;  1GSQ A;  2HFD A;  5HR3 A;  2JZR A;  4MZC A;  1B9Y C;  3TKS E;  2FWG A;  3Q74 A;  4WBJ A;  2M80 A;  2RM6 A;  4KH7 A;  5DQS A;  2X8H A;  3TUE A;  2CVB A;  4IKH A;  2I4A A;  1T4Y A;  5IO0 A;  1GLP A;  4ECC A;  3KMN A;  5C00 A;  1SJI A;  1OAZ A;  1V98 A;  5J4U A;  4NAX A;  1W89 A;  3PH9 A;  1GUH A;  4BL7 A;  3TKP A;  2M72 A;  3HA9 A;  1PL1 A;  3DWV A;  3GH9 A;  4NHW A;  2LJR A;  3GST A;  1I9D A;  1TRW A;  4MF6 A;  2GVP A;  4DSS A;  1A0R P;  1A2M A;  1HYU A;  4IHU A;  2E0Q A;  5DAK A;  3HZ4 A;  1G7E A;  4XHM A;  4N0V A;  2WS2 A;  2VL9 A;  3FK8 A;  1ERT A;  2OAD A;  1WIK A;  2L5O A;  1YF0 A;  4PUF C;  4AF2 A;  5EY6 A;  1NHO A;  3N9J A;  1SU9 A;  4WXT A;  1TU7 A;  4MDC A;  2HNL A;  1DE2 A;  1GNE A;  1KBN A;  1CQH A;  2DJJ A;  3IV4 A;  3AY8 A;  1JZW A;  2KHP A;  4K7I A;  4KDU A;  1EOH A;  4AJ7 A;  2YJH A;  3RHB A;  3TKS C;  2VD1 A;  3HDC A;  3W8S A;  1BAY A;  5CP1 A;  1PX7 A;  3A3T A;  1ERU A;  13GS A;  1IYH A;  5D8I A;  4F0B A;  2LV3 A;  3F0I A;  2CVD A;  3TDG A;  2JU5 A;  2AUV A;  3ZLP A;  2GZY A;  4NMU A;  4N10 A;  1XBS A;  4HOJ A;  6GSV A;  4KA0 A;  1Z5Y E;  5IOW A;  1AQW A;  2EIR A;  3GKM A;  3HD5 A;  3TJB A;  3BCK A;  5DAL B;  3M0F A;  4BWQ A;  2RLI A;  3GFK A;  1Y6E A;  2LJA A;  3L9V A;  4P3Y B;  3UIW A;  1G0T A;  5JCG A;  4TKY A;  1U88 A;  1ML6 A;  2X64 A;  1GH2 A;  4ILF A;  2K18 A;  2LQQ A;  4TXO B;  4J56 E;  1TI1 A;  4N0Z A;  2FD3 A;  2DIY A;  4J57 E;  3ZRE A;  4MJB A;  1PMT A;  2K6V A;  1YQ1 A;  1M2A A;  4MJE A;  2X8C A;  4ZB9 A;  2YZU A;  1TU8 A;  2LRN A;  3L78 A;  1GSE A;  3ME7 A;  1M2B A;  3EWL A;  1K0C A;  4TN8 A;  1QGV A;  3VWU A;  5AGY A;  1YEP A;  1ZCP A;  1T4Z A;  1V9W A;  3TKQ A;  4I5Q A;  1FVJ A;  1TXX A;  3UBL A;  2BTO T;  2H66 A;  2VD0 A;  3MSZ A;  3ZVJ D;  4MAB A;  1EEJ A;  1W4V A;  20GS A;  5ELG A;  2V32 A;  2HT9 A;  2YV9 A;  3ISO A;  4ZB6 A;  3H79 A;  4Q5F A;  1ZL9 A;  1YDK A;  4QL7 A;  2E2M A;  5IO2 A;  1K0D A;  5D9T A;  1WOU A;  2B5Y A;  3FR3 A;  4ZL7 A;  5ECH B;  4ECI A;  4IQ1 A;  3IHQ A;  3HVV A;  3CTF A;  4ID0 A;  2N5A A;  1QK8 A;  2HRN A;  3MDK A;  2VLT A;  4KCE A;  2PGT A;  3KH9 A;  1HD2 A;  2B6M A;  2MBT A;  2CQ9 A;  4HU9 A;  4I6X A;  1YF1 A;  3UAR A;  1VF3 A;  3GIX A;  3RAZ A;  3A2V A;  1GTI A;  5IPG A;  3DIE A;  1GP1 A;  2AHE A;  4I97 A;  3O6T A;  4ZB8 A;  4I2U A;  1U3I A;  3TJF A;  2MMA A;  2EIO A;  6GSX A;  4EF0 A;  4PXO A;  2OE1 A;  1B48 A;  2FLS A;  4HQS A;  1H75 A;  3M1G A;  3GN3 A;  1WWJ A;  1EP7 A;  4Q5Q A;  4G2E A;  2J9U B;  2YV7 A;  1K3O A;  2REM A;  1BED A;  2P31 A;  1ZYQ B;  2VUP A;  1M9A A;  4WF4 A;  1X5C A;  2H1A A;  2PUK C;  4EC0 A;  2K8V A;  4AGS A;  3U6V A;  1MDK A;  1S3C A;  3HKR A;  1YZX A;  3ZIT A;  1GTU A;  3UL3 A;  1ZOF A;  3QPM A;  3EE2 A;  3GNJ A;  3C7M A;  4GLT A;  1GRX A;  1WE0 A;  2R2J A;  2HE3 A;  1PL2 A;  3EMP A;  3IA1 A;  1TKD B;  3TRP A;  4MF5 A;  2L4C A;  4ZBD A;  1MD3 A;  1R4W A;  4JRR A;  2DMM A;  5ID2 A;  5A4W A;  5G1K A;  4J2F A;  3TRQ A;  1SKW B;  5CRH A;  3HJO A;  2VLV A;  8GSS A;  2VCZ A;  1GTA A;  3HY2 A;  1M9B A;  4XXB B;  2H8L A;  3LGC A;  3O76 A;  3M8N A;  3FZ4 A;  1AUC A;  1FO5 A;  2CV4 A;  4O92 A;  3KTL A;  4BVX A;  2OKA A;  4HU7 A;  1XXU A;  1PKW A;  3FYG A;  2O8V B;  3HVS A;  4IEL A;  4WBR D;  3V1W A;  1XFL A;  1ERW A;  1R5A A;  3QCP A;  4NV5 A;  2BJX A;  2YCD A;  3HZ8 A;  4KE3 A;  3LYK A;  1Z9H A;  5EL8 A;  3C71 A;  1F9M A;  2NDO A;  1OE7 A;  1JZO A;  3A2W A;  4FO5 A;  4OCE A;  4D73 B;  3UVH A;  2F8A A;  3DKS A;  1TRS A;  4K8M A;  2CX4 A;  1XWK A;  3IRA A;  4EO3 A;  2R5G A;  4K1F A;  1JLV A;  4JU5 A;  1OC9 A;  3DRN A;  3LEF A;  5KN0 A;  1FB0 A;  1SYX A;  2FWH A;  4K6X A;  3WGD A;  5J9C A;  2LRT A;  1VF2 A;  1LU4 A;  5CAX A;  3VWW A;  2H72 A;  3M9J A;  1FW1 A;  1K3Y A;  5CRE A;  3FRC A;  3TB2 A;  3HXS A;  5B6M A;  2NTO A;  2MMO A;  3EU3 A;  4F82 A;  5CO3 A;  2MZC A;  1BX9 A;  5B7C A;  2OE0 A;  1GLQ A;  3QAV A;  3KP9 A;  2G2Q A;  1NM3 A;  3G7Y A;  1FG4 A;  2YPM A;  3G9B A;  1OKD A;  3ZL5 A;  3TOT A;  4K9Z A;  4YAP A;  1TK5 B;  5KN2 A;  2GZP A;  3C8E A;  1M7T A;  4GXZ A;  1ST9 A;  4MK3 A;  2C6B A;  3IBH A;  5GAP D;  4L0U A;  3G7I A;  4HI7 A;  3FR6 A;  2L57 A;  3DVX A;  4GST A;  4L5L A;  1XPV A;  4TR3 A;  3QFA C;  5B6N A;  5HFG A;  4E8E A;  1USB A;  3HCZ A;  2JAC A;  5A4U A;  1EP8 A;  2H19 A;  2VO4 A;  3VK9 A;  3IDV A;  3TKS A;  2GTU A;  2XC2 A;  5E59 A;  3D4M A;  2YWO A;  7GSS A;  2PPT A;  4K0N A;  2OA7 A;  2YZH A;  3VLN A;  5CNW A;  3LSZ A;  1FOV A;  2LJK A;  4CW9 A;  3GKN A;  1N2A A;  1ABA A;  2ZNM A;  3US3 A;  4TRX A;  2BMX A;  5IMD A;  1FAA A;  2O7K A;  1WP0 A;  4ECB A;  1Y25 A;  3P2A A;  4PUR A;  2DSA A;  4GSN A;  3F3R A;  4BA7 A;  3BBY A;  1B8X A;  4ML6 A;  17GS A;  3EYT A;  2R37 A;  5E4W A;  3NIV A;  1AAZ A;  3O3T A;  5IIZ A;  1J0F A;  1RK4 A;  3HHV A;  5J3R A;  3I69 A;  3P7X A;  3IC4 A;  2AJQ B;  2CA8 A;  3LQ7 A;  1TK0 B;  2NPB A;  3RBT A;  5FHI A;  4TVE A;  2RUF A;  3HYP A;  3W6G A;  5ECO B;  3FHK A;  3RHC A;  5INY A;  2IFQ B;  5LD0 A;  2VLU A;  1GUL A;  2H1G A;  14GS A;  3QAG A;  2VCQ A;  3C73 A;  3UOM A;  1TTZ A;  2P5R A;  3HJP A;  4EVM A;  3TJK A;  2MYG A;  1XVQ A;  1WRY A;  5C04 A;  3G7J A;  4WKW A;  3TCO A;  1V57 A;  1TRU A;  3JCM L;  4X1U A;  3CRU A;  2DJ2 A;  1NW2 A;  2JSY A;  2NBS A;  4F0C A;  3ERF A;  1Q98 A;  3IAS 2;  3GH6 A;  2F51 A;  4XIH A;  4TR1 A;  2C3Q A;  5ECS A;  4OFT A;  1GSU A;  2H74 A;  4JR6 A;  3BJ5 A;  4K7O A;  5G1L A;  2HYX A;  1UA5 A;  3EC3 A;  3H1N A;  2H71 A;  1QQ2 A;  1XZO A;  1M99 A;  4YQM A;  1A2L A;  1FB6 A;  1R5P A;  3LWA A;  3GUR A;  2QSI A;  2FWF A;  1X5D A;  4XCS A;  22GS A;  4XS4 B;  4BWS A;  2VAF A;  4EXJ A;  4OWY A;  5B8B A;  3DVW A;  3LYP A;  3Q18 A;  2WGR A;  5GAN D;  5DCG A;  3ME8 A;  2IL3 A;  2O85 A;  4Q5R A;  4GRF A;  1GUM A;  2F3M A;  3DXB A;  5CYY A;  4JED A;  1K0A A;  5ECP B;  3BD2 A;  5JCU A;  2PVO C;  4RUV A;  5L71 A;  1DE1 A;  5IPH A;  1Z3E A;  2DLX A;  4IVF A;  2HRF A;  2Z9S A;  1TW9 A;  2V6K A;  5IMF A;  4H86 A;  3QMX A;  4FIW A;  4CHS A;  2OBI A;  3ZFB A;  2CZ3 A;  3IE3 A;  3GTU A;  2PER A;  1QMV A;  3QOU A;  1X5E A;  4V1A g;  2IMD A;  3WT2 A;  1TRV A;  2B7J A;  4QL9 A;  2TRX A;  1G7O A;  5FT3 A;  1MD4 A;  2HI7 A;  2H0H A;  2HLS A;  3APQ A;  1FHE A;  4HZ2 A;  3FZA A;  4ZBB A;  1Q4J A;  4IQA A;  1X9S B;  1V58 A;  5J41 A;  1UN2 A;  5H5R A;  5KN3 A;  3WYW A;  3ZMK A;  1SJZ A;  2VCX A;  4GWR A;  3L9U A;  5ABR A;  3RDW A;  3UMA A;  3FZ9 A;  5F06 A;  4HUA A;  2LNT A;  1O8X A;  1WPI A;  3GUS A;  1AQV A;  1EWX A;  4PGT A;  2XBI A;  4XS6 A;  1NHY A;  1PA3 A;  2MMN A;  2YWI A;  2JAD A;  3D5J A;  2FCH A;  3IK7 A;  1QUW A;  1S3A A;  1XW9 A;  1Z6M A;  2B7K A;  2VIM A;  1B9X C;  1ON4 A;  3E3E A;  3GKK A;  4Q5N A;  2GGT A;  4OMV A;  2WZ9 A;  1FVK A;  5ELA A;  2R6K A;  2WFC A;  2A2R A;  4E8H A;  3Q19 A;  4K0G A;  4L5O A;  2GT5 A;  1GSY A;  2GQK A;  4EL1 A;  1EZK A;  2M46 A;  16GS A;  4EE0 A;  4POL A;  2KUC A;  2VL2 C;  3FKF A;  3VI5 A;  3F3Q A;  4IBP A;  4KDY A;  1S3D A;  2ZCT A;  1U6T A;  4GF0 A;  3D6I A;  1U3A A;  2TRC P;  5DQY A;  5CRD A;  3IPZ A;  1XWG A;  2N5F A;  3GMF A;  1U87 A;  2LUS A;  3GYK A;  3L9S A;  5DDL A;  5ECM B;  4N11 A;  1EOG A;  4HS1 A;  4KX4 A;  1K0B A;  3GKX A;  1UC7 A;  2R4V A;  4OFM A;  4G19 A;  4HQZ A;  2C0D A;  2GLR A;  2CAQ A;  2I3Y A;  2V2G A;  3VWV A;  1SK2 A;  2WJU A;  3D4T A;  2I1U A;  3TJJ A;  5D9V A;  2HZE B;  1N8J A;  5ECI B;  1ZYE A;  2GQM A;  4X0X A;  4O7H A;  3TKR A;  3IOS A;  3SBC A;  1PQN A;  1O85 A;  2R3X A;  1MTC A;  4HJ2 A;  5DJM A;  2IN3 A;  2C0F A;  4F03 A;  3U5R E;  1DUG A;  3QDN A;  4BVY A;  2C8U A;  4XRD A;  3APO A;  2IWT A;  3SWL A;  1PX6 A;  4YH2 A;  2GT6 A;  4AJ8 A;  2CZ2 A;  1SK1 A;  4L0W A;  3FR9 A;  4NHZ A;  1E2Y A;  2X8G A;  3FY7 A;  2K8S A;  2CT6 A;  4EDZ A;  1XWC A;  1HNC A;  5D9W A;  3A2X A;  2IMI A;  1Z7P A;  3CYN A;  1NSW A;  4JE1 A;  4DSS B;  1MDI A;  4MP4 A;  3LXZ A;  1SL2 B;  3MAK A;  2RII A;  4NV2 A;  2V1M A;  2YWN A;  4KAE A;  1Z6N A;  3K8N A;  1JFU A;  2RM5 A;  5DAK B;  5D9X A;  5CRW A;  5AIX A;  4XRA A;  1SYR A;  2DC5 A;  2HSY A;  1DSB A;  3QR6 A;  4KB3 A;  2C80 A;  2PMT A;  3DEX A;  2OAC A;  1EGO A;  1T00 A;  5LCZ A;  5DAL A;  2B1K A;  5DCH A;  4WR5 A;  4KW6 A;  3CSJ A;  5IQY A;  1C72 A;  3I6A A;  3IR4 A;  4EKZ A;  1O7U A;  1I5G A;  1RQM A;  4RI6 A;  4TXO A;  4MZW A;  2KLX A;  2O87 A;  1EEM A;  1J9B A;  4LL1 B;  1B4Q A;  3S9F A;  3D21 A;  2CX3 A;  2LS5 A;  1LJR A;  18GS A;  3P8W A;  2GS3 A;  4KCA A;  2H6Y A;  2GST A;  4QQ7 A;  1QXH A;  4NWY A;  4MF7 A;  4ZIJ A;  5IMV A;  4G9H A;  5ECN B;  1VGL A;  2FUG 2;  3ED3 A;  4N30 A;  2FY6 A;  5D93 A;  2DIZ A;  3UJ1 A;  4KDX A;  1F2E A;  3TGZ A;  3UEM A;  1T1V A;  4NXI A;  1PSQ A;  2YOI A;  1KTE A;  3VPQ A;  1K3L A;  2AB6 A;  1GSF A;  3GA4 A;  3B0A B;  3F4R A;  4GQC A;  1RW1 A;  2VCT A;  1YY7 A;  1JHB A;  1YJ6 A;  2I9H A;  5F05 A;  5D73 A;  2VM2 A;  3I9V 2;  1G6Y A;  2PVQ A;  3D0Z A;  3F4S A;  4O5R A;  3KD0 A;  3FZ5 A;  1BYE A;  3C1S A;  2L4Q A;  2B1L A;  3KXO A;  1O81 A;  3ZIJ A;  1GSD A;  2F8F A;  2GDR A;  2WDU A;  4TXV A;  4HZ4 A;  6GSY A;  4MPF A;  2KOK A;  1A8Y A;  5A4V A;  4IP6 A;  2P5Q A;  3CTG A;  2C1Y A;  5IMC A;  2VCV A;  4DSR A;  5G5F A;  4GQF A;  4HDE A;  3CMI A;  4ECJ A;  1SD8 A;  5F0G A;  3WT1 A;  4TR0 A;  1VF4 A;  2IMK A;  5JWQ B;  1SJ6 A;  3RPN A;  2FA4 A;  5GZZ B;  2FWE A;  5HFK A;  5GSS A;  4GSS A;  4JR4 A;  2XBQ A;  2H75 A;  1EGR A;  3VWX A;  5GST A;  3IK9 A;  2QC7 A;  4EUY A;  4JZQ A;  3KM6 A;  2YP6 A;  2PWJ A;  3CXG A;  5IMA A;  4POK A;  1R26 A;  2YWM A;  4ZBA A;  3QD9 A;  3GSS A;  2WB9 A;  2C3T A;  2WUL A;  3F4T A;  1K0O A;  4RI7 A;  4KND A;  4F9Z A;  2DBC A;  2AYT A;  3HJM A;  4FYU A;  3CSH A;  3IXR A;  2L59 A;  1PRX A;  1OYJ A;  3KIJ A;  2XPD A;  3F8U A;  4MJA A;  4O32 A;  1H4O A;  1AQX A;  3J7Y k;  1BJX A;  2V41 A;  5ECL B;  5LNK e;  3J7Y b;  1X0R A;  2IIY A;  3B08 B;  1GTB A;  5ECQ B;  3NOF A;  1PD2 1;  1XCC A;  4MZB A;  4LMW A;  4ULX A;  5AIS A;  5EVO A;  2H1B A;  3D22 A;  1O8W A;  2GSS A;  1X9M B;  2VL2 A;  3VFI A;  4IJ3 A;  3ZYW A;  2CAI A;  2QGV A;  3KEB A;  10GS A;  6GSU A;  1TI3 A;  3DD3 A;  1TJD A;  1SL0 B;  3KP8 A;  5COH A;  5HR1 A;  3GHA A;  4FH8 A;  4KSM A;  3DGQ A;  2FHE A;  1HNB A;  1XWB A;  3KH7 A;  2B3S A;  2F9S A;  4LA1 A;  2FA8 A;  1GL8 A;  3LXT A;  4KUN A;  4TW5 A;  4D73 A;  5JCW A;  5ID2 B;  2ON7 A;  4X43 A;  5F07 A;  1OC3 A;  6GSS A;  1G6W A;  1HNA A;  3TOU A;  4PQI A;  4BPY A;  4OO5 A;  1K0N A;  3MNG A;  2C0E A;  2H6Z A;  1AW9 A;  1M2D A;  4OD7 A;  3F9U A;  1GUK A;  19GS A;  3FW2 A;  3CSI A;  1EV4 A;  1J08 A;  2WCI A;  4K2D A;  1ZMA A;  2ALB A;  5CRG A;  5HR0 A;  4NPB A;  1HQO A;  5HQP A;  2J9H A;  12GS A;  2G0F A;  2LRC A;  4PQH A;  2DJ0 A;  3WD6 A;  1TDI A;  5IM9 A;  4KGI A;  5G31 A;  2JSZ A;  4PNG A;  4OFN A;  4GCI A;  1GSS A;  3P90 A;  3KZQ A;  1AIU A;  5IOX A;  2YAN A;  1OC9 B;  2GQL A;  2EC4 A;  3UAP A;  1E6B A;  2QKE A;  4YAV A;  1PGT A;  4WEY A;  2H70 A;  3ZTL A;  2CVK A;  3NZN A;  4V1A p;  1ZGN A;  4CDO A;  3GL3 A;  5D96 A;  2LST A;  2DJ1 A;  3GX0 A;  5EPF A;  4IP1 A;  1SL1 B;  4GTU A;  1OC8 A;  2FGX A;  3WGX A;  3I43 A;  3GL5 A;  2C3N A;  4I2T A;  5JWR B;  2XHF A;  2C6A A;  3L0H A;  4L8E A;  3PR8 A;  4IGJ A;  2VM1 A;  1TOF A;  4MLY A;  3BCI A;  2L6C A;  3WGE A;  2FNO A;  2DJK A;  3ZVJ A;  1O73 A;  3EMX A;  2IPA A;  3H4K A;  1GWC A;  2VOC A;  3UBK A;  1OKT A;  4AJ6 A;  4WF5 A;  1F3B A;  1T7P B;  5HFI A;  1AXD A;  1OE8 A;  4MCU A;  2HZF A;  3PGT A;  4WR4 A;  5A5K A;  1XIY A;  3F63 A;  2LEG A;  2GSR A;  2ZUP A;  4LL4 B;  1JZD A;  1SEN A;  3KJY A;  1DBY A;  1A8L A;  2VL3 A;  3GRX A;  2HXK A;  3CRT A;  2IJY A;  2OJL A;  4I8B A;  4Z7X A;  4V2M A;  1V2A A;  2JL4 A;  1MEK A;  4DSQ A;  2EIQ A;  3W8J A;  1UVZ A;  2PBJ A;  3L4N A;  4MJC A;  4G10 A;  4OO4 A;  3Q6O A;  2B5E A;  2HSH A;  2MMZ A;  3VUR A;  2H73 A;  3CBU A;  2WRT A;  4FYC A;  4EDY A;  2JZT A;  4XS1 A;  2IFQ A;  2L5L A;  2D2Z A;  1OVN A;  4K7N A;  2O89 A;  3LOR A;  2KP1 A;  6GST A;  1A24 A;  1K0M A;  4DVC A;  4YQV A;  2J23 A;  3DML A;  2MBS A;  3UVT A;  2E2G A;  2C0G A;  2PU9 C;  3A5W A;  11GS A;  1SKR B;  4ZL9 A;  3ZRD A;  3EU4 A;  3TJG A;  3GX8 A;  9GSS A;  4WET A;  1SK0 A;  1ILO A;  2H0G A;  4IJI A;  4KSO A;  5B8A A;  2V6O A;  4IW9 A;  3C1R A;  4PNF A;  3VI7 A;  4V2L A;  1ZZY A;  3N5O A;  4POB A;  3MWH A;  3APS A;  1MDJ A;  2H01 A;  5DVB A;  4IS0 A;  4MPG A;  2RUE A;  3H93 A;  1M0U A;  1F37 A;  3R2Q A;  2TIR A;  2A2S A;  4TR4 A;  3E0U A;  3F6D A;  4MMM A;  4DEJ A;  4XS4 A;  1CQG A;  2N5B A;  1VRS D;  1YKA A;  3GV1 A;  1KEB A;  5HR2 A;  3F6F A;  4ISD A;  4PUA A;  4RQX A;  2C4J A;  1THO A;  1LBK A;  4LMV A;  2LQO A;  2H6X A;  3M9K A;  5DBQ A;  3FEU A;  2GZZ A;  5H5Q A;  6GSW A;  1A23 A;  2AAW A;  3EVI A;  5G5E A;  5F8B A;  1T3B A;  1XWA A;  1TP9 A;  5J9B A;  1VF1 A;  3ERW A;  3KGK A;  4TR1 B;  3KCM A;  4TOP A;  1IYI A;  4POM A;  5FWG A;  2XPE A;  2YJ7 A;  2LNS A;  2P0G A;  1EV9 A;  3EUR A;  1T8E B;  5H5S A;  2A4V A;  4ACS A;  1X9W B;  4RQR A;  4IN0 A;  5AIV A;  3ZML A;  1ERV A;  1SD9 A;  5DJL A;  5KEJ A;  2H1D A;  1TK8 B;  4V2N A;  3M3M A;  2PN8 A;  4ZIL A;  2K9F A;  3KTB A;  1XW5 A;  4OCF A;  2X99 A;  5ECK B;  5AN1 A;  1PN9 A;  1F3A A;  2YNX A;  3KMO A;  4LLR A;  1AC1 A;  1XW6 A;  4HEA 2;  2OBK A;  1QFN A;  4FYB A;  1JZR A;  4F2I A;  4YQU A;  4PX1 A;  1PKZ A;  5J5N A;  1A2J A;  1XVW A;  2B5X A;  5IMZ A;  1V40 A;  1YKC A;  2I81 A;  3QFB C;  2VCW A;  5ECR B;  3GTU B;  2GSQ A;  2JZS A;  4ZL8 A;  1R7H A;  2OE3 A;  3LFL A;  3ERG A;  2DJ3 A;  1XOA A;  1THX A;  2L6D A;  3E9J B;  3EIN A;  3TRX A;  1WMJ A;  2LKU A;  5KN1 A;  3LG6 A;  3PIN A;  2IMF A;  1URM A;  3BOA A;  1O6J A;  3LJR A;  4MA9 A;  5JWO B;  1BQ7 A;  1F6M C;  2AV4 A;  3OR5 A;  5G30 A;  4ML1 A;  2E7P A;  1Z7R A;  3DYR A;  3H8Q A;  1ACV A;  1YEX A;  2H76 A;  2H30 A;  3ZFL A;  1GNW A;  1KNG A;  1JLW A;  2DML A;  2NVL A;  5G2Z A; 
#chains in the Genus database with same CATH topology
 2ON5 A;  2YN1 A;  3IU3 I;  1R0I A;  1WJK A;  3ZIV A;  1BG5 A;  1B4P A;  4MH2 A;  1A0F A;  4XTS A;  5ENU A;  4MH3 A;  4JBB A;  1XOB A;  3HVX A;  4PQ1 A;  2E2H L;  1IW7 D;  5GAE c;  2H0I A;  3QAW A;  3HOX L;  2QA1 A;  3ZZX A;  3IAM 2;  2HZE A;  2KP2 A;  1SKS B;  3VPT A;  2IME A;  2ES7 A;  1VCX A;  2LTK A;  4A3D L;  4ZXG A;  3WWL A;  4HJM A;  3RPP A;  1GSQ A;  2HFD A;  5HR3 A;  2JZR A;  4MZC A;  1B9Y C;  3TKS E;  1B71 A;  2FWG A;  3Q74 A;  1H7V A;  2M80 A;  4WBJ A;  2RM6 A;  4KH7 A;  1OWC A;  3HAX C;  5DQS A;  2X8H A;  3TUE A;  2CVB A;  4IKH A;  2I4A A;  1T4Y A;  5IO0 A;  1GLP A;  4ECC A;  3KMN A;  5C00 A;  1SJI A;  1OAZ A;  1V98 A;  5J4U A;  4AYB P;  1W89 A;  3KYX A;  4NAX A;  3GTO L;  3PH9 A;  1GUH A;  4BL7 A;  3TKP A;  2M72 A;  3HA9 A;  1BQ9 A;  1PL1 A;  3DWV A;  3GH9 A;  4NHW A;  2LJR A;  3GST A;  1I9D A;  1TRW A;  4MF6 A;  2GVP A;  4DSS A;  1A0R P;  5MFZ A;  1A2M A;  1HYU A;  4GS7 D;  4IHU A;  2E0Q A;  5DAK A;  3HZ4 A;  1G7E A;  4XHM A;  3A44 A;  3HOV L;  4N0V A;  2WS2 A;  2A6H D;  1PN0 A;  1RDV A;  4BVY B;  2VL9 A;  3FK8 A;  1ODH A;  1ERT A;  2OAD A;  1Y1V L;  1WIK A;  2L5O A;  3S1Q L;  1YF0 A;  2R93 L;  4PUF C;  5C3E L;  4AF2 A;  1NHO A;  5EY6 A;  3N9J A;  1SU9 A;  4AR6 A;  4WXT A;  1TU7 A;  4MDC A;  2HNL A;  1DE2 A;  4ICY A;  4QIW P;  1GNE A;  1IRN A;  5AI3 A;  1KBN A;  1CQH A;  2DJJ A;  3IV4 A;  3AY8 A;  1JZW A;  2KHP A;  4K7I A;  4KDU A;  4O5Q A;  1EOH A;  4AJ7 A;  2YJH A;  2R7Z L;  3RHB A;  3TKS C;  2VD1 A;  3HDC A;  2AUS B;  3W8S A;  3GTQ L;  1BAY A;  1PX7 A;  5CP1 A;  3A3T A;  1ERU A;  13GS A;  1IYH A;  5D8I A;  4F0B A;  2LV3 A;  3F0I A;  2CVD A;  3TDG A;  2JU5 A;  2AUV A;  2EY4 E;  1Y1W L;  3ZLP A;  2GZY A;  4NMU A;  4N10 A;  1XBS A;  4HOJ A;  6GSV A;  4KA0 A;  1Z5Y E;  5IOW A;  1AQW A;  1TWA L;  2EIR A;  3GKM A;  3HD5 A;  3PO2 L;  3TJB A;  3BCK A;  5DAL B;  3M0F A;  4BWQ A;  2RLI A;  3GFK A;  1Y6E A;  2LJA A;  3L9V A;  4P3Y B;  3UIW A;  1G0T A;  5JCG A;  4TKY A;  1U88 A;  1ML6 A;  2X64 A;  1GH2 A;  4ILF A;  2K18 A;  2LQQ A;  1S24 A;  4TXO B;  4J56 E;  1TI1 A;  4N0Z A;  2FD3 A;  2DIY A;  4J57 E;  3ZRE A;  4MJB A;  1PMT A;  2K6V A;  1YQ1 A;  1I6H L;  1M2A A;  4MJE A;  2X8C A;  4ZB9 A;  2YZU A;  5GAG c;  1TU8 A;  2LRN A;  3L78 A;  1GSE A;  3ME7 A;  1M2B A;  3EWL A;  2DKH A;  1B13 A;  1RWD A;  5M3F L;  1K0C A;  4TN8 A;  1QGV A;  3LWP B;  3VWU A;  5AGY A;  2HSM A;  2R0C A;  1YEP A;  1DVB A;  1ZCP A;  1T4Z A;  1V9W A;  3R3E A;  3TKQ A;  4I5Q A;  3LWQ B;  1FVJ A;  1TXX A;  3UBL A;  1PZX A;  2BTO T;  2H66 A;  1CAA A;  2VD0 A;  3MSZ A;  3ZVJ D;  4MAB A;  1EEJ A;  2Y0S P;  1W4V A;  20GS A;  5ELG A;  2V32 A;  2HT9 A;  2YV9 A;  3HOW L;  3ISO A;  4ZB6 A;  3H79 A;  4AI1 A;  4Q5F A;  1ZL9 A;  1YDK A;  4QL7 A;  2E2M A;  5IO2 A;  1K0D A;  5D9T A;  5KOX A;  1WOU A;  2B5Y A;  3FR3 A;  4ZL7 A;  5ECH B;  4ECI A;  4IQ1 A;  3IHQ A;  3HVV A;  4JAD A;  3CTF A;  4ID0 A;  4POG A;  2N5A A;  1QK8 A;  2R92 L;  2HRN A;  3MDK A;  2VLT A;  4KCE A;  2PGT A;  4Z2U A;  3H3V M;  2YU9 L;  3KH9 A;  1HD2 A;  2B6M A;  2MBT A;  2CQ9 A;  4HU9 A;  4I6X A;  1YF1 A;  1BQ8 A;  3UAR A;  1VF3 A;  3GIX A;  3RAZ A;  3A2V A;  1GTI A;  1R0G A;  3KYU A;  5IPG A;  3DIE A;  4AHX A;  1GP1 A;  2AHE A;  4I97 A;  4AR3 A;  3O6T A;  4ZB8 A;  2AQC A;  4I2U A;  1U3I A;  2O5J D;  3TJF A;  2MMA A;  2EIO A;  1PFV A;  6GSX A;  2HVY C;  4EF0 A;  4PXO A;  2OE1 A;  1B48 A;  2FLS A;  4HQS A;  1H75 A;  3M1G A;  3GN3 A;  1WWJ A;  1EP7 A;  4Q5Q A;  4G2E A;  5M5W L;  2J9U B;  1NXG A;  2YV7 A;  1K3O A;  2REM A;  1BED A;  2P31 A;  1ZYQ B;  4Y7N L;  2VUP A;  1M9A A;  4WF4 A;  1X5C A;  2H1A A;  2PUK C;  4EC0 A;  2K8V A;  4AGS A;  3U6V A;  1MDK A;  1S3C A;  2JA7 L;  3HKR A;  3H0G L;  1YZX A;  4C3I L;  3ZIT A;  1GTU A;  2M4V A;  4AHZ A;  3UL3 A;  1ZOF A;  4AI0 A;  3QPM A;  5EIO C;  3EE2 A;  3GNJ A;  3C7M A;  4GLT A;  1GRX A;  1WE0 A;  1NNQ A;  2R2J A;  2HE3 A;  1PL2 A;  2L0Z A;  3EMP A;  3IA1 A;  1TKD B;  3TRP A;  5IYC L;  4A3B L;  4MF5 A;  2L4C A;  4ZBD A;  1MD3 A;  1R4W A;  4JRR A;  3FDJ A;  2DMM A;  5ID2 A;  5IYD L;  5A4W A;  5G1K A;  4J2F A;  3TRQ A;  1SKW B;  5CRH A;  3HJO A;  1SMW A;  2VLV A;  8GSS A;  2VCZ A;  4G0K A;  1GTA A;  4O5U A;  4YKG A;  2Z3Q B;  3HY2 A;  1M9B A;  4XXB B;  2H8L A;  3LGC A;  3M8N A;  3O76 A;  3FZ4 A;  1AUC A;  1FO5 A;  2CV4 A;  4O92 A;  3KTL A;  4EIQ A;  4BVX A;  2OKA A;  4HU7 A;  2LCQ A;  2ERJ A;  1XXU A;  4LHL A;  1PKW A;  3FYG A;  2O8V B;  1QQT A;  5DM7 1;  3HVS A;  1VZI A;  4IEL A;  4WBR D;  3V1W A;  1XFL A;  1ERW A;  1R5A A;  1IU5 A;  3QCP A;  3KYV A;  1I3Q L;  2XJU A;  4NV5 A;  2BJX A;  2B63 L;  2YCD A;  3HZ8 A;  4KE3 A;  3LYK A;  1I50 L;  1Z9H A;  5EL8 A;  3C71 A;  1YK5 A;  1F9M A;  2NDO A;  1OE7 A;  1JZO A;  3A2W A;  4FO5 A;  4OCE A;  4D73 B;  3UVH A;  1R0H A;  2F8A A;  3DKS A;  1TRS A;  4K8M A;  2CX4 A;  1XWK A;  3IRA A;  4EO3 A;  2R5G A;  4K1F A;  1JLV A;  4JU5 A;  1OC9 A;  3DRN A;  3LEF A;  5KN0 A;  2QA2 A;  1FB0 A;  3HOY L;  1SYX A;  2FWH A;  4K6X A;  2V0E A;  3WGD A;  2A68 D;  5J9C A;  3EPT A;  2LRT A;  1RYT A;  1VF2 A;  1LU4 A;  3S1R L;  5CAX A;  3VWW A;  2H72 A;  3M9J A;  1FW1 A;  1K3Y A;  5CRE A;  3FRC A;  3TB2 A;  3HXS A;  5B6M A;  2NTO A;  2MMO A;  3EU3 A;  4F82 A;  5CO3 A;  2MZC A;  1BX9 A;  5B7C A;  2OE0 A;  1GLQ A;  3QAV A;  3FMW A;  2A2P A;  3KP9 A;  2G2Q A;  2X49 A;  1NM3 A;  3G7Y A;  1ZRP A;  2JA8 L;  1FG4 A;  2XJT A;  2CR8 A;  2KKD A;  2YPM A;  3G9B A;  1OKD A;  3ZL5 A;  3K7A L;  3TOT A;  4K9Z A;  4YAP A;  1TK5 B;  2PMZ P;  5KN2 A;  2GZP A;  3C8E A;  1M7T A;  3RZ6 A;  4GXZ A;  2VUM L;  1ST9 A;  1B2O A;  2C6B A;  2M6O A;  3IBH A;  4MK3 A;  5GAP D;  4L0U A;  3G7I A;  4HI7 A;  3FR6 A;  2E2J L;  2L57 A;  3DVX A;  4GST A;  1T9Q A;  4L5L A;  3LWR B;  1XPV A;  3QFA C;  4TR3 A;  5B6N A;  5HFG A;  4E8E A;  1USB A;  3HCZ A;  5M5X L;  2JAC A;  3LPE B;  1EP8 A;  2H19 A;  5A4U A;  2VO4 A;  3VK9 A;  3IDV A;  3TKS A;  2GTU A;  2XC2 A;  5E59 A;  3D4M A;  2YWO A;  7GSS A;  1B2J A;  1YK4 A;  1BRF A;  2PPT A;  4K0N A;  2OA7 A;  2YZH A;  3VLN A;  5CNW A;  3LSZ A;  1FOV A;  2LJK A;  1CAD A;  4CW9 A;  3GKN A;  1N2A A;  5K2M E;  1RYQ A;  1ABA A;  2ZNM A;  3US3 A;  4TRX A;  2BMX A;  5IMD A;  1FAA A;  2O7K A;  1WP0 A;  1OWB A;  1RDG A;  3S2H L;  4ECB A;  5C4J L;  1Y25 A;  3A5I A;  3P2A A;  4PUR A;  2DSA A;  4GSN A;  3F3R A;  4YWL A;  4BA7 A;  3BBY A;  1B8X A;  4ML6 A;  3GTP L;  17GS A;  3EYT A;  2R37 A;  5E4W A;  3NIV A;  1AAZ A;  3O3T A;  5IIZ A;  1J0F A;  1RK4 A;  3HHV A;  5J3R A;  3I69 A;  3P7X A;  3IC4 A;  2AJQ B;  2CA8 A;  4G0I A;  1SFO L;  3LQ7 A;  1TK0 B;  2DSX A;  4AR5 A;  2NPB A;  4K9F A;  3HOU L;  3RBT A;  5FHI A;  4TVE A;  2RUF A;  3HYP A;  3W6G A;  5ECO B;  3FHK A;  2NVT L;  3RHC A;  5INY A;  2IFQ B;  2WB1 P;  5LD0 A;  2WAQ P;  2VLU A;  7RXN A;  1GUL A;  2H1G A;  14GS A;  3QAG A;  2VCQ A;  4KF9 A;  3C73 A;  3UOM A;  2Z3R B;  1TTZ A;  2P5R A;  3HJP A;  4EVM A;  3TJK A;  2MYG A;  1XVQ A;  1WRY A;  5C04 A;  3G7J A;  4E6Y A;  4WKW A;  3TCO A;  2GMG A;  1V57 A;  1TRU A;  4Y52 L;  3JCM L;  4X1U A;  3CRU A;  2DJ2 A;  1NW2 A;  3PO3 L;  2JSY A;  2NBS A;  4F0C A;  3ERF A;  1Q98 A;  1C09 A;  3IAS 2;  3GH6 A;  3J7Z 1;  2F51 A;  3CQF A;  4TR1 A;  4XIH A;  2C3Q A;  5ECS A;  3H9C A;  4OFT A;  1GSU A;  2H74 A;  4JAG A;  4JR6 A;  3BJ5 A;  4K7O A;  5G1L A;  2NVQ L;  2HYX A;  1UA5 A;  3EC3 A;  3H1N A;  3RZT A;  3M3Y L;  2H71 A;  1QQ2 A;  1XZO A;  1M99 A;  1ZYP A;  4YQM A;  1A2L A;  1FB6 A;  1R5P A;  3PWF A;  3LWA A;  3GUR A;  1DX8 A;  2QSI A;  2FWF A;  1X5D A;  4XCS A;  22GS A;  4XS4 B;  4BWS A;  4A3G L;  2VAF A;  4EXJ A;  4OWY A;  1PFO A;  5B8B A;  3DVW A;  3LYP A;  1E8J A;  3Q18 A;  2WGR A;  5GAN D;  5DCG A;  3ME8 A;  2IL3 A;  2BE5 D;  2O85 A;  4Q5R A;  4GRF A;  1GUM A;  2F3M A;  3DXB A;  5IP7 L;  3NFP I;  5CYY A;  4JED A;  1K0A A;  5ECP B;  3BD2 A;  5JCU A;  2PVO C;  4RUV A;  5L71 A;  1DE1 A;  5IPH A;  1Z3E A;  2DLX A;  4IVF A;  4BBR L;  2HRF A;  2Z9S A;  1TW9 A;  2V6K A;  5IMF A;  4H86 A;  3QMX A;  4FIW A;  4JAF A;  4CHS A;  2OBI A;  3ZFB A;  2CZ3 A;  3IE3 A;  3GTU A;  2PER A;  1QMV A;  3QOU A;  5C4X L;  1X5E A;  4V1A g;  2IMD A;  3WT2 A;  1TRV A;  2B7J A;  4QL9 A;  2TRX A;  1G7O A;  5FT3 A;  1MD4 A;  2HI7 A;  2H0H A;  3PKJ A;  4TVM A;  4TPU A;  2HLS A;  3APQ A;  2JI2 A;  1FHE A;  4HZ2 A;  3H97 A;  3S1N L;  3FZA A;  4ZBB A;  1Q4J A;  4IQA A;  1X9S B;  4A3J L;  1V58 A;  5J41 A;  1UN2 A;  5H5R A;  4EIP A;  3WYW A;  4WFN 1;  3ZMK A;  5KN3 A;  1WCM L;  1SJZ A;  2VCX A;  4GWR A;  3L9U A;  5ABR A;  2JA5 L;  3RDW A;  2E2I L;  3UMA A;  2JA6 L;  3FZ9 A;  5F06 A;  4HUA A;  2LNT A;  1O8X A;  3RZO L;  1WPI A;  3GUS A;  1AQV A;  1EWX A;  4PGT A;  1XG8 A;  2XBI A;  4XS6 A;  1NHY A;  4ME3 A;  1IRO A;  1PA3 A;  2MMN A;  3GTM L;  3I4M L;  2YWI A;  3LWO B;  2JAD A;  3QQC E;  3D5J A;  1PFU A;  2FCH A;  3IK7 A;  1QUW A;  1S3A A;  1XW9 A;  1Z6M A;  2B7K A;  2VIM A;  1B9X C;  1ON4 A;  3E3E A;  5DM6 1;  1ZYN A;  3GKK A;  4Q5N A;  2GGT A;  4OMV A;  2WZ9 A;  1FVK A;  5ELA A;  2R6K A;  2WFC A;  2A2R A;  4E8H A;  3Q19 A;  4K0G A;  4L5O A;  2GT5 A;  1GSY A;  2GQK A;  4EL1 A;  1EZK A;  2M46 A;  16GS A;  4EE0 A;  4POL A;  4A3M L;  2KUC A;  2VL2 C;  3FKF A;  3VI5 A;  3F3Q A;  4IBP A;  4KDY A;  1S3D A;  2ZCT A;  1U6T A;  4GF0 A;  3D6I A;  1U3A A;  1M3I A;  2TRC P;  4A5P A;  5DQY A;  2RFK B;  4Z2T A;  4K5S A;  5CRD A;  5H1S c;  3IPZ A;  1XWG A;  2N5F A;  3GMF A;  1M3J A;  1U87 A;  2LUS A;  3GYK A;  3L9S A;  5DDL A;  5ECM B;  4N11 A;  1EOG A;  4HS1 A;  4YWM A;  4C2M 1;  4KX4 A;  1K0B A;  3GKX A;  1UC7 A;  2R4V A;  4OFM A;  4G19 A;  4HQZ A;  2C0D A;  2GLR A;  2CAQ A;  2I3Y A;  2V2G A;  3VWV A;  1SK2 A;  1JYB A;  2WJU A;  2I1U A;  3D4T A;  3TJJ A;  5D9V A;  2HZE B;  1N8J A;  5ECI B;  8RXN A;  1ZYE A;  2GQM A;  4X0X A;  4A3C L;  4O7H A;  1YUZ A;  3TKR A;  3IOS A;  3SBC A;  4A3K L;  5KOW A;  1PQN A;  1O85 A;  2R3X A;  1MTC A;  3QVD A;  5BMU A;  4HJ2 A;  5DJM A;  4AHW A;  1LKM A;  2IN3 A;  2C0F A;  4F03 A;  3U5R E;  1DUG A;  4RXN A;  3QDN A;  4BVY A;  2C8U A;  4XRD A;  3APO A;  2IWT A;  3SWL A;  1PX6 A;  4YH2 A;  2GT6 A;  4AJ8 A;  2CZ2 A;  1SK1 A;  4L0W A;  3FR9 A;  1QCV A;  4G0L A;  4BBS L;  4NHZ A;  1E2Y A;  5MGN A;  4A3I L;  2X8G A;  3FY7 A;  2K8S A;  2CT6 A;  4BL7 B;  4EDZ A;  1XWC A;  1HNC A;  5D9W A;  3A2X A;  4C3H L;  2IMI A;  1Z7P A;  3CYN A;  3SS2 A;  1NSW A;  4JE1 A;  5MF6 A;  4DSS B;  1MDI A;  4MP4 A;  1F4L A;  3LXZ A;  1SL2 B;  3MAK A;  2RII A;  4NV2 A;  2V1M A;  2YWN A;  4KAE A;  1Z6N A;  1SMU A;  3WWN B;  1JFU A;  3K8N A;  2RM5 A;  5DAK B;  5D9X A;  5CRW A;  2B5I D;  5AIX A;  3PKI A;  4XRA A;  4FQU A;  1SYR A;  2V3B B;  2DC5 A;  5IP9 L;  2HSY A;  1DSB A;  3QR6 A;  4KB3 A;  2C80 A;  2PMT A;  3DEX A;  2OAC A;  1VZH A;  1EGO A;  1T00 A;  5LCZ A;  5DAL A;  4A93 L;  2B1K A;  5DCH A;  4WR5 A;  4KW6 A;  3CSJ A;  5IQY A;  1C72 A;  3I6A A;  3IR4 A;  4EKZ A;  1O7U A;  1I5G A;  2X4A A;  1RQM A;  4RI6 A;  2KN9 A;  4TXO A;  4MZW A;  2KLX A;  2O87 A;  1R9T L;  5AN9 H;  1EEM A;  1J9B A;  4LL1 B;  1B4Q A;  3S9F A;  1T9O A;  3D21 A;  4XGH A;  2CX3 A;  2LS5 A;  1LJR A;  18GS A;  3P8W A;  2GS3 A;  4KCA A;  2H6Y A;  2GST A;  4QQ7 A;  1QXH A;  4NWY A;  4MF7 A;  4ZIJ A;  5IMV A;  4G9H A;  5ECN B;  1VGL A;  2FUG 2;  3ED3 A;  4N30 A;  2NVX L;  2FY6 A;  5D93 A;  2R0P A;  2DIZ A;  2ERS A;  3UJ1 A;  4UY8 1;  4KDX A;  1F2E A;  3TGZ A;  3UEM A;  1T1V A;  4NXI A;  1PSQ A;  2A6E D;  2YOI A;  1KTE A;  3VPQ A;  1K3L A;  2AB6 A;  1GSF A;  3GA4 A;  3B0A B;  3F4R A;  4GQC A;  1RW1 A;  2VCT A;  1YY7 A;  1JHB A;  1YJ6 A;  2I9H A;  2ZIX A;  5F05 A;  5D73 A;  2VM2 A;  3I9V 2;  4BY1 L;  1G6Y A;  1BE7 A;  3S14 L;  2PVQ A;  3FKI L;  3D0Z A;  3F4S A;  3KD0 A;  4O5R A;  3FZ5 A;  1LTL A;  1BYE A;  3C1S A;  2M4Y A;  2L4Q A;  4ZN1 B;  2B1L A;  3KXO A;  1O81 A;  3ZIJ A;  3CQZ L;  1GSD A;  2XJS A;  2F8F A;  2GDR A;  2WDU A;  4TXV A;  4HZ4 A;  6GSY A;  1FOH A;  4MPF A;  2KOK A;  1A8Y A;  3GTK L;  5A4V A;  4IP6 A;  2P5Q A;  3CTG A;  2C1Y A;  3I4N L;  5IMC A;  2VCV A;  4DSR A;  5G5F A;  4GQF A;  2XJR A;  1BFY A;  3RYG A;  4HDE A;  3CMI A;  4ECJ A;  1SD8 A;  5F0G A;  3WT1 A;  4TR0 A;  3J7Y 1;  1VF4 A;  2IMK A;  2V0F A;  3MPS A;  5JWQ B;  1SJ6 A;  3RPN A;  2FA4 A;  1SMM A;  5GZZ B;  2FWE A;  2XJV A;  5HFK A;  3GTJ L;  5GSS A;  4PTS A;  4GSS A;  4JR4 A;  4CY8 A;  4A3E L;  2XBQ A;  2H75 A;  1EGR A;  3VWX A;  5GST A;  3IK9 A;  2QC7 A;  4EUY A;  4JZQ A;  3KM6 A;  2YP6 A;  2PWJ A;  3CXG A;  5IMA A;  4V19 6;  4POK A;  1R26 A;  2YWM A;  4ZBA A;  3QD9 A;  4G6B A;  3GSS A;  2WB9 A;  4AI3 A;  5JVG 1;  2C3T A;  5EIN C;  2WUL A;  3F4T A;  1IU6 A;  1K0O A;  4RI7 A;  4KND A;  5MFP A;  4F9Z A;  1S2Z A;  1Z92 B;  2AYT A;  2DBC A;  1T9P A;  3HJM A;  4FYU A;  4JAE A;  3CSH A;  3IXR A;  2L59 A;  1PRX A;  1OYJ A;  3KIJ A;  2XPD A;  3F8U A;  4MJA A;  4O32 A;  1H4O A;  1AQX A;  3J7Y k;  1BJX A;  2MS3 A;  2V41 A;  5ECL B;  5LNK e;  3J7Y b;  1X0R A;  3PIP 1;  2RDV A;  4U67 1;  2IIY A;  3B08 B;  3HJW B;  1GTB A;  5ECQ B;  4C3J L;  3NOF A;  1PD2 1;  1XCC A;  4MZB A;  4LMW A;  4ULX A;  5AIS A;  3S17 L;  5EVO A;  2H1B A;  3S16 L;  3D22 A;  1O8W A;  2GSS A;  1X9M B;  2VL2 A;  3VFI A;  4IJ3 A;  3ZYW A;  2CAI A;  2QGV A;  3KEB A;  10GS A;  6GSU A;  3S1M L;  1TI3 A;  3DD3 A;  3HVN A;  4POF A;  1TJD A;  1SL0 B;  3KP8 A;  5COH A;  5HR1 A;  3GHA A;  4FH8 A;  4KSM A;  3DGQ A;  2FHE A;  1HNB A;  5GAH c;  1XWB A;  3LW9 A;  3KH7 A;  1PFW A;  2B3S A;  2F9S A;  4LA1 A;  2FA8 A;  1GL8 A;  2R0G A;  3LXT A;  4MNN A;  4KUN A;  4TW5 A;  3LWV B;  4D73 A;  5JCW A;  5ID2 B;  3PZA A;  3P8B A;  2ON7 A;  4X43 A;  5F07 A;  1OC3 A;  1R0F A;  6GSS A;  4X4J A;  4YKF A;  1G6W A;  1HNA A;  3TOU A;  4PQI A;  4BPY A;  4OO5 A;  1K0N A;  3MNG A;  2HR5 A;  2C0E A;  2H6Z A;  3MSU A;  1AW9 A;  1M2D A;  4OD7 A;  3F9U A;  2M6P A;  1GUK A;  4BVX B;  19GS A;  3FW2 A;  3CSI A;  1EV4 A;  1J08 A;  2WCI A;  4K2D A;  1ZMA A;  2ALB A;  3IHG A;  5CRG A;  5HR0 A;  4NPB A;  1VZG A;  2K2D A;  1HQO A;  5HQP A;  3MIX A;  2J9H A;  12GS A;  2G0F A;  2LRC A;  4PQH A;  2DJ0 A;  3WD6 A;  1TDI A;  5IM9 A;  3RZD L;  4KGI A;  5G31 A;  4A3L L;  2JSZ A;  4PNG A;  3PL5 A;  1RB9 A;  4OFN A;  4GCI A;  1GSS A;  2DKI A;  3P90 A;  3KZQ A;  1AIU A;  5IOX A;  2YAN A;  1OC9 B;  2GQL A;  2EC4 A;  3UAP A;  3HJY B;  1E6B A;  4A3F L;  2QKE A;  4YAV A;  1PGT A;  4WEY A;  2H70 A;  1WJV A;  1FHM A;  3ZTL A;  2CVK A;  3NZN A;  4V1A p;  1ZGN A;  4CDO A;  3GL3 A;  3H99 A;  5D96 A;  2LST A;  2DJ1 A;  3GX0 A;  2CKA A;  5EPF A;  4IP1 A;  3KYY A;  2NVY L;  1SL1 B;  4GTU A;  1OC8 A;  2FGX A;  3WGX A;  4CY6 A;  2QL0 A;  1TWC L;  3GL5 A;  3I43 A;  2C3N A;  4I2T A;  5JWR B;  2XHF A;  2A4H A;  2C6A A;  3L0H A;  4L8E A;  3PR8 A;  4IGJ A;  2VM1 A;  5AI2 A;  1TOF A;  4K2X A;  4MLY A;  3BCI A;  2L6C A;  5M5Y L;  3WGE A;  2FNO A;  2DJK A;  3ZVJ A;  1O73 A;  3EMX A;  2IPA A;  5C44 L;  3H4K A;  1GWC A;  2VOC A;  3UBK A;  1OKT A;  4AJ6 A;  4WF5 A;  1F3B A;  1T7P B;  5HFI A;  1AXD A;  1OE8 A;  4MCU A;  4ZN3 B;  2HZF A;  3PGT A;  4WR4 A;  1XIY A;  5A5K A;  3PIO 1;  3F63 A;  2LEG A;  2GSR A;  2ZUP A;  4LL4 B;  1JZD A;  2UZ8 A;  1SEN A;  3KJY A;  3K35 A;  1DBY A;  1S3R A;  1A8L A;  2VL3 A;  3GRX A;  1NXE A;  2HXK A;  3CRT A;  2IJY A;  2OJL A;  4I8B A;  4Z7X A;  4V2M A;  1V2A A;  4X6A L;  2JL4 A;  1MEK A;  4DSQ A;  2EIQ A;  3W8J A;  1UVZ A;  2PBJ A;  3L4N A;  3MYD A;  4MJC A;  4G10 A;  4OO4 A;  3GTG L;  3Q6O A;  2B5E A;  2HSH A;  2MMZ A;  3VUR A;  2H73 A;  4AHY A;  3CBU A;  2WRT A;  4FYC A;  2APO B;  2XJQ A;  3S2D L;  3H9B A;  3KYW A;  4EDY A;  2JZT A;  4XS1 A;  2IFQ A;  2L5L A;  2D2Z A;  1OVN A;  4K7N A;  2O89 A;  4B8C D;  3LOR A;  2KP1 A;  4BXX L;  6GST A;  1A24 A;  1K0M A;  4DVC A;  4YQV A;  2HRA A;  2J23 A;  3S15 L;  3DML A;  5FLM L;  2CKC A;  1QYB A;  2MBS A;  3UVT A;  2E2G A;  2C0G A;  2PU9 C;  3A5W A;  11GS A;  1SKR B;  5JVH 1;  2PYA A;  1LKO A;  4ZL9 A;  3ZRD A;  3EU4 A;  3TJG A;  3GX8 A;  9GSS A;  4WET A;  1SK0 A;  1ILO A;  2PSM C;  2H0G A;  4IJI A;  4KSO A;  5B8A A;  2V6O A;  2XJP A;  4IW9 A;  2JI1 A;  3C1R A;  4PNF A;  3VI7 A;  4V2L A;  1R0J A;  4AR4 A;  1ZZY A;  3N5O A;  4BY7 L;  4POB A;  3MWH A;  3APS A;  1MDJ A;  2H01 A;  5DVB A;  3MQK B;  4IS0 A;  4MPG A;  2RUE A;  5BRT A;  3H93 A;  1M0U A;  1F37 A;  3R2Q A;  2TIR A;  2A2S A;  4TR4 A;  3E0U A;  1TWG L;  3F6D A;  4MMM A;  4DEJ A;  4XS4 A;  1CQG A;  2N5B A;  1VRS D;  1TWF L;  1YKA A;  3GV1 A;  1KEB A;  4Z2R A;  5HR2 A;  3F6F A;  4ISD A;  4PUA A;  1K83 L;  4RQX A;  2C4J A;  1THO A;  1LBK A;  4LMV A;  2LQO A;  2H6X A;  3M9K A;  5DBQ A;  1TWH L;  3FEU A;  2GZZ A;  5H5Q A;  6GSW A;  1A23 A;  2AAW A;  3EVI A;  5G5E A;  5F8B A;  1T3B A;  1PFY A;  1P7P A;  2AYJ A;  1YV1 A;  1XWA A;  1TP9 A;  5J9B A;  1VF1 A;  3ERW A;  3KGK A;  4TR1 B;  6RXN A;  3KCM A;  2PVE A;  4TOP A;  1IYI A;  4POM A;  5FWG A;  2XPE A;  4AI2 A;  2YJ7 A;  2LNS A;  2P0G A;  2A69 D;  1EV9 A;  3EUR A;  1T8E B;  5H5S A;  5FJ8 L;  2A4V A;  4ACS A;  1X9W B;  4RQR A;  4IN0 A;  2H12 A;  5AIV A;  3HKZ P;  3ZML A;  4HSC X;  1ERV A;  4LHN A;  1SD9 A;  5DJL A;  5KEJ A;  2H1D A;  1TK8 B;  5IYB L;  4V2N A;  3M3M A;  2PN8 A;  4ZIL A;  2K9F A;  3KTB A;  5IY0 A;  1XW5 A;  4OCF A;  2X99 A;  5RXN A;  5ECK B;  5AN1 A;  1PN9 A;  1F3A A;  2YNX A;  3KMO A;  4LLR A;  1AC1 A;  3JR7 A;  5GAD c;  1XW6 A;  4HEA 2;  4K5R A;  1YUX A;  2OBK A;  2JI3 A;  1QFN A;  4FYB A;  1JZR A;  2VL6 A;  4F2I A;  3GTL L;  4YQU A;  1S30 A;  4PX1 A;  1PKZ A;  5J5N A;  1A2J A;  1XVW A;  2B5X A;  5IMZ A;  1V40 A;  1YKC A;  3LNL A;  5MLC 3;  2I81 A;  3QFB C;  2VCW A;  3M4O L;  5ECR B;  5M3M L;  3GTU B;  2GSQ A;  2JZS A;  4ZL8 A;  3ZG6 A;  1R7H A;  2OE3 A;  3LFL A;  3ERG A;  4USS A;  2DJ3 A;  1XOA A;  1THX A;  2L6D A;  3E9J B;  3EIN A;  3TRX A;  1WMJ A;  2LKU A;  5KN1 A;  3LG6 A;  1FHH A;  3PIN A;  2HRK A;  2IMF A;  1URM A;  3BOA A;  1O6J A;  3LJR A;  4MA9 A;  1LKP A;  5JWO B;  1BQ7 A;  1F6M C;  3IC8 A;  2AV4 A;  3OR5 A;  5G30 A;  4ML1 A;  2E7P A;  2NYD A;  1Z7R A;  4BIK A;  3DYR A;  3H8Q A;  1ACV A;  1YEX A;  3VPB E;  2H76 A;  2H30 A;  3ZFL A;  2PVX A;  1GNW A;  3HOZ L;  1KNG A;  1JLW A;  2DML A;  3PPU A;  2NVL A;  5G2Z A; 
#chains in the Genus database with same CATH homology
 2ON5 A;  2YN1 A;  3IU3 I;  1R0I A;  1WJK A;  3ZIV A;  1BG5 A;  1B4P A;  4MH2 A;  1A0F A;  4XTS A;  5ENU A;  4MH3 A;  4JBB A;  1XOB A;  3HVX A;  4PQ1 A;  1IW7 D;  5GAE c;  2H0I A;  3QAW A;  2QA1 A;  3ZZX A;  3IAM 2;  2HZE A;  2KP2 A;  1SKS B;  3VPT A;  2IME A;  2ES7 A;  1VCX A;  2LTK A;  4ZXG A;  3WWL A;  4HJM A;  3RPP A;  1GSQ A;  2HFD A;  5HR3 A;  2JZR A;  4MZC A;  1B9Y C;  3TKS E;  1B71 A;  2FWG A;  3Q74 A;  1H7V A;  2M80 A;  4WBJ A;  2RM6 A;  4KH7 A;  1OWC A;  5DQS A;  2X8H A;  3TUE A;  2CVB A;  4IKH A;  2I4A A;  1T4Y A;  5IO0 A;  1GLP A;  4ECC A;  3KMN A;  5C00 A;  1SJI A;  1OAZ A;  1V98 A;  5J4U A;  4NAX A;  1W89 A;  3KYX A;  3PH9 A;  1GUH A;  4BL7 A;  3TKP A;  2M72 A;  3HA9 A;  1BQ9 A;  1PL1 A;  3DWV A;  3GH9 A;  4NHW A;  2LJR A;  3GST A;  1I9D A;  1TRW A;  4MF6 A;  2GVP A;  4DSS A;  1A0R P;  5MFZ A;  1A2M A;  1HYU A;  4GS7 D;  4IHU A;  2E0Q A;  5DAK A;  3HZ4 A;  1G7E A;  4XHM A;  3A44 A;  4N0V A;  2WS2 A;  2A6H D;  1PN0 A;  1RDV A;  4BVY B;  2VL9 A;  3FK8 A;  1ODH A;  1ERT A;  2OAD A;  1WIK A;  2L5O A;  1YF0 A;  4PUF C;  4AF2 A;  1NHO A;  5EY6 A;  3N9J A;  1SU9 A;  4AR6 A;  4WXT A;  1TU7 A;  4MDC A;  2HNL A;  1DE2 A;  4ICY A;  1GNE A;  1IRN A;  5AI3 A;  1KBN A;  1CQH A;  2DJJ A;  3IV4 A;  3AY8 A;  1JZW A;  2KHP A;  4K7I A;  4KDU A;  4O5Q A;  1EOH A;  4AJ7 A;  2YJH A;  3RHB A;  3TKS C;  2VD1 A;  3HDC A;  3W8S A;  1BAY A;  1PX7 A;  5CP1 A;  3A3T A;  1ERU A;  13GS A;  1IYH A;  5D8I A;  4F0B A;  2LV3 A;  3F0I A;  2CVD A;  3TDG A;  2JU5 A;  2AUV A;  3ZLP A;  2GZY A;  4NMU A;  4N10 A;  1XBS A;  4HOJ A;  6GSV A;  4KA0 A;  1Z5Y E;  5IOW A;  1AQW A;  2EIR A;  3GKM A;  3HD5 A;  3TJB A;  3BCK A;  5DAL B;  3M0F A;  4BWQ A;  2RLI A;  3GFK A;  1Y6E A;  2LJA A;  3L9V A;  4P3Y B;  3UIW A;  1G0T A;  5JCG A;  4TKY A;  1U88 A;  1ML6 A;  2X64 A;  1GH2 A;  4ILF A;  2K18 A;  2LQQ A;  1S24 A;  4TXO B;  4J56 E;  1TI1 A;  4N0Z A;  2FD3 A;  2DIY A;  4J57 E;  3ZRE A;  4MJB A;  1PMT A;  2K6V A;  1YQ1 A;  1M2A A;  4MJE A;  2X8C A;  4ZB9 A;  2YZU A;  5GAG c;  1TU8 A;  2LRN A;  3L78 A;  1GSE A;  3ME7 A;  1M2B A;  3EWL A;  2DKH A;  1B13 A;  1RWD A;  1K0C A;  4TN8 A;  1QGV A;  3VWU A;  5AGY A;  2HSM A;  2R0C A;  1YEP A;  1DVB A;  1ZCP A;  1T4Z A;  1V9W A;  3R3E A;  3TKQ A;  4I5Q A;  1FVJ A;  1TXX A;  3UBL A;  2BTO T;  2H66 A;  1CAA A;  2VD0 A;  3MSZ A;  3ZVJ D;  4MAB A;  1EEJ A;  1W4V A;  20GS A;  5ELG A;  2V32 A;  2HT9 A;  2YV9 A;  3ISO A;  4ZB6 A;  3H79 A;  4AI1 A;  4Q5F A;  1ZL9 A;  1YDK A;  4QL7 A;  2E2M A;  5IO2 A;  1K0D A;  5D9T A;  5KOX A;  1WOU A;  2B5Y A;  3FR3 A;  4ZL7 A;  5ECH B;  4ECI A;  4IQ1 A;  3IHQ A;  3HVV A;  4JAD A;  3CTF A;  4ID0 A;  4POG A;  2N5A A;  1QK8 A;  2HRN A;  3MDK A;  2VLT A;  4KCE A;  2PGT A;  4Z2U A;  3KH9 A;  1HD2 A;  2B6M A;  2MBT A;  2CQ9 A;  4HU9 A;  4I6X A;  1YF1 A;  1BQ8 A;  3UAR A;  1VF3 A;  3GIX A;  3RAZ A;  3A2V A;  1GTI A;  1R0G A;  3KYU A;  5IPG A;  3DIE A;  4AHX A;  1GP1 A;  2AHE A;  4I97 A;  4AR3 A;  3O6T A;  4ZB8 A;  4I2U A;  1U3I A;  2O5J D;  3TJF A;  2MMA A;  2EIO A;  6GSX A;  4EF0 A;  4PXO A;  2OE1 A;  1B48 A;  2FLS A;  4HQS A;  1H75 A;  3M1G A;  3GN3 A;  1WWJ A;  1EP7 A;  4Q5Q A;  4G2E A;  2J9U B;  1NXG A;  2YV7 A;  1K3O A;  2REM A;  1BED A;  2P31 A;  1ZYQ B;  2VUP A;  1M9A A;  4WF4 A;  1X5C A;  2H1A A;  2PUK C;  4EC0 A;  2K8V A;  4AGS A;  3U6V A;  1MDK A;  1S3C A;  3HKR A;  1YZX A;  3ZIT A;  1GTU A;  2M4V A;  4AHZ A;  3UL3 A;  1ZOF A;  4AI0 A;  3QPM A;  5EIO C;  3EE2 A;  3GNJ A;  3C7M A;  4GLT A;  1GRX A;  1WE0 A;  1NNQ A;  2R2J A;  2HE3 A;  1PL2 A;  2L0Z A;  3EMP A;  3IA1 A;  1TKD B;  3TRP A;  4MF5 A;  2L4C A;  4ZBD A;  1MD3 A;  1R4W A;  4JRR A;  2DMM A;  5ID2 A;  5A4W A;  5G1K A;  4J2F A;  3TRQ A;  1SKW B;  5CRH A;  3HJO A;  1SMW A;  2VLV A;  8GSS A;  2VCZ A;  4G0K A;  1GTA A;  4O5U A;  4YKG A;  2Z3Q B;  3HY2 A;  1M9B A;  4XXB B;  2H8L A;  3LGC A;  3O76 A;  3M8N A;  3FZ4 A;  1AUC A;  1FO5 A;  2CV4 A;  4O92 A;  3KTL A;  4EIQ A;  4BVX A;  2OKA A;  4HU7 A;  2LCQ A;  2ERJ A;  1XXU A;  4LHL A;  1PKW A;  3FYG A;  2O8V B;  5DM7 1;  3HVS A;  1VZI A;  4IEL A;  4WBR D;  3V1W A;  1XFL A;  1ERW A;  1R5A A;  1IU5 A;  3QCP A;  3KYV A;  2XJU A;  4NV5 A;  2BJX A;  2YCD A;  3HZ8 A;  4KE3 A;  3LYK A;  1Z9H A;  5EL8 A;  3C71 A;  1YK5 A;  1F9M A;  2NDO A;  1OE7 A;  1JZO A;  3A2W A;  4FO5 A;  4OCE A;  4D73 B;  3UVH A;  1R0H A;  2F8A A;  3DKS A;  1TRS A;  4K8M A;  2CX4 A;  1XWK A;  3IRA A;  4EO3 A;  2R5G A;  4K1F A;  1JLV A;  4JU5 A;  1OC9 A;  3DRN A;  3LEF A;  5KN0 A;  2QA2 A;  1FB0 A;  1SYX A;  2FWH A;  4K6X A;  2V0E A;  3WGD A;  2A68 D;  5J9C A;  3EPT A;  2LRT A;  1RYT A;  1VF2 A;  1LU4 A;  5CAX A;  3VWW A;  2H72 A;  3M9J A;  1FW1 A;  1K3Y A;  5CRE A;  3FRC A;  3TB2 A;  3HXS A;  5B6M A;  2NTO A;  2MMO A;  3EU3 A;  4F82 A;  5CO3 A;  2MZC A;  1BX9 A;  5B7C A;  2OE0 A;  1GLQ A;  3QAV A;  3FMW A;  2A2P A;  3KP9 A;  2G2Q A;  2X49 A;  1NM3 A;  3G7Y A;  1ZRP A;  1FG4 A;  2XJT A;  2CR8 A;  2KKD A;  2YPM A;  3G9B A;  1OKD A;  3ZL5 A;  3TOT A;  4K9Z A;  4YAP A;  1TK5 B;  5KN2 A;  2GZP A;  3C8E A;  1M7T A;  3RZ6 A;  4GXZ A;  1ST9 A;  1B2O A;  2C6B A;  2M6O A;  3IBH A;  4MK3 A;  5GAP D;  4L0U A;  3G7I A;  4HI7 A;  3FR6 A;  2L57 A;  3DVX A;  4GST A;  1T9Q A;  4L5L A;  1XPV A;  4TR3 A;  3QFA C;  5B6N A;  5HFG A;  4E8E A;  1USB A;  3HCZ A;  2JAC A;  3LPE B;  1EP8 A;  2H19 A;  5A4U A;  2VO4 A;  3VK9 A;  3IDV A;  3TKS A;  2GTU A;  2XC2 A;  5E59 A;  3D4M A;  2YWO A;  7GSS A;  1B2J A;  1YK4 A;  1BRF A;  2PPT A;  4K0N A;  2OA7 A;  2YZH A;  3VLN A;  5CNW A;  3LSZ A;  1FOV A;  2LJK A;  1CAD A;  4CW9 A;  3GKN A;  1N2A A;  5K2M E;  1RYQ A;  1ABA A;  2ZNM A;  3US3 A;  4TRX A;  2BMX A;  5IMD A;  1FAA A;  2O7K A;  1WP0 A;  1OWB A;  1RDG A;  4ECB A;  1Y25 A;  3A5I A;  3P2A A;  4PUR A;  2DSA A;  4GSN A;  3F3R A;  4YWL A;  4BA7 A;  3BBY A;  1B8X A;  4ML6 A;  17GS A;  3EYT A;  2R37 A;  5E4W A;  3NIV A;  1AAZ A;  3O3T A;  5IIZ A;  1J0F A;  1RK4 A;  3HHV A;  5J3R A;  3I69 A;  3P7X A;  3IC4 A;  2AJQ B;  2CA8 A;  4G0I A;  3LQ7 A;  1TK0 B;  2DSX A;  4AR5 A;  2NPB A;  4K9F A;  3RBT A;  5FHI A;  4TVE A;  2RUF A;  3HYP A;  3W6G A;  5ECO B;  3FHK A;  3RHC A;  5INY A;  2IFQ B;  5LD0 A;  2VLU A;  7RXN A;  1GUL A;  2H1G A;  14GS A;  3QAG A;  2VCQ A;  4KF9 A;  3C73 A;  3UOM A;  2Z3R B;  1TTZ A;  2P5R A;  3HJP A;  4EVM A;  3TJK A;  2MYG A;  1XVQ A;  1WRY A;  5C04 A;  3G7J A;  4E6Y A;  4WKW A;  3TCO A;  2GMG A;  1V57 A;  1TRU A;  3JCM L;  4X1U A;  3CRU A;  2DJ2 A;  1NW2 A;  2JSY A;  2NBS A;  4F0C A;  3ERF A;  1Q98 A;  1C09 A;  3IAS 2;  3J7Z 1;  2F51 A;  3GH6 A;  4XIH A;  4TR1 A;  2C3Q A;  5ECS A;  4OFT A;  1GSU A;  2H74 A;  4JAG A;  4JR6 A;  3BJ5 A;  4K7O A;  5G1L A;  2HYX A;  1UA5 A;  3EC3 A;  3H1N A;  3RZT A;  2H71 A;  1QQ2 A;  1XZO A;  1M99 A;  1ZYP A;  4YQM A;  1A2L A;  1FB6 A;  1R5P A;  3PWF A;  3LWA A;  3GUR A;  1DX8 A;  2QSI A;  2FWF A;  1X5D A;  4XCS A;  22GS A;  4XS4 B;  4BWS A;  2VAF A;  4EXJ A;  4OWY A;  5B8B A;  3DVW A;  3LYP A;  1E8J A;  3Q18 A;  2WGR A;  5GAN D;  5DCG A;  3ME8 A;  2IL3 A;  2BE5 D;  2O85 A;  4Q5R A;  4GRF A;  1GUM A;  2F3M A;  3DXB A;  3NFP I;  5CYY A;  4JED A;  1K0A A;  5ECP B;  3BD2 A;  5JCU A;  2PVO C;  4RUV A;  5L71 A;  1DE1 A;  5IPH A;  1Z3E A;  2DLX A;  4IVF A;  2HRF A;  2Z9S A;  1TW9 A;  2V6K A;  5IMF A;  4H86 A;  3QMX A;  4FIW A;  4JAF A;  4CHS A;  2OBI A;  3ZFB A;  2CZ3 A;  3IE3 A;  3GTU A;  2PER A;  1QMV A;  3QOU A;  1X5E A;  4V1A g;  2IMD A;  3WT2 A;  1TRV A;  2B7J A;  4QL9 A;  2TRX A;  1G7O A;  5FT3 A;  1MD4 A;  2HI7 A;  2H0H A;  3PKJ A;  4TVM A;  4TPU A;  2HLS A;  3APQ A;  2JI2 A;  1FHE A;  4HZ2 A;  3FZA A;  4ZBB A;  1Q4J A;  4IQA A;  1X9S B;  1V58 A;  5J41 A;  1UN2 A;  5H5R A;  4EIP A;  3WYW A;  4WFN 1;  3ZMK A;  5KN3 A;  1SJZ A;  2VCX A;  4GWR A;  3L9U A;  5ABR A;  3RDW A;  3UMA A;  3FZ9 A;  5F06 A;  4HUA A;  2LNT A;  1O8X A;  1WPI A;  3GUS A;  1AQV A;  1EWX A;  4PGT A;  2XBI A;  4XS6 A;  1NHY A;  4ME3 A;  1IRO A;  1PA3 A;  2MMN A;  2YWI A;  2JAD A;  3QQC E;  3D5J A;  2FCH A;  3IK7 A;  1QUW A;  1S3A A;  1XW9 A;  1Z6M A;  2B7K A;  2VIM A;  1B9X C;  1ON4 A;  3E3E A;  5DM6 1;  1ZYN A;  3GKK A;  4Q5N A;  2GGT A;  4OMV A;  2WZ9 A;  1FVK A;  5ELA A;  2R6K A;  2WFC A;  2A2R A;  4E8H A;  3Q19 A;  4K0G A;  4L5O A;  2GT5 A;  1GSY A;  2GQK A;  4EL1 A;  1EZK A;  2M46 A;  16GS A;  4EE0 A;  4POL A;  2KUC A;  2VL2 C;  3FKF A;  3VI5 A;  3F3Q A;  4IBP A;  4KDY A;  1S3D A;  2ZCT A;  1U6T A;  4GF0 A;  3D6I A;  1U3A A;  2TRC P;  4A5P A;  5DQY A;  4Z2T A;  4K5S A;  5CRD A;  5H1S c;  3IPZ A;  1XWG A;  2N5F A;  3GMF A;  1U87 A;  2LUS A;  3GYK A;  3L9S A;  5DDL A;  5ECM B;  4N11 A;  1EOG A;  4HS1 A;  4YWM A;  4KX4 A;  1K0B A;  3GKX A;  1UC7 A;  2R4V A;  4OFM A;  4G19 A;  4HQZ A;  2C0D A;  2GLR A;  2CAQ A;  2I3Y A;  2V2G A;  3VWV A;  1SK2 A;  1JYB A;  2WJU A;  2I1U A;  3D4T A;  3TJJ A;  5D9V A;  2HZE B;  1N8J A;  5ECI B;  8RXN A;  1ZYE A;  2GQM A;  4X0X A;  4O7H A;  1YUZ A;  3TKR A;  3IOS A;  3SBC A;  5KOW A;  1PQN A;  1O85 A;  2R3X A;  1MTC A;  3QVD A;  5BMU A;  4HJ2 A;  5DJM A;  4AHW A;  1LKM A;  2IN3 A;  2C0F A;  4F03 A;  3U5R E;  1DUG A;  4RXN A;  3QDN A;  4BVY A;  2C8U A;  4XRD A;  3APO A;  2IWT A;  3SWL A;  1PX6 A;  4YH2 A;  2GT6 A;  4AJ8 A;  2CZ2 A;  1SK1 A;  4L0W A;  3FR9 A;  1QCV A;  4G0L A;  4NHZ A;  1E2Y A;  5MGN A;  2X8G A;  3FY7 A;  2K8S A;  2CT6 A;  4BL7 B;  4EDZ A;  1XWC A;  1HNC A;  5D9W A;  3A2X A;  2IMI A;  1Z7P A;  3CYN A;  3SS2 A;  1NSW A;  4JE1 A;  5MF6 A;  4DSS B;  1MDI A;  4MP4 A;  3LXZ A;  1SL2 B;  3MAK A;  2RII A;  4NV2 A;  2V1M A;  2YWN A;  4KAE A;  1Z6N A;  1SMU A;  3WWN B;  1JFU A;  3K8N A;  2RM5 A;  5DAK B;  5D9X A;  5CRW A;  2B5I D;  5AIX A;  3PKI A;  4XRA A;  4FQU A;  1SYR A;  2V3B B;  2DC5 A;  2HSY A;  1DSB A;  3QR6 A;  4KB3 A;  2C80 A;  2PMT A;  3DEX A;  2OAC A;  1VZH A;  1EGO A;  1T00 A;  5LCZ A;  5DAL A;  2B1K A;  5DCH A;  4WR5 A;  4KW6 A;  3CSJ A;  5IQY A;  1C72 A;  3I6A A;  3IR4 A;  4EKZ A;  1O7U A;  1I5G A;  2X4A A;  1RQM A;  4RI6 A;  2KN9 A;  4TXO A;  4MZW A;  2KLX A;  2O87 A;  5AN9 H;  1EEM A;  1J9B A;  4LL1 B;  1B4Q A;  3S9F A;  1T9O A;  3D21 A;  4XGH A;  2CX3 A;  2LS5 A;  1LJR A;  18GS A;  3P8W A;  2GS3 A;  4KCA A;  2H6Y A;  2GST A;  4QQ7 A;  1QXH A;  4NWY A;  4MF7 A;  4ZIJ A;  5IMV A;  4G9H A;  5ECN B;  1VGL A;  2FUG 2;  3ED3 A;  4N30 A;  2FY6 A;  5D93 A;  2R0P A;  2DIZ A;  2ERS A;  3UJ1 A;  4UY8 1;  4KDX A;  1F2E A;  3TGZ A;  3UEM A;  1T1V A;  4NXI A;  1PSQ A;  2A6E D;  2YOI A;  1KTE A;  3VPQ A;  1K3L A;  2AB6 A;  1GSF A;  3GA4 A;  3B0A B;  3F4R A;  4GQC A;  1RW1 A;  2VCT A;  1YY7 A;  1JHB A;  1YJ6 A;  2I9H A;  2ZIX A;  5F05 A;  5D73 A;  2VM2 A;  3I9V 2;  1G6Y A;  1BE7 A;  2PVQ A;  3D0Z A;  3F4S A;  3KD0 A;  4O5R A;  3FZ5 A;  1LTL A;  1BYE A;  3C1S A;  2M4Y A;  2L4Q A;  4ZN1 B;  2B1L A;  3KXO A;  1O81 A;  3ZIJ A;  1GSD A;  2XJS A;  2F8F A;  2GDR A;  2WDU A;  4TXV A;  4HZ4 A;  6GSY A;  1FOH A;  4MPF A;  2KOK A;  1A8Y A;  5A4V A;  4IP6 A;  2P5Q A;  3CTG A;  2C1Y A;  5IMC A;  2VCV A;  4DSR A;  5G5F A;  4GQF A;  2XJR A;  1BFY A;  3RYG A;  4HDE A;  3CMI A;  4ECJ A;  1SD8 A;  5F0G A;  3WT1 A;  4TR0 A;  3J7Y 1;  1VF4 A;  2IMK A;  2V0F A;  3MPS A;  5JWQ B;  1SJ6 A;  3RPN A;  2FA4 A;  1SMM A;  5GZZ B;  2FWE A;  2XJV A;  5HFK A;  5GSS A;  4PTS A;  4GSS A;  4JR4 A;  4CY8 A;  2XBQ A;  2H75 A;  1EGR A;  3VWX A;  5GST A;  3IK9 A;  2QC7 A;  4EUY A;  4JZQ A;  3KM6 A;  2YP6 A;  2PWJ A;  3CXG A;  5IMA A;  4V19 6;  4POK A;  1R26 A;  2YWM A;  4ZBA A;  3QD9 A;  4G6B A;  3GSS A;  2WB9 A;  4AI3 A;  5JVG 1;  2C3T A;  5EIN C;  2WUL A;  3F4T A;  1IU6 A;  1K0O A;  4RI7 A;  4KND A;  5MFP A;  4F9Z A;  1S2Z A;  1Z92 B;  2AYT A;  2DBC A;  1T9P A;  3HJM A;  4FYU A;  4JAE A;  3CSH A;  3IXR A;  2L59 A;  1PRX A;  1OYJ A;  3KIJ A;  2XPD A;  3F8U A;  4MJA A;  4O32 A;  1H4O A;  1AQX A;  3J7Y k;  1BJX A;  2MS3 A;  2V41 A;  5ECL B;  5LNK e;  3J7Y b;  1X0R A;  3PIP 1;  2RDV A;  4U67 1;  2IIY A;  3B08 B;  1GTB A;  5ECQ B;  3NOF A;  1PD2 1;  1XCC A;  4MZB A;  4LMW A;  4ULX A;  5AIS A;  5EVO A;  2H1B A;  3D22 A;  1O8W A;  2GSS A;  1X9M B;  2VL2 A;  3VFI A;  4IJ3 A;  3ZYW A;  2CAI A;  2QGV A;  3KEB A;  10GS A;  6GSU A;  1TI3 A;  3DD3 A;  4POF A;  1TJD A;  1SL0 B;  3KP8 A;  5COH A;  5HR1 A;  3GHA A;  4FH8 A;  4KSM A;  3DGQ A;  2FHE A;  1HNB A;  5GAH c;  1XWB A;  3LW9 A;  3KH7 A;  2B3S A;  2F9S A;  4LA1 A;  2FA8 A;  1GL8 A;  2R0G A;  3LXT A;  4MNN A;  4KUN A;  4TW5 A;  4D73 A;  5JCW A;  5ID2 B;  3PZA A;  3P8B A;  2ON7 A;  4X43 A;  5F07 A;  1OC3 A;  1R0F A;  6GSS A;  4X4J A;  4YKF A;  1G6W A;  1HNA A;  3TOU A;  4PQI A;  4BPY A;  4OO5 A;  1K0N A;  3MNG A;  2HR5 A;  2C0E A;  2H6Z A;  3MSU A;  1AW9 A;  1M2D A;  4OD7 A;  3F9U A;  2M6P A;  1GUK A;  4BVX B;  19GS A;  3FW2 A;  3CSI A;  1EV4 A;  1J08 A;  2WCI A;  4K2D A;  1ZMA A;  2ALB A;  3IHG A;  5CRG A;  5HR0 A;  4NPB A;  1VZG A;  2K2D A;  1HQO A;  5HQP A;  3MIX A;  2J9H A;  12GS A;  2G0F A;  2LRC A;  4PQH A;  2DJ0 A;  3WD6 A;  1TDI A;  5IM9 A;  4KGI A;  5G31 A;  2JSZ A;  4PNG A;  1RB9 A;  4OFN A;  4GCI A;  1GSS A;  2DKI A;  3P90 A;  3KZQ A;  1AIU A;  5IOX A;  2YAN A;  1OC9 B;  2GQL A;  2EC4 A;  3UAP A;  1E6B A;  2QKE A;  4YAV A;  1PGT A;  4WEY A;  2H70 A;  1WJV A;  1FHM A;  3ZTL A;  2CVK A;  3NZN A;  4V1A p;  1ZGN A;  4CDO A;  3GL3 A;  5D96 A;  2LST A;  2DJ1 A;  3GX0 A;  2CKA A;  5EPF A;  4IP1 A;  3KYY A;  1SL1 B;  4GTU A;  1OC8 A;  2FGX A;  3WGX A;  4CY6 A;  2QL0 A;  3I43 A;  3GL5 A;  2C3N A;  4I2T A;  5JWR B;  2XHF A;  2A4H A;  2C6A A;  3L0H A;  4L8E A;  3PR8 A;  4IGJ A;  2VM1 A;  5AI2 A;  1TOF A;  4K2X A;  4MLY A;  3BCI A;  2L6C A;  3WGE A;  2FNO A;  2DJK A;  3ZVJ A;  1O73 A;  3EMX A;  2IPA A;  3H4K A;  1GWC A;  2VOC A;  3UBK A;  1OKT A;  4AJ6 A;  4WF5 A;  1F3B A;  1T7P B;  5HFI A;  1AXD A;  1OE8 A;  4MCU A;  4ZN3 B;  2HZF A;  3PGT A;  4WR4 A;  1XIY A;  5A5K A;  3PIO 1;  3F63 A;  2LEG A;  2GSR A;  2ZUP A;  4LL4 B;  1JZD A;  2UZ8 A;  1SEN A;  3KJY A;  3K35 A;  1DBY A;  1A8L A;  2VL3 A;  3GRX A;  1NXE A;  2HXK A;  3CRT A;  2IJY A;  2OJL A;  4I8B A;  4Z7X A;  4V2M A;  1V2A A;  2JL4 A;  1MEK A;  4DSQ A;  2EIQ A;  3W8J A;  1UVZ A;  2PBJ A;  3L4N A;  3MYD A;  4MJC A;  4G10 A;  4OO4 A;  3Q6O A;  2B5E A;  2HSH A;  2MMZ A;  3VUR A;  2H73 A;  4AHY A;  3CBU A;  2WRT A;  4FYC A;  2XJQ A;  3KYW A;  4EDY A;  2JZT A;  4XS1 A;  2IFQ A;  2L5L A;  2D2Z A;  1OVN A;  4K7N A;  2O89 A;  4B8C D;  3LOR A;  2KP1 A;  6GST A;  1A24 A;  1K0M A;  4DVC A;  4YQV A;  2HRA A;  2J23 A;  3DML A;  2CKC A;  1QYB A;  2MBS A;  3UVT A;  2E2G A;  2C0G A;  2PU9 C;  3A5W A;  11GS A;  1SKR B;  5JVH 1;  2PYA A;  1LKO A;  4ZL9 A;  3ZRD A;  3EU4 A;  3TJG A;  3GX8 A;  9GSS A;  4WET A;  1SK0 A;  1ILO A;  2PSM C;  2H0G A;  4IJI A;  4KSO A;  5B8A A;  2V6O A;  2XJP A;  4IW9 A;  2JI1 A;  3C1R A;  4PNF A;  3VI7 A;  4V2L A;  1R0J A;  4AR4 A;  1ZZY A;  3N5O A;  4POB A;  3MWH A;  3APS A;  1MDJ A;  2H01 A;  5DVB A;  4IS0 A;  4MPG A;  2RUE A;  5BRT A;  3H93 A;  1M0U A;  1F37 A;  3R2Q A;  2TIR A;  2A2S A;  4TR4 A;  3E0U A;  3F6D A;  4MMM A;  4DEJ A;  4XS4 A;  1CQG A;  2N5B A;  1VRS D;  1YKA A;  3GV1 A;  1KEB A;  4Z2R A;  5HR2 A;  3F6F A;  4ISD A;  4PUA A;  4RQX A;  2C4J A;  1THO A;  1LBK A;  4LMV A;  2LQO A;  2H6X A;  3M9K A;  5DBQ A;  3FEU A;  2GZZ A;  5H5Q A;  6GSW A;  1A23 A;  2AAW A;  3EVI A;  5G5E A;  5F8B A;  1T3B A;  2AYJ A;  1YV1 A;  1XWA A;  1TP9 A;  5J9B A;  1VF1 A;  3ERW A;  3KGK A;  4TR1 B;  6RXN A;  3KCM A;  2PVE A;  4TOP A;  1IYI A;  4POM A;  5FWG A;  2XPE A;  4AI2 A;  2YJ7 A;  2LNS A;  2P0G A;  2A69 D;  1EV9 A;  3EUR A;  1T8E B;  5H5S A;  2A4V A;  4ACS A;  1X9W B;  4RQR A;  4IN0 A;  2H12 A;  5AIV A;  3ZML A;  1ERV A;  4LHN A;  1SD9 A;  5DJL A;  5KEJ A;  2H1D A;  1TK8 B;  4V2N A;  3M3M A;  2PN8 A;  4ZIL A;  2K9F A;  3KTB A;  5IY0 A;  1XW5 A;  4OCF A;  2X99 A;  5RXN A;  5ECK B;  5AN1 A;  1PN9 A;  1F3A A;  2YNX A;  3KMO A;  4LLR A;  1AC1 A;  5GAD c;  1XW6 A;  4HEA 2;  4K5R A;  1YUX A;  2OBK A;  2JI3 A;  1QFN A;  4FYB A;  1JZR A;  2VL6 A;  4F2I A;  4YQU A;  1S30 A;  4PX1 A;  1PKZ A;  5J5N A;  1A2J A;  1XVW A;  2B5X A;  5IMZ A;  1V40 A;  1YKC A;  3LNL A;  5MLC 3;  2I81 A;  3QFB C;  2VCW A;  5ECR B;  3GTU B;  2GSQ A;  2JZS A;  4ZL8 A;  3ZG6 A;  1R7H A;  2OE3 A;  3LFL A;  3ERG A;  4USS A;  2DJ3 A;  1XOA A;  1THX A;  2L6D A;  3E9J B;  3EIN A;  3TRX A;  1WMJ A;  2LKU A;  5KN1 A;  3LG6 A;  1FHH A;  3PIN A;  2HRK A;  2IMF A;  1URM A;  3BOA A;  1O6J A;  3LJR A;  4MA9 A;  1LKP A;  5JWO B;  1BQ7 A;  1F6M C;  3IC8 A;  2AV4 A;  3OR5 A;  5G30 A;  4ML1 A;  2E7P A;  2NYD A;  1Z7R A;  3DYR A;  3H8Q A;  1ACV A;  1YEX A;  3VPB E;  2H76 A;  2H30 A;  3ZFL A;  2PVX A;  1GNW A;  1KNG A;  1JLW A;  2DML A;  3PPU A;  2NVL A;  5G2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...