2PPTA

Crystal structure of thioredoxin-2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
149
structure length
149
Chain Sequence
b'MMGAKMAESLRLTCLACGQANKVPSDRLAAGPKCGICGAGLITGKVAGIDPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin-2
publication title Crystal Structure of thioredoxin-2
rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 39
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2007-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.140 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2pptA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pptA02
2ALBA 1K0MA 4KCAA 4K6XA 4PQIA 2K8SA 2KHPA 1ABAA 1O6JA 4POMA 4EO3A 4YAPA 1XWGA 2PWJA 4HEA2 1O8WA 4EVMA 3TOTA 3C7MA 3RDWA 1JZDA 1XXUA 2RUFA 1MTCA 5G1LA 4WEYA 2LNTA 3H79A 2PBJA 1A24A 2C3NA 1K3OA 3RBTA 2VUPA 3RHBA 4MZWA 3PINA 1JZWA 1K3YA 2WZ9A 3FR3A 2F8AA 3A3TA 1XWKA 1YKCA 4PURA 1GUKA 3FRCA 4BPYA 1V9WA 4HU9A 2QGVA 2YV7A 1KNGA 3C71A 4IW9A 4L5OA 4BVYA 3UJ1A 2VL3A 1Z5YE 5ECQB 2X99A 1FB6A 2X64A 3KIJA 2MZCA 4J56E 4D73B 2H1GA 1AUCA 2LKUA 4X43A 4L0UA 2K9FA 4IP1A 1UC7A 5DBQA 1RK4A 1NHOA 1A8YA 4IHUA 3HVSA 3LXZA 2LEGA 2FWFA 1UVZA 3D4TA 3TJGA 3FR6A 3EWLA 2ON5A 4LMWA 3J7Yk 2V32A 1GSEA 1R5AA 3TOUA 1ZCPA 5IMVA 3EINA 1XPVA 1GSSA 1ZOFA 4G10A 5JCWA 3F6DA 2BMXA 4KGIA 1XCCA 1B8XA 5AN1A 3HXSA 1QFNA 5CAXA 3G7IA 3HA9A 4ZL9A 5IO2A 2HXKA 2OADA 1XWCA 3ERFA 5HR1A 2H71A 5KN1A 3HJMA 5LCZA 1SK1A 2F51A 1V57A 3F3RA 2I4AA 3ZIVA 1SD8A 4JR4A 4KB3A 3TKPA 1M99A 4AJ8A 2XBQA 1TRUA 4FO5A 4RI7A 2XC2A 3BBYA 18GSA 1GUMA 5B8AA 3EVIA 4EL1A 2IJYA 5LNKe 4TN8A 2M72A 3FZ4A 3GTUB 5ECSA 4KX4A 5H5RA 3SBCA 4POLA 3F4SA 4ZIJA 5HR3A 3BCKA 2DSAA 13GSA 3CTFA 1ZGNA 4I5QA 1QGVA 1U3IA 4XCSA 3KZQA 2R2JA 5IMZA 2K8VA 4BWQA 4TR1B 2VLTA 5ECIB 2H0IA 4JR6A 2X8CA 2ZNMA 3GHAA 1BG5A 3KM6A 3RAZA 4LLRA 1ILOA 3L9UA 2V2GA 3TRPA 1ACVA 3L4NA 2C0FA 3ME8A 4PNGA 2H01A 4F03A 3D4MA 2BJXA 1ON4A 6GSYA 3KMNA 5G5EA 1GLPA 3L0HA 1EEMA 5ECHB 2C80A 2LQQA 3HCZA 4IS0A 3CRTA 4ECIA 4LL4B 2B3SA 1TJDA 2DJ2A 3I69A 1S3DA 2PGTA 2I81A 3LWAA 1PGTA 3HVXA 3TJJA 1WOUA 3HZ8A 3FZ9A 4OO4A 3GKMA 2DJ3A 2WULA 4V1Ag 12GSA 3DWVA 3BD2A 3Q18A 4TKYA 2WCIA 2YZHA 4JZQA 1XVWA 1Y6EA 2H74A 5G5FA 3I6AA 2VL9A 1R4WA 2C6BA 5D9VA 3VWVA 4IVFA 2M80A 2A4VA 3C1SA 2PVQA 2GZZA 2GT6A 3KCMA 4XIHA 3CMIA 3HVVA 1TU7A 4CW9A 2FNOA 1DE2A 3TCOA 3IDVA 1KBNA 4MCUA 2O8VB 2EIQA 1TK5B 3IAM2 3M9JA 4I2UA 3DKSA 3SWLA 1MDJA 2PUKC 4EXJA 3CTGA 3VWWA 1Q98A 3QFAC 2B5YA 2YWIA 4K7IA 1GNEA 1TU8A 2H19A 3HY2A 1V98A 3UAPA 1Z3EA 3GH9A 2DLXA 1DUGA 2FY6A 3QAGA 2R37A 1SENA 1GTBA 2A2RA 9GSSA 2F9SA 4Q5RA 4GXZA 3UL3A 1F6MC 3QOUA 1FVKA 3EMPA 5C04A 2JU5A 3LG6A 4L0WA 1FO5A 1GP1A 1GTUA 2O89A 2VO4A 1AC1A 1A2MA 3KJYA 3RHCA 3UMAA 3ZVJD 2MBSA 4V2NA 3IHQA 4ZXGA 1FG4A 3I9V2 4AF2A 3F4RA 4LL1B 1GSUA 5DALA 3DMLA 1XWAA 2GSSA 1MDKA 3C1RA 1EV4A 2B1KA 2VCXA 2I1UA 2L4CA 3GX0A 4FYUA 1GSQA 2H75A 1F37A 1X9SB 4TOPA 1B9YC 1GH2A 4E8EA 2XPEA 2LQOA 3MNGA 3TUEA 1UA5A 2VM2A 4IKHA 5IPHA 1R7HA 2HZFA 1O8XA 5IMAA 1XW5A 3IV4A 3HJOA 5AGYA 1SJIA 5ABRA 1FHEA 2CVBA 3M0FA 4NV5A 1OC3A 2B1LA 4V2MA 3FYGA 3VPTA 5JWOB 4LA1A 5A4WA 1K0CA 1YF1A 2NPBA 2GTUA 3HYPA 2JZTA 1K0BA 1OE8A 4JRRA 3W8SA 2HI7A 4NWYA 3O3TA 3TKQA 4KCEA 4GQFA 4HI7A 2JZRA 4JBBA 2J9UB 4I97A 4JE1A 1EGRA 2OA7A 2AYTA 2FWEA 5DJMA 5FT3A 2IMDA 3H93A 4G2EA 1GNWA 5J3RA 2V41A 3M8NA 3PH9A 3GUSA 1EGOA 5DCGA 4DSSB 4NHWA 1JHBA 1JLWA 2H1BA 3WT2A 3DYRA 2LTKA 3TKRA 1QMVA 4H86A 5HFKA 2I3YA 2YWOA 1TW9A 1OKTA 16GSA 1X5CA 4I2TA 2DBCA 3JCML 1SJ6A 1K0DA 2N5AA 2IMEA 3CYNA 2F8FA 2AAWA 4DSRA 3ZITA 4KSOA 2CAQA 2PERA 5ID2A 4KH7A 3IA1A 4P3YB 2YWNA 2ZUPA 4O5RA 4V2LA 4N10A 1N2AA 1BEDA 3QPMA 2RUEA 1TRWA 2WJUA 1B4PA 2KOKA 3VFIA 2YWMA 3IXRA 4FIWA 5D8IA 2VAFA 4JEDA 1MD4A 5F8BA 2IN3A 2AV4A 2VCQA 2CV4A 5IOXA 2HZEB 4G9HA 2B6MA 4XRDA 1Z6NA 2RLIA 2V6KA 5EY6A 3GMFA 5D9XA 4X1UA 1TK0B 4ZL7A 1JZOA 3IAS2 2LV3A 3FR9A 3F6FA 4OO5A 2LUSA 3P90A 4ECBA 4IJIA 4F0BA 4AGSA 2V1MA 3RPPA 5AIXA 3KH9A 1RQMA 2AHEA 1THXA 2DJJA 2RIIA 4MZBA 1EWXA 3QAVA 5IMCA 2JZSA 3ZMLA 3EYTA 1R26A 1AAZA 2B5EA 3D22A 4XS6A 1AQXA 4CDOA 1VF3A 7GSSA 3UVTA 1KEBA 1JLVA 2CAIA 4TRXA 3WGEA 3GRXA 3D21A 3P2AA 4RQXA 3IPZA 5GSTA 5F0GA 4MDCA 2H6YA 4TXOB 3M3MA 3KP8A 4GQCA 2HFDA 2H8LA 6GSUA 1TP9A 1SJZA 1GSYA 2F3MA 5DDLA 4N0ZA 2MMAA 1VF2A 2Z9SA 1A23A 2YP6A 5DJLA 3UVHA 3F9UA 3VI5A 3TKSA 1HNAA 3ZYWA 4XS4B 1T7PB 1K0AA 2WFCA 3GNJA 3GX8A 1MD3A 5ENUA 1GWCA 2AUVA 2HSYA 2C4JA 1XVQA 4DVCA 5KEJA 1BX9A 3ED3A 4XTSA 1BJXA 1M9AA 2OE0A 1E6BA 3Q74A 4K0NA 4KAEA 1KTEA 3UOMA 1GSFA 5J9BA 2L5LA 1XBSA 1XW6A 2P5QA 4ZBAA 3DEXA 3IR4A 1G0TA 1YZXA 1EV9A 4BWSA 1NW2A 4EC0A 3ZZXA 1X5DA 4NPBA 5JWQB 2LRNA 3RPNA 5H5SA 2KLXA 2OBIA 3D5JA 4L5LA 5DCHA 1DE1A 2TRCP 2DJKA 2FD3A 3TRXA 1YQ1A 2VIMA 3GSTA 3Q6OA 4N30A 1LU4A 14GSA 1EP7A 4TW5A 5HFIA 4EF0A 1M0UA 2LSTA 1G6YA 3N5OA 3KGKA 4HS1A 1PL1A 4PX1A 4NHZA 4GTUA 2GSQA 2VOCA 3P8WA 1SK0A 4HQZA 5KN0A 1TXXA 5EPFA 3ZLPA 4J57E 4Q5NA 5AIVA 1ZL9A 1ERWA 1SYRA 4NV2A 5DVBA 4DSQA 3LYKA 1OKDA 2FA8A 5CRDA 4MLYA 2JL4A 1W4VA 2X8GA 3DIEA 2FA4A 3E0UA 1AQVA 4FH8A 1V2AA 4TR1A 6GSTA 2N5FA 5ECKB 4KA0A 5DAKB 4WBJA 4QQ7A 5DQYA 4TXVA 3VWUA 1PKWA 2MMOA 4JU5A 1B4QA 4YH2A 4PQ1A 2O85A 1TI3A 3LORA 3MDKA 4KUNA 2HLSA 2WDUA 5B6MA 2GZPA 2CZ2A 5JWRB 2CZ3A 5INYA 4ML1A 2P0GA 2GS3A 4NAXA 4Z7XA 1V58A 2NTOA 1Z6MA 2IMFA 3FZAA 1YF0A 4DEJA 3UBKA 2QSIA 1YJ6A 4OMVA 1O81A 3W8JA 3L9VA 4WF4A 1T8EB 3IC4A 1TKDB 3WGDA 1SL1B 1EOHA 1WPIA 2H6ZA 2LS5A 4HOJA 5IOWA 1YEXA 4XRAA 2B7KA 1EEJA 4IQAA 4PNFA 3EU3A 4ILFA 1RW1A 4YQUA 4BL7A 1AXDA 1BYEA 4MMMA 5FWGA 3S9FA 3C73A 3L9SA 1S3AA 4HZ2A 5AISA 3DRNA 4YQMA 4MJCA 1SD9A 4OFNA 4HU7A 2ON7A 2IWTA 2AJQB 1BAYA 1PMTA 1X9WB 1SKWB 1N8JA 3IOSA 4ZB9A 2OJLA 2C3TA 5B8BA 3GSSA 3GN3A 3CRUA 1TRSA 1VF4A 1SYXA 4O7HA 2OE3A 4MF6A 1XOBA 3FK8A 10GSA 1QUWA 2WRTA 4F9ZA 3V1WA 1J08A 5CRGA 4WR5A 5G31A 1Z7RA 1M9BA 1SL0B 2L4QA 1TTZA 2FWHA 3FZ5A 2I9HA 2LJRA 5G2ZA 2O87A 3ZMKA 1AQWA 3R2QA 2C3QA 4OD7A 3MAKA 2IFQB 1M2DA 3ISOA 2JSZA 2WGRA 3DGQA 2EIRA 4G19A 1GTAA 1AIUA 1TRVA 4CHSA 1HNBA 4GF0A 4K1FA 5G30A 5H5QA 3APOA 3G9BA 4AJ6A 2CA8A 3PGTA 1K0OA 3IBHA 4HZ4A 1TI1A 4X0XA 1FOVA 4MJBA 2C8UA 2H0HA 3WGXA 1Z9HA 4V1Ap 1XZOA 2GT5A 2H1AA 4MZCA 3GYKA 2YOIA 4PQHA 2MMNA 3IE3A 5HQPA 3O6TA 3TGZA 1I5GA 5CRWA 4MPGA 2ES7A 2H1DA 2O7KA 2L59A 5D93A 2B5XA 2C0DA 5IMFA 5A5KA 3CXGA 2BTOT 1EP8A 1NSWA 1X5EA 2HSHA 3EMXA 1GRXA 1WJKA 4KE3A 4ZILA 3CBUA 2R4VA 3ZFLA 3MWHA 4ZB8A 3H8QA 1HYUA 3QMXA 4POKA 3GIXA 2KUCA 5CP1A 1XW9A 3VI7A 1HQOA 4ZBBA 1O73A 4O32A 5A4UA 4PXOA 5J41A 1U88A 4IN0A 5B6NA 1JZRA 1T3BA 3ZREA 1J9BA 4ZL8A 1YKAA 3HZ4A 2M46A 5KN2A 3I43A 2CX3A 5CREA 5HR0A 3WT1A 1DBYA 3TJFA 5G1KA 1WE0A 1WP0A 4AJ7A 1YDKA 1ERTA 2H30A 3FY7A 1FB0A 1T4ZA 3UARA 4Q5FA 2YN1A 4FYBA 2NBSA 3H1NA 2HNLA 4HUAA 1A8LA 1OYJA 4QL7A 2LJKA 1EOGA 3IK9A 1OC9A 3DVXA 19GSA 5A4VA 2TIRA 2DC5A 2YCDA 5DQSA 1B9XC 3US3A 1GUHA 4K8MA 1XWBA 4PUAA 3LXTA 1TOFA 2L6DA 2D2ZA 3LGCA 1V40A 3PR8A 1FW1A 4K7OA 3L78A 4KDXA 5JCGA 4GLTA 4TR4A 5GAPD 3KD0A 1E2YA 3APQA 3N9JA 5EVOA 2P5RA 3Q19A 1CQHA 4WETA 5CYYA 2GVPA 4MPFA 2GSRA 2MYGA 2YJ7A 2DJ0A 4MF7A 5CNWA 3DD3A 3TJBA 5J9CA 2CVKA 1U3AA 4GSSA 2YJHA 1A0FA 4YQVA 1JFUA 4PGTA 4POBA 4MK3A 2H66A 5GZZB 5CO3A 3EE2A 3HJPA 3FW2A 1BQ7A 4HDEA 3ERWA 2LRTA 3NOFA 4MH3A 4MP4A 4NXIA 3BJ5A 4PUFC 3EC3A 2HT9A 3U5RE 2DMMA 4GRFA 4EDYA 5D9WA 11GSA 1F9MA 1SL2B 3NIVA 3A2WA 3WD6A 1SU9A 2GQKA 2MMZA 2JADA 5COHA 4ISDA 4BA7A 3G7YA 1YY7A 3KEBA 3NZNA 2NDOA 4TXOA 4ECCA 3F0IA 2VLUA 3D6IA 2HRFA 4BVXA 3GKKA 1GL8A 1QK8A 3HHVA 4KSMA 5IQYA 1PA3A 4D73A 1WWJA 2K18A 1F2EA 3UEMA 2C6AA 4XS4A 4E8HA 4ZB6A 3MSZA 2PU9C 3ZRDA 20GSA 2E0QA 1ZYQB 1PL2A 4NMUA 2G2QA 4OFMA 1VF1A 1NM3A 4IQ1A 3ME7A 1M2AA 1XOAA 1X9MB 2HE3A 1NHYA 3CSHA 5ECMB 2DIZA 3GFKA 3GA4A 1PQNA 4OCEA 3QFBC 4GCIA 5ECPB 3TB2A 2JSYA 1Y25A 1TDIA 1T4YA 1Q4JA 5LD0A 1IYHA 2R5GA 5JCUA 3F4TA 3IK7A 1HNCA 1SKSB 1U6TA 2GLRA 3EURA 2GSTA 1TK8B 5D9TA 3F8UA 1OVNA 2IL3A 3QDNA 2YPMA 4ML6A 3GTUA 1AW9A 3HDCA 2J23A 3APSA 2H72A 3F63A 2EC4A 1GULA 1WMJA 2PMTA 4TR0A 2OE1A 5IMDA 2GZYA 3ZFBA 2L6CA 1ML6A 3QR6A 1PSQA 1LBKA 2VD0A 3D0ZA 3M1GA 4ECJA 4MA9A 2RM5A 2FCHA 4WKWA 5E4WA 1PD21 1ST9A 3GL3A 3G7JA 4I8BA 1URMA 3GV1A 2CX4A 3FEUA 1A0RP 4IGJA 1M7TA 4Q5QA 2H0GA 1GLQA 3B0AB 3OR5A 2PN8A 2V6OA 3ZIJA 3ERGA 4L8EA 3M9KA 4KNDA 3KH7A 3E3EA 2VCWA 1GSDA 5F06A 2N5BA 2CVDA 5DAKA 2WS2A 1YEPA 3DVWA 3QAWA 2XBIA 3VLNA 3C8EA 1USBA 1PX6A 1X0RA 3LJRA 2OACA 4OCFA 2TRXA 4QL9A 3A2VA 5GSSA 4HJMA 4MABA 4HQSA 4ZBDA 1K0NA 2H70A 3KXOA 4XHMA 3VURA 17GSA 2GDRA 3E9JB 5FHIA 5ECOB 1O7UA 2MBTA 22GSA 5C00A 1S3CA 1A2LA 2GGTA 4F0CA 5ECNB 1K3LA 2REMA 3IRAA 3H4KA 4K2DA 1MEKA 5HR2A 1J0FA 1OC8A 4I6XA 3LFLA 3ZVJA 2YANA 2K6VA 2IIYA 1O85A 1PKZA 1F3AA 6GSXA 2FGXA 3DXBA 1T00A 4KW6A 1QXHA 4F82A 1W89A 1FVJA 2VL2C 2A2SA 4MJAA 3LEFA 1VGLA 1ZZYA 3VPQA 2YZUA 1ZMAA 4TVEA 1ZYEA 5F05A 2HRNA 5E59A 2VD1A 2FWGA 3BCIA 2H76A 2IMIA 5D73A 1EZKA 2XHFA 1H4OA 2WB9A 2L57A 5J5NA 5D96A 5DALB 4N11A 2VM1A 4YAVA 3KP9A 1CQGA 3TDGA 3CSJA 4KDUA 1SKRB 4WBRD 2LJAA 4LMVA 2GQLA 5ELGA 1Z7PA 2VCZA 2VCTA 2VCVA 2B7JA 5IPGA 4EE0A 4ULXA 2FHEA 4XS1A 2R3XA 1A2JA 2IFQA 2J9HA 1THOA 1HD2A 4J2FA 2PPTA 2PVOC 4RI6A 2EIOA 4WXTA 1PX7A 4N0VA 2DIYA 2NVLA 5F07A 2OKAA 1GTIA 3KTBA 3LSZA 3FKFA 5ECLB 3BOAA 3EU4A 4O92A 1UN2A 3A5WA 1B48A 3KMOA 1SK2A 2LNSA 5GAND 1ERVA 3P7XA 4GSTA 2G0FA 3TJKA 1VRSD 3VWXA 1LJRA 1G6WA 4OWYA 4K7NA 1U87A 4OFTA 5ELAA 2XPDA 8GSSA 2X8HA 2H73A 2E2MA 4IBPA 2CT6A 4KDYA 3J7Yb 4GSNA 4IP6A 4RQRA 2L5OA 3F3QA 3HD5A 2R6KA 4TR3A 5IM9A 3LYPA 4ID0A 1R5PA 1DSBA 2IMKA 5IIZA 1M2BA 3FHKA 1C72A 2C0GA 2LRCA 3CSIA 2IPAA 3GH6A 2C0EA 3GKXA 4HJ2A 3UBLA 3B08B 2H6XA 3U6VA 2YV9A 4MF5A 3AY8A 6GSSA 2VL2A 4XXBB 3TKSC 3O76A 3A2XA 2RM6A 4K0GA 1QQ2A 3QCPA 4MJEA 2ZCTA 1OE7A 5ID2B 4EDZA 5HFGA 1OAZA 4ACSA 1OC9B 6GSVA 4K9ZA 1XFLA 4RUVA 2DMLA 3ZL5A 1G7OA 4DSSA 3LQ7A 5EL8A 2VLVA 2CQ9A 3TKSE 3WYWA 3UIWA 3GL5A 3QD9A 2E2GA 5B7CA 5CRHA 3GKNA 1WIKA 5KN3A 2AB6A 1T1VA 3K8NA 1XIYA 2QKEA 4EUYA 4F2IA 4WF5A 5IO0A 3GURA 2YNXA 5J4UA 4WR4A 1I9DA 4FYCA 2FLSA 3TRQA 2P31A 2GQMA 1PN9A 1PRXA 2FUG2 1IYIA 2QC7A 1FAAA 2DJ1A 3W6GA 4EKZA 1F3BA 2E7PA 2HYXA 5L71A 2KP1A 1G7EA 6GSWA 2HZEA 4GWRA 2JACA 1WRYA 3KTLA 5ECRB 3HKRA 3VK9A 4IELA 4MH2A 3ZTLA 1MDIA 1ERUA 2C1YA 4IJ3A 2KP2A 2OBKA 1H75A
chains in the Genus database with same CATH superfamily
1VCXA 3H97A 4AHWA 2ALBA 1K0MA 4KCAA 4K6XA 4PQIA 2K8SA 2KHPA 1ABAA 1O6JA 4POMA 4EO3A 4YAPA 1XWGA 2JA6L 2PWJA 4HEA2 1O8WA 4EVMA 3TOTA 3C7MA 3LWVB 3RDWA 4XGHA 1JZDA 1XXUA 1MTCA 2RUFA 5G1LA 2E2HL 4WEYA 2LNTA 3H79A 2PBJA 1A24A 2C3NA 1K3OA 3RBTA 2A68D 2VUPA 3RHBA 4MZWA 3PINA 1JZWA 1K3YA 2WZ9A 3FR3A 2F8AA 3PO3L 3A3TA 1XWKA 1YKCA 4BVXB 4PURA 1GUKA 3FRCA 4BPYA 1V9WA 4HU9A 2QGVA 2YV7A 4RXNA 1KNGA 3C71A 4IW9A 4L5OA 4BVYA 3UJ1A 2VL3A 1Z5YE 5ECQB 2X99A 1FB6A 2X64A 3KIJA 4K2XA 2MZCA 4J56E 4D73B 2H1GA 1AUCA 2LKUA 4X43A 4L0UA 1PZXA 2K9FA 4IP1A 1UC7A 5DBQA 1RK4A 1NHOA 1S3RA 1A8YA 4IHUA 3HVSA 3LXZA 2Y0SP 1PFVA 2LEGA 2FWFA 1UVZA 3D4TA 3TJGA 3FR6A 3EWLA 2ON5A 4LMWA 3J7Z1 3J7Yk 2V32A 1GSEA 1R5AA 3TOUA 1ZCPA 5IMVA 3EINA 1XPVA 1GSSA 1ZOFA 4G10A 4AI2A 5JCWA 3F6DA 2BMXA 4KGIA 1XCCA 1B8XA 5AN1A 2AQCA 2ERJA 3HXSA 1QFNA 5CAXA 3G7IA 3HA9A 4ZL9A 5IO2A 2HXKA 2OADA 1XWCA 3ERFA 5HR1A 2H71A 5KN1A 3HJMA 2X49A 5LCZA 1SK1A 2F51A 1V57A 3F3RA 2I4AA 3ZIVA 1SD8A 4JR4A 4KB3A 3TKPA 1M99A 4AJ8A 2XBQA 1TRUA 4FO5A 4RI7A 2XC2A 3BBYA 4Z2UA 18GSA 1GUMA 5B8AA 3EVIA 4EL1A 2IJYA 5LNKe 1WCML 4TN8A 2M72A 3FZ4A 3GTUB 5ECSA 4KX4A 5H5RA 3SBCA 4POLA 3F4SA 4ZIJA 5HR3A 3RZ6A 3S1RL 3BCKA 2DSAA 13GSA 3S14L 3CTFA 1ZGNA 1F4LA 4I5QA 1QGVA 3HJYB 1U3IA 4XCSA 2B5ID 3KZQA 2R2JA 5IMZA 2K8VA 4BWQA 4Y7NL 4TR1B 1TWFL 2VLTA 5ECIB 2H0IA 4JR6A 2X8CA 1NXEA 2ZNMA 3GHAA 1BG5A 2M4YA 3KM6A 3RAZA 4LLRA 1ILOA 4C3IL 3L9UA 2V2GA 3TRPA 1ACVA 3L4NA 2C0FA 3ME8A 4PNGA 2H01A 4F03A 3D4MA 2BJXA 1ON4A 6GSYA 3KMNA 5G5EA 1GLPA 3L0HA 1EEMA 5ECHB 2C80A 2LQQA 1YK5A 4AI3A 4A3JL 3HCZA 2KN9A 4IS0A 3CRTA 4ECIA 4LL4B 2B3SA 2Z3RB 1TJDA 3FDJA 2DJ2A 1YV1A 3I69A 2XJQA 2JA7L 1S3DA 2PGTA 2I81A 3LWAA 1PGTA 4ME3A 3HVXA 5MGNA 3TJJA 1WOUA 3HZ8A 1ZYNA 3FZ9A 4OO4A 3GKMA 2V3BB 1CADA 1T9PA 2DJ3A 2WULA 4V1Ag 12GSA 3DWVA 3BD2A 3Q18A 4TKYA 2WCIA 4USSA 3HOVL 2YZHA 4JZQA 2NVQL 1XVWA 1Y6EA 2H74A 2DSXA 5G5FA 3I6AA 2VL9A 4A3KL 2V0FA 1R4WA 2XJPA 2C6BA 5D9VA 3VWVA 4IVFA 3QQCE 2M80A 2A4VA 2AUSB 3C1SA 2PVQA 4AHYA 2GZZA 2GT6A 3GTLL 3KCMA 4XIHA 1H7VA 4YWLA 3CMIA 3HVVA 1TU7A 3S15L 4CW9A 2FNOA 1DE2A 3TCOA 3IDVA 1KBNA 4MCUA 2PMZP 2PVEA 2EIQA 2O8VB 1TK5B 3IAM2 2AYJA 3M9JA 4I2UA 4YKGA 3DKSA 3SWLA 1MDJA 2PUKC 5KOWA 4EXJA 3CTGA 3VWWA 1IW7D 4TVMA 1Q98A 3QFAC 2B5YA 1QCVA 2YWIA 4K7IA 1GNEA 1ZYPA 1TU8A 2H19A 3HY2A 1V98A 3UAPA 1Z3EA 3GH9A 2DLXA 1DUGA 4JAFA 2FY6A 3QAGA 2R37A 1SENA 2RFKB 1GTBA 2A2RA 9GSSA 2F9SA 4Q5RA 3ZG6A 4GXZA 3IC8A 2HSMA 3UL3A 1F6MC 3QOUA 1FVKA 3EMPA 5C04A 2JU5A 3LG6A 4L0WA 1FO5A 1GP1A 1GTUA 2O89A 2VO4A 1AC1A 1A2MA 3KJYA 1T9OA 2XJSA 3RHCA 3EPTA 3UMAA 3ZVJD 4FQUA 2MBSA 3MYDA 5M3FL 4V2NA 3IHQA 2XJVA 4ZXGA 3GTGL 1FG4A 3IU3I 3I9V2 3F4RA 4AF2A 4LL1B 5DM71 1GSUA 5DALA 3S2HL 3DMLA 1XWAA 2GSSA 1MDKA 3C1RA 1EV4A 2B1KA 2VCXA 2I1UA 3SS2A 2L4CA 3GX0A 4FYUA 1GSQA 2H75A 1F37A 1X9SB 4TOPA 4ZN3B 4A3ML 1B9YC 1S24A 1GH2A 4E8EA 2XPEA 1BQ8A 2LQOA 4A3EL 3MNGA 3TUEA 1UA5A 2VM2A 4IKHA 5IPHA 1R7HA 2HZFA 1O8XA 5IMAA 1XW5A 3MPSA 3IV4A 3HJOA 5AGYA 2A4HA 1SJIA 5ABRA 1FHEA 4EIQA 1S30A 2CVBA 3M0FA 4NV5A 1OC3A 1SMMA 2B1LA 4V2MA 3FYGA 2CKCA 1B13A 3VPTA 5JWOB 3PKJA 4LA1A 5A4WA 1K0CA 1YF1A 3HOWL 2NPBA 2GTUA 3HYPA 2JZTA 1K0BA 3LW9A 1OE8A 4JRRA 3W8SA 2HI7A 1T9QA 3NFPI 4NWYA 3O3TA 3TKQA 3GTKL 4KCEA 4GQFA 4HI7A 2JZRA 4JBBA 2J9UB 5IYCL 4I97A 4JE1A 2OA7A 1EGRA 3CQFA 2AYTA 2FWEA 5DJMA 5FT3A 2IMDA 3H93A 4G2EA 1GNWA 3LNLA 4A3DL 5M5XL 5J3RA 2V41A 1I50L 3M8NA 3PH9A 4QIWP 3GUSA 1EGOA 5DCGA 4DSSB 4NHWA 1JHBA 1JLWA 2H1BA 3WT2A 3DYRA 2LTKA 3TKRA 1QMVA 1FOHA 4H86A 5HFKA 1LTLA 2I3YA 2YWOA 2XJRA 4WFN1 1TW9A 1OKTA 16GSA 2HR5A 1Y1VL 1X5CA 4I2TA 2DBCA 3JCML 1SJ6A 1K0DA 2N5AA 2IMEA 3CYNA 2F8FA 2AAWA 4DSRA 4K5RA 3ZITA 4KSOA 5EIOC 2CAQA 1TWGL 5M3ML 4Z2RA 2PERA 5ID2A 3WWLA 4KH7A 3IA1A 4P3YB 2YWNA 2ZUPA 2R0CA 2HVYC 4O5RA 4V2LA 4N10A 5C4JL 1BEDA 1N2AA 3QPMA 2RUEA 4G6BA 1TRWA 2WJUA 1SMWA 1SFOL 1B4PA 2KOKA 3VFIA 3H99A 2YWMA 3JR7A 3IXRA 4FIWA 5D8IA 2VAFA 4JEDA 1MD4A 5F8BA 2IN3A 2AV4A 2VCQA 2CV4A 5IOXA 2HZEB 5MFPA 4G9HA 2B6MA 4XRDA 1Z6NA 3RZOL 2RLIA 2V6KA 5EY6A 3GMFA 5D9XA 4LHLA 4X1UA 1TK0B 4ZL7A 1JZOA 3IAS2 2ERSA 2LV3A 1FHHA 3FR9A 3F6FA 4OO5A 2LUSA 3P90A 4ECBA 1P7PA 4IJIA 1TWCL 4F0BA 2QA1A 4AGSA 2V1MA 3RPPA 5AIXA 3KH9A 1RQMA 2AHEA 1THXA 2DJJA 2RIIA 4MZBA 1EWXA 3QAVA 5IMCA 2JZSA 3ZMLA 3EYTA 1R26A 1AAZA 2B5EA 3D22A 4XS6A 1AQXA 4CDOA 3IHGA 1VF3A 2PSMC 7GSSA 3UVTA 7RXNA 2HRKA 4KF9A 1KEBA 1JLVA 2CAIA 4TRXA 3WGEA 3GRXA 3D21A 2QA2A 2NVTL 3P2AA 4RQXA 3IPZA 5GSTA 2R7ZL 5F0GA 3S1QL 4MDCA 2H6YA 4TXOB 3M3MA 3KP8A 3KYUA 4GQCA 4POGA 2QL0A 2HFDA 2R0PA 2H8LA 6GSUA 1TP9A 1SJZA 1GSYA 2F3MA 5DDLA 4N0ZA 2MMAA 1VF2A 2Z9SA 3GTOL 1A23A 2YP6A 5DJLA 3UVHA 3F9UA 3VI5A 3TKSA 1HNAA 3ZYWA 4XS4B 2JI1A 1T7PB 1K0AA 1WJVA 2WFCA 3GNJA 3GX8A 1R0JA 1MD3A 5ENUA 1GWCA 2AUVA 2HSYA 2C4JA 1XVQA 4DVCA 5GAHc 5KEJA 1BX9A 3ED3A 4XTSA 1BJXA 3CQZL 1M9AA 2OE0A 1E6BA 2M6OA 3Q74A 4K0NA 5KOXA 4KAEA 1KTEA 3UOMA 1GSFA 5J9BA 4K9FA 2L5LA 1XBSA 1XW6A 2P5QA 4C3HL 4ZBAA 3DEXA 3IR4A 1G0TA 1YZXA 1EV9A 4BWSA 1NW2A 1BRFA 4EC0A 3ZZXA 1X5DA 1LKOA 4NPBA 5AI3A 4YKFA 5JWQB 2LRNA 3RPNA 5H5SA 2KLXA 2OBIA 3D5JA 4L5LA 4BY7L 2BE5D 3H9BA 2DKIA 4MNNA 5DCHA 1DE1A 2TRCP 2DJKA 2FD3A 3TRXA 1YQ1A 3HOZL 3S1NL 2VIMA 3GSTA 3Q6OA 4N30A 1LU4A 14GSA 1EP7A 4TW5A 4U671 5HFIA 4EF0A 1M0UA 2LSTA 1G6YA 2VUML 3N5OA 3KGKA 1M3IA 4HS1A 4JAEA 4O5QA 1PL1A 4PX1A 4NHZA 4GTUA 2GSQA 2VOCA 3P8WA 1SK0A 4HQZA 5KN0A 1TXXA 5EPFA 3ZLPA 4J57E 4Q5NA 5AIVA 1ZL9A 1ERWA 1SYRA 4NV2A 5DVBA 3FKIL 4DSQA 5H1Sc 3LYKA 1OKDA 2FA8A 5CRDA 1VZHA 4MLYA 3WWNB 2JL4A 1W4VA 2X8GA 3DIEA 3LWPB 1LKPA 2FA4A 3E0UA 1AQVA 4FH8A 5JVH1 1V2AA 4TR1A 5DM61 6GSTA 2N5FA 5ECKB 1K83L 4KA0A 5DAKB 4WBJA 4QQ7A 5DQYA 5IYBL 2ZIXA 4TXVA 1VZIA 3VWUA 1PKWA 2MMOA 4JU5A 1B4QA 1IRNA 1RDVA 2RDVA 4YH2A 4PQ1A 2O85A 1TI3A 3LORA 3MDKA 4KUNA 2HLSA 2WDUA 5B6MA 5MF6A 2GZPA 2X4AA 3GTQL 2CZ2A 5JWRB 2CZ3A 4AYBP 5INYA 4ML1A 2P0GA 4GS7D 2GS3A 4NAXA 4Z7XA 1V58A 2NTOA 1M3JA 1Z6MA 2IMFA 3FZAA 1YF0A 4DEJA 5MLC3 3UBKA 2QSIA 1YJ6A 4OMVA 4E6YA 1O81A 3W8JA 3L9VA 4WF4A 1T8EB 3IC4A 2K2DA 1TKDB 3WGDA 1R0IA 1SL1B 1EOHA 1WPIA 2H6ZA 2LS5A 4HOJA 5IOWA 1YUXA 3K35A 1YEXA 4XRAA 2B7KA 1EEJA 4G0KA 4IQAA 4PNFA 3EU3A 4ILFA 1RW1A 3LWQB 4YQUA 4BL7A 1AXDA 2JI2A 1BYEA 4MMMA 1OWBA 2A6ED 5FWGA 3M3YL 3GTPL 3S9FA 3C73A 3L9SA 1S3AA 4HZ2A 5AISA 3DRNA 4YQMA 4MJCA 1SD9A 4OFNA 4HU7A 2ON7A 2IWTA 2AJQB 3PZAA 1BAYA 1PMTA 1X9WB 1SKWB 2E2IL 1N8JA 1VZGA 3IOSA 4ZB9A 2E2JL 2OJLA 2C3TA 5B8BA 3GSSA 3GN3A 3CRUA 1TRSA 3S16L 1I6HL 1VF4A 1SYXA 4O7HA 2OE3A 4Z2TA 4MF6A 1XOBA 3FK8A 10GSA 1QUWA 2WRTA 4F9ZA 3V1WA 1J08A 2CKAA 5CRGA 4WR5A 4AR4A 5G31A 1Z7RA 1IU5A 1M9BA 1SL0B 3PIP1 2L4QA 1TTZA 2FWHA 3FZ5A 2I9HA 2LJRA 1TWAL 4PTSA 5G2ZA 2O87A 3ZMKA 1AQWA 3R2QA 2C3QA 4OD7A 3KYWA 3MAKA 2IFQB 1M2DA 3ISOA 4A93L 2JSZA 3PIO1 2WGRA 3DGQA 2EIRA 4ZN1B 4G19A 4B8CD 1GTAA 1AIUA 1TRVA 1Z92B 4CHSA 2O5JD 3MQKB 1HNBA 4GF0A 3A5IA 4K1FA 5G30A 5H5QA 2R93L 3APOA 3G9BA 4AJ6A 2CA8A 3PGTA 1K0OA 3A44A 4AI0A 1SMUA 3IBHA 4HZ4A 1TI1A 1CAAA 4X0XA 3LWOB 1FOVA 1PFOA 3VPBE 4MJBA 2C8UA 2H0HA 4CY8A 4BBRL 3WGXA 1Z9HA 3HOUL 4V1Ap 1XZOA 2L0ZA 2GT5A 2H1AA 4MZCA 3GYKA 2YOIA 4PQHA 2MMNA 3IE3A 5HQPA 3O6TA 1PFUA 4A3CL 3TGZA 1I5GA 5CRWA 4MPGA 5EINC 2ES7A 2H1DA 2O7KA 2L59A 5D93A 2B5XA 2C0DA 5IMFA 5A5KA 2UZ8A 3CXGA 2BTOT 1EP8A 5FJ8L 1NSWA 1X5EA 2HSHA 3EMXA 1GRXA 1WJKA 4KE3A 4ZILA 5M5WL 2R4VA 3CBUA 3ZFLA 3HJWB 3MWHA 5IY0A 4ZB8A 3H8QA 1HYUA 3QMXA 4POKA 3GIXA 2M6PA 2KUCA 5CP1A 1XW9A 4C3JL 1HQOA 3VI7A 3FMWA 4ZBBA 1O73A 4O32A 5A4UA 1FHMA 4PXOA 5J41A 1U88A 4IN0A 4HSCX 5B6NA 1JZRA 1T3BA 3ZREA 1J9BA 4ZL8A 1YKAA 3HZ4A 4ICYA 5C4XL 2M46A 5KN2A 3I43A 2CX3A 5CREA 5HR0A 3WT1A 1DBYA 1TWHL 2MS3A 3TJFA 5G1KA 1WE0A 1WP0A 3GTML 4AJ7A 1YDKA 1ERTA 2H30A 3FY7A 1FB0A 2WAQP 1NNQA 1T4ZA 3KYVA 4Q5FA 3UARA 2YN1A 2H12A 3KYXA 4FYBA 2NBSA 3H1NA 2HNLA 4HUAA 1A8LA 1OYJA 3H0GL 4QL7A 2LJKA 1EOGA 3IK9A 5FLML 2Z3QB 6RXNA 1OC9A 3DVXA 1YK4A 19GSA 5A4VA 1B2OA 2TIRA 2DC5A 2YCDA 1R0FA 5BRTA 3I4ML 5DQSA 1E8JA 1B9XC 3US3A 1GUHA 4K8MA 2JA8L 1XWBA 4LHNA 4PUAA 3LXTA 1TOFA 2L6DA 2WB1P 2D2ZA 3LGCA 1RDGA 1V40A 3PR8A 1FW1A 4K7OA 3L78A 4KDXA 5JCGA 4GLTA 4TR4A 5GAPD 3KD0A 4YWMA 1E2YA 3APQA 3N9JA 5EVOA 2P5RA 3Q19A 3S1ML 3M4OL 1IROA 3H9CA 1CQHA 4WETA 5CYYA 4Y52L 2GMGA 2GVPA 4MPFA 2GSRA 2MYGA 2YJ7A 2DJ0A 4MF7A 5CNWA 3DD3A 3TJBA 5J9CA 3PL5A 4AR5A 2CVKA 1U3AA 4GSSA 2YJHA 3I4NL 2NYDA 1A0FA 4YQVA 4CY6A 1JFUA 4PGTA 4POBA 4MK3A 2H66A 5GZZB 5CO3A 3EE2A 4JAGA 3HJPA 3FW2A 1BQ7A 4HDEA 3ERWA 2LRTA 3NOFA 4MH3A 5IYDL 1NXGA 4MP4A 4NXIA 4BVYB 4K5SA 4A3BL 3BJ5A 4PUFC 3EC3A 2HT9A 3U5RE 2DMMA 5BMUA 4GRFA 3HOXL 4EDYA 5D9WA 11GSA 1DX8A 1F9MA 1SL2B 3NIVA 3A2WA 5AI2A 1QQTA 3WD6A 1SU9A 2GQKA 2MMZA 2JADA 4O5UA 5COHA 4ISDA 3KYYA 4BA7A 3G7YA 1YY7A 3KEBA 3NZNA 2NDOA 4TXOA 4ECCA 3F0IA 2R0GA 1XG8A 2VLUA 3D6IA 2HRFA 4BVXA 3GKKA 1GL8A 1QK8A 3HHVA 4KSMA 5IQYA 1PA3A 4D73A 1WWJA 2K18A 1F2EA 3UEMA 2C6AA 4XS4A 4E8HA 4ZB6A 5C3EL 3MSZA 2PU9C 4A3IL 3ZRDA 20GSA 2E0QA 1ZYQB 1PL2A 4NMUA 2G2QA 4OFMA 1VF1A 2M4VA 4AR6A 1NM3A 4IQ1A 3ME7A 2XJTA 1M2AA 1XOAA 1X9MB 3HAXC 2HE3A 2PVXA 1NHYA 3CSHA 5ECMB 1B2JA 2DIZA 3GFKA 3GA4A 1PQNA 2A6HD 4OCEA 3QFBC 4GCIA 5ECPB 3TB2A 2JSYA 4POFA 1Y25A 1TDIA 3S2DL 1T4YA 1R0GA 1Q4JA 5LD0A 1IYHA 2R5GA 5JCUA 3F4TA 3IK7A 2A2PA 1HNCA 1SKSB 5RXNA 1U6TA 2GLRA 4EIPA 2YU9L 3EURA 2GSTA 1TK8B 5D9TA 2KKDA 3F8UA 1OVNA 2IL3A 3QDNA 2YPMA 5IP7L 4ML6A 3GTUA 1AW9A 5MFZA 1RB9A 3HDCA 2J23A 3APSA 2H72A 3F63A 2EC4A 1GULA 1WMJA 2PMTA 2VL6A 4TR0A 2OE1A 5IMDA 2GZYA 3ZFBA 3PKIA 2XJUA 2L6CA 1ML6A 3QR6A 1PSQA 1LBKA 2VD0A 3D0ZA 3M1GA 4X4JA 4ECJA 4MA9A 2RM5A 2FCHA 4WKWA 5E4WA 1OWCA 1PD21 1ST9A 3GL3A 3G7JA 4I8BA 1URMA 3GV1A 2CX4A 1QYBA 3FEUA 1A0RP 4IGJA 1M7TA 4Q5QA 2B63L 3PPUA 2H0GA 1GLQA 3B0AB 3OR5A 2PN8A 4X6AL 2V6OA 3ZIJA 3ERGA 4UY81 4L8EA 3M9KA 4KNDA 4BXXL 3KH7A 3E3EA 2VCWA 2JA5L 1GSDA 5F06A 2N5BA 2CVDA 5DAKA 2WS2A 1YEPA 3DVWA 3QAWA 2XBIA 3VLNA 3C8EA 1USBA 3GTJL 1PX6A 1X0RA 8RXNA 3S17L 3LJRA 1RWDA 2OACA 4OCFA 2TRXA 5M5YL 3A2VA 4QL9A 5GSSA 4HJMA 4MABA 4HQSA 4ZBDA 4BL7B 1ZRPA 1K0NA 2H70A 3KXOA 4XHMA 5GAGc 1RYQA 3VURA 17GSA 2GDRA 3E9JB 5FHIA 5ECOB 2NVYL 1O7UA 2MBTA 1R9TL 22GSA 5C00A 1S3CA 1A2LA 5IP9L 2GGTA 1IU6A 4F0CA 5ECNB 1K3LA 3RYGA 2REMA 3IRAA 2NVXL 3H4KA 4K2DA 1MEKA 5HR2A 1J0FA 1C09A 1OC8A 3HVNA 4I6XA 3LFLA 3ZVJA 2YANA 2K6VA 2IIYA 1DVBA 1O85A 2HRAA 1PKZA 4A3GL 1YUZA 1F3AA 6GSXA 2FGXA 3DXBA 1T00A 4KW6A 1QXHA 4F82A 1W89A 1FVJA 2VL2C 1I3QL 2A2SA 4MJAA 3LEFA 3QVDA 1VGLA 1ZZYA 3VPQA 2YZUA 5GADc 4V196 1ZMAA 4TVEA 1ZYEA 5F05A 1R0HA 3LWRB 2HRNA 4AR3A 4JADA 5E59A 2VD1A 2FWGA 3BCIA 2H76A 2APOB 3RZTA 2IMIA 5D73A 1EZKA 2XHFA 1H4OA 2WB9A 2L57A 5J5NA 5D96A 5DALB 4N11A 2VM1A 4YAVA 4C2M1 2A69D 3KP9A 1CQGA 3TDGA 3CSJA 4KDUA 1SKRB 4WBRD 2LJAA 4LMVA 3P8BA 2GQLA 5ELGA 1Z7PA 2VCZA 2VCTA 2VCVA 2B7JA 5IPGA 4EE0A 4ULXA 2FHEA 4XS1A 2R3XA 2EY4E 1A2JA 4A5PA 2R92L 2IFQA 2J9HA 1THOA 1HD2A 4J2FA 2PPTA 3K7AL 1S2ZA 2PVOC 4RI6A 4AHXA 2EIOA 4WXTA 1PX7A 4N0VA 2DIYA 2NVLA 5JVG1 5F07A 2OKAA 1GTIA 3KTBA 3LSZA 3FKFA 5ECLB 3BOAA 3EU4A 5GAEc 4O92A 1UN2A 3A5WA 1B48A 3KMOA 1SK2A 2LNSA 5GAND 2PYAA 1ERVA 3P7XA 4GSTA 2G0FA 1PFWA 3HOYL 3TJKA 4BY1L 1VRSD 3VWXA 1LJRA 1G6WA 5C44L 4OWYA 4K7NA 1U87A 4OFTA 1JYBA 3PWFA 5ELAA 2XPDA 8GSSA 2X8HA 2H73A 2E2MA 3MIXA 4IBPA 2CT6A 4KDYA 1BFYA 3HKZP 3J7Yb 4GSNA 4IP6A 3F3QA 2L5OA 4RQRA 3HD5A 2R6KA 1ODHA 4TR3A 5IM9A 3LYPA 4ID0A 1R5PA 1DSBA 4G0LA 2IMKA 5IIZA 1M2BA 4BIKA 3FHKA 1C72A 2C0GA 2LRCA 2DKHA 3CSIA 2IPAA 3GH6A 2C0EA 3GKXA 3RZDL 4HJ2A 3UBLA 3B08B 1B71A 2H6XA 3U6VA 2YV9A 4MF5A 3AY8A 6GSSA 5K2ME 2VL2A 4XXBB 3TKSC 3O76A 3A2XA 2RM6A 4K0GA 1QQ2A 3QCPA 4MJEA 2ZCTA 1OE7A 5ID2B 4EDZA 5HFGA 1OAZA 4ACSA 4AI1A 1OC9B 6GSVA 4K9ZA 1XFLA 4RUVA 2DMLA 3ZL5A 1G7OA 3J7Y1 4DSSA 3LQ7A 5EL8A 2VLVA 2CQ9A 4BBSL 3H3VM 3TKSE 3WYWA 3UIWA 3GL5A 3QD9A 2E2GA 5B7CA 5CRHA 4A3LL 3GKNA 1LKMA 4TPUA 1WIKA 5KN3A 2V0EA 2AB6A 1T1VA 3K8NA 1XIYA 2QKEA 4EUYA 4F2IA 3PO2L 4WF5A 5IO0A 3GURA 2CR8A 2YNXA 1PFYA 5J4UA 4WR4A 1I9DA 4FYCA 3LPEB 2FLSA 4A3FL 1PN0A 3TRQA 2P31A 2GQMA 1PN9A 1BE7A 1PRXA 2FUG2 1IYIA 4G0IA 4AHZA 2QC7A 1FAAA 2DJ1A 3W6GA 4EKZA 1F3BA 2E7PA 2LCQA 5AN9H 2HYXA 5L71A 2KP1A 1RYTA 1G7EA 6GSWA 2HZEA 1BQ9A 4GWRA 3MSUA 2JACA 1WRYA 3KTLA 5ECRB 3HKRA 3VK9A 4IELA 4MH2A 3ZTLA 1Y1WL 1MDIA 1ERUA 2C1YA 4IJ3A 2KP2A 2OBKA 2JI3A 1H75A 3R3EA
chains in the Genus database with same CATH topology
1VCXA 4AHWA 2ALBA 1K0MA 4KCAA 4K6XA 4PQIA 2K8SA 2KHPA 1ABAA 1O6JA 4POMA 4EO3A 4YAPA 1XWGA 2PWJA 4HEA2 1O8WA 4EVMA 3TOTA 3C7MA 3RDWA 4XGHA 1JZDA 1XXUA 1MTCA 2RUFA 5G1LA 4WEYA 2LNTA 3H79A 2PBJA 1A24A 2C3NA 1K3OA 3RBTA 2A68D 2VUPA 3RHBA 4MZWA 3PINA 1JZWA 1K3YA 2WZ9A 3FR3A 2F8AA 3A3TA 1XWKA 1YKCA 4BVXB 4PURA 1GUKA 3FRCA 4BPYA 1V9WA 4HU9A 2QGVA 2YV7A 4RXNA 1KNGA 3C71A 4IW9A 4L5OA 4BVYA 3UJ1A 2VL3A 1Z5YE 5ECQB 2X99A 1FB6A 2X64A 3KIJA 4K2XA 2MZCA 4J56E 4D73B 2H1GA 1AUCA 2LKUA 4X43A 4L0UA 2K9FA 4IP1A 1UC7A 5DBQA 1RK4A 1NHOA 1A8YA 4IHUA 3HVSA 3LXZA 2LEGA 2FWFA 1UVZA 3D4TA 3TJGA 3FR6A 3EWLA 2ON5A 4LMWA 3J7Z1 3J7Yk 2V32A 1GSEA 1R5AA 3TOUA 1ZCPA 5IMVA 3EINA 1XPVA 1GSSA 1ZOFA 4G10A 4AI2A 5JCWA 3F6DA 2BMXA 4KGIA 1XCCA 1B8XA 5AN1A 2ERJA 3HXSA 1QFNA 5CAXA 3G7IA 3HA9A 4ZL9A 5IO2A 2HXKA 2OADA 1XWCA 3ERFA 5HR1A 2H71A 5KN1A 3HJMA 2X49A 5LCZA 1SK1A 2F51A 1V57A 3F3RA 2I4AA 3ZIVA 1SD8A 4JR4A 4KB3A 3TKPA 1M99A 4AJ8A 2XBQA 1TRUA 4FO5A 4RI7A 2XC2A 3BBYA 4Z2UA 18GSA 1GUMA 5B8AA 3EVIA 4EL1A 2IJYA 5LNKe 4TN8A 2M72A 3FZ4A 3GTUB 5ECSA 4KX4A 5H5RA 3SBCA 4POLA 3F4SA 4ZIJA 5HR3A 3RZ6A 3BCKA 2DSAA 13GSA 3CTFA 1ZGNA 4I5QA 1QGVA 1U3IA 4XCSA 2B5ID 3KZQA 2R2JA 5IMZA 2K8VA 4BWQA 4TR1B 2VLTA 5ECIB 2H0IA 4JR6A 2X8CA 1NXEA 2ZNMA 3GHAA 1BG5A 2M4YA 3KM6A 3RAZA 4LLRA 1ILOA 3L9UA 2V2GA 3TRPA 1ACVA 3L4NA 2C0FA 3ME8A 4PNGA 2H01A 4F03A 3D4MA 2BJXA 1ON4A 6GSYA 3KMNA 5G5EA 1GLPA 3L0HA 1EEMA 5ECHB 2C80A 2LQQA 1YK5A 4AI3A 3HCZA 2KN9A 4IS0A 3CRTA 4ECIA 4LL4B 2B3SA 2Z3RB 1TJDA 2DJ2A 1YV1A 3I69A 2XJQA 1S3DA 2PGTA 2I81A 3LWAA 1PGTA 4ME3A 3HVXA 5MGNA 3TJJA 1WOUA 3HZ8A 1ZYNA 3FZ9A 4OO4A 3GKMA 2V3BB 1CADA 1T9PA 2DJ3A 2WULA 4V1Ag 12GSA 3DWVA 3BD2A 3Q18A 4TKYA 2WCIA 4USSA 2YZHA 4JZQA 1XVWA 1Y6EA 2H74A 2DSXA 5G5FA 3I6AA 2VL9A 2V0FA 1R4WA 2XJPA 2C6BA 5D9VA 3VWVA 4IVFA 3QQCE 2M80A 2A4VA 3C1SA 2PVQA 4AHYA 2GZZA 2GT6A 3KCMA 4XIHA 1H7VA 4YWLA 3CMIA 3HVVA 1TU7A 4CW9A 2FNOA 1DE2A 3TCOA 3IDVA 1KBNA 4MCUA 2PVEA 2EIQA 2O8VB 1TK5B 3IAM2 2AYJA 3M9JA 4I2UA 4YKGA 3DKSA 3SWLA 1MDJA 2PUKC 5KOWA 4EXJA 3CTGA 3VWWA 1IW7D 4TVMA 1Q98A 3QFAC 2B5YA 1QCVA 2YWIA 4K7IA 1GNEA 1ZYPA 1TU8A 2H19A 3HY2A 1V98A 3UAPA 1Z3EA 3GH9A 2DLXA 1DUGA 4JAFA 2FY6A 3QAGA 2R37A 1SENA 1GTBA 2A2RA 9GSSA 2F9SA 4Q5RA 3ZG6A 4GXZA 3IC8A 2HSMA 3UL3A 1F6MC 3QOUA 1FVKA 3EMPA 5C04A 2JU5A 3LG6A 4L0WA 1FO5A 1GP1A 1GTUA 2O89A 2VO4A 1AC1A 1A2MA 3KJYA 1T9OA 2XJSA 3RHCA 3EPTA 3UMAA 3ZVJD 4FQUA 2MBSA 3MYDA 4V2NA 3IHQA 2XJVA 4ZXGA 1FG4A 3IU3I 3I9V2 3F4RA 4AF2A 4LL1B 5DM71 1GSUA 5DALA 3DMLA 1XWAA 2GSSA 1MDKA 3C1RA 1EV4A 2B1KA 2VCXA 2I1UA 3SS2A 2L4CA 3GX0A 4FYUA 1GSQA 2H75A 1F37A 1X9SB 4TOPA 4ZN3B 1B9YC 1S24A 1GH2A 4E8EA 2XPEA 1BQ8A 2LQOA 3MNGA 3TUEA 1UA5A 2VM2A 4IKHA 5IPHA 1R7HA 2HZFA 1O8XA 5IMAA 1XW5A 3MPSA 3IV4A 3HJOA 5AGYA 2A4HA 1SJIA 5ABRA 1FHEA 4EIQA 1S30A 2CVBA 3M0FA 4NV5A 1OC3A 1SMMA 2B1LA 4V2MA 3FYGA 2CKCA 1B13A 3VPTA 5JWOB 3PKJA 4LA1A 5A4WA 1K0CA 1YF1A 2NPBA 2GTUA 3HYPA 2JZTA 1K0BA 3LW9A 1OE8A 4JRRA 3W8SA 2HI7A 1T9QA 3NFPI 4NWYA 3O3TA 3TKQA 4KCEA 4GQFA 4HI7A 2JZRA 4JBBA 2J9UB 4I97A 4JE1A 1EGRA 2OA7A 2AYTA 2FWEA 5DJMA 5FT3A 2IMDA 3H93A 4G2EA 1GNWA 3LNLA 5J3RA 2V41A 3M8NA 3PH9A 3GUSA 1EGOA 5DCGA 4DSSB 4NHWA 1JHBA 1JLWA 2H1BA 3WT2A 3DYRA 2LTKA 3TKRA 1QMVA 1FOHA 4H86A 5HFKA 1LTLA 2I3YA 2YWOA 2XJRA 4WFN1 1TW9A 1OKTA 16GSA 2HR5A 1X5CA 4I2TA 2DBCA 3JCML 1SJ6A 1K0DA 2N5AA 2IMEA 3CYNA 2F8FA 2AAWA 4DSRA 4K5RA 3ZITA 4KSOA 5EIOC 2CAQA 4Z2RA 2PERA 5ID2A 3WWLA 4KH7A 3IA1A 4P3YB 2YWNA 2ZUPA 2R0CA 4O5RA 4V2LA 4N10A 1N2AA 1BEDA 3QPMA 2RUEA 4G6BA 1TRWA 2WJUA 1SMWA 1B4PA 2KOKA 3VFIA 2YWMA 3IXRA 4FIWA 5D8IA 2VAFA 4JEDA 1MD4A 5F8BA 2IN3A 2AV4A 2VCQA 2CV4A 5IOXA 2HZEB 5MFPA 4G9HA 2B6MA 4XRDA 1Z6NA 2RLIA 2V6KA 5EY6A 3GMFA 5D9XA 4LHLA 4X1UA 1TK0B 4ZL7A 1JZOA 3IAS2 2ERSA 2LV3A 1FHHA 3FR9A 3F6FA 4OO5A 2LUSA 3P90A 4ECBA 4IJIA 4F0BA 2QA1A 4AGSA 2V1MA 3RPPA 5AIXA 3KH9A 1RQMA 2AHEA 1THXA 2DJJA 2RIIA 4MZBA 1EWXA 3QAVA 5IMCA 2JZSA 3ZMLA 3EYTA 1R26A 1AAZA 2B5EA 3D22A 4XS6A 1AQXA 4CDOA 3IHGA 1VF3A 2PSMC 7GSSA 3UVTA 7RXNA 2HRKA 4KF9A 1KEBA 1JLVA 2CAIA 4TRXA 3WGEA 3GRXA 3D21A 2QA2A 3P2AA 4RQXA 3IPZA 5GSTA 5F0GA 4MDCA 2H6YA 4TXOB 3M3MA 3KP8A 3KYUA 4GQCA 4POGA 2QL0A 2HFDA 2R0PA 2H8LA 6GSUA 1TP9A 1SJZA 1GSYA 2F3MA 5DDLA 4N0ZA 2MMAA 1VF2A 2Z9SA 1A23A 2YP6A 5DJLA 3UVHA 3F9UA 3VI5A 3TKSA 1HNAA 3ZYWA 4XS4B 2JI1A 1T7PB 1K0AA 1WJVA 2WFCA 3GNJA 3GX8A 1R0JA 1MD3A 5ENUA 1GWCA 2AUVA 2HSYA 2C4JA 1XVQA 4DVCA 5GAHc 5KEJA 1BX9A 3ED3A 4XTSA 1BJXA 1M9AA 2OE0A 1E6BA 2M6OA 3Q74A 4K0NA 5KOXA 4KAEA 1KTEA 3UOMA 1GSFA 5J9BA 4K9FA 2L5LA 1XBSA 1XW6A 2P5QA 4ZBAA 3DEXA 3IR4A 1G0TA 1YZXA 1EV9A 4BWSA 1NW2A 1BRFA 4EC0A 3ZZXA 1X5DA 1LKOA 4NPBA 5AI3A 4YKFA 5JWQB 2LRNA 3RPNA 5H5SA 2KLXA 2OBIA 3D5JA 4L5LA 2BE5D 2DKIA 4MNNA 5DCHA 1DE1A 2TRCP 2DJKA 2FD3A 3TRXA 1YQ1A 2VIMA 3GSTA 3Q6OA 4N30A 1LU4A 14GSA 1EP7A 4TW5A 4U671 5HFIA 4EF0A 1M0UA 2LSTA 1G6YA 3N5OA 3KGKA 4HS1A 4JAEA 4O5QA 1PL1A 4PX1A 4NHZA 4GTUA 2GSQA 2VOCA 3P8WA 1SK0A 4HQZA 5KN0A 1TXXA 5EPFA 3ZLPA 4J57E 4Q5NA 5AIVA 1ZL9A 1ERWA 1SYRA 4NV2A 5DVBA 4DSQA 5H1Sc 3LYKA 1OKDA 2FA8A 5CRDA 1VZHA 4MLYA 3WWNB 2JL4A 1W4VA 2X8GA 3DIEA 1LKPA 2FA4A 3E0UA 1AQVA 4FH8A 5JVH1 1V2AA 4TR1A 5DM61 6GSTA 2N5FA 5ECKB 4KA0A 5DAKB 4WBJA 4QQ7A 5DQYA 2ZIXA 4TXVA 1VZIA 3VWUA 1PKWA 2MMOA 4JU5A 1B4QA 1IRNA 1RDVA 2RDVA 4YH2A 4PQ1A 2O85A 1TI3A 3LORA 3MDKA 4KUNA 2HLSA 2WDUA 5B6MA 5MF6A 2GZPA 2X4AA 2CZ2A 5JWRB 2CZ3A 5INYA 4ML1A 2P0GA 4GS7D 2GS3A 4NAXA 4Z7XA 1V58A 2NTOA 1Z6MA 2IMFA 3FZAA 1YF0A 4DEJA 5MLC3 3UBKA 2QSIA 1YJ6A 4OMVA 4E6YA 1O81A 3W8JA 3L9VA 4WF4A 1T8EB 3IC4A 2K2DA 1TKDB 3WGDA 1R0IA 1SL1B 1EOHA 1WPIA 2H6ZA 2LS5A 4HOJA 5IOWA 1YUXA 3K35A 1YEXA 4XRAA 2B7KA 1EEJA 4G0KA 4IQAA 4PNFA 3EU3A 4ILFA 1RW1A 4YQUA 4BL7A 1AXDA 2JI2A 1BYEA 4MMMA 1OWBA 2A6ED 5FWGA 3S9FA 3C73A 3L9SA 1S3AA 4HZ2A 5AISA 3DRNA 4YQMA 4MJCA 1SD9A 4OFNA 4HU7A 2ON7A 2IWTA 2AJQB 3PZAA 1BAYA 1PMTA 1X9WB 1SKWB 1N8JA 1VZGA 3IOSA 4ZB9A 2OJLA 2C3TA 5B8BA 3GSSA 3GN3A 3CRUA 1TRSA 1VF4A 1SYXA 4O7HA 2OE3A 4Z2TA 4MF6A 1XOBA 3FK8A 10GSA 1QUWA 2WRTA 4F9ZA 3V1WA 1J08A 2CKAA 5CRGA 4WR5A 4AR4A 5G31A 1Z7RA 1IU5A 1M9BA 1SL0B 3PIP1 2L4QA 1TTZA 2FWHA 3FZ5A 2I9HA 2LJRA 4PTSA 5G2ZA 2O87A 3ZMKA 1AQWA 3R2QA 2C3QA 4OD7A 3KYWA 3MAKA 2IFQB 1M2DA 3ISOA 2JSZA 3PIO1 2WGRA 3DGQA 2EIRA 4ZN1B 4G19A 4B8CD 1GTAA 1AIUA 1TRVA 1Z92B 4CHSA 2O5JD 1HNBA 4GF0A 3A5IA 4K1FA 5G30A 5H5QA 3APOA 3G9BA 4AJ6A 2CA8A 3PGTA 1K0OA 3A44A 4AI0A 1SMUA 3IBHA 4HZ4A 1TI1A 1CAAA 4X0XA 1FOVA 3VPBE 4MJBA 2C8UA 2H0HA 4CY8A 3WGXA 1Z9HA 4V1Ap 1XZOA 2L0ZA 2GT5A 2H1AA 4MZCA 3GYKA 2YOIA 4PQHA 2MMNA 3IE3A 5HQPA 3O6TA 3TGZA 1I5GA 5CRWA 4MPGA 5EINC 2ES7A 2H1DA 2O7KA 2L59A 5D93A 2B5XA 2C0DA 5IMFA 5A5KA 2UZ8A 3CXGA 2BTOT 1EP8A 1NSWA 1X5EA 2HSHA 3EMXA 1GRXA 1WJKA 4KE3A 4ZILA 3CBUA 2R4VA 3ZFLA 3MWHA 5IY0A 4ZB8A 3H8QA 1HYUA 3QMXA 4POKA 3GIXA 2M6PA 2KUCA 5CP1A 1XW9A 3VI7A 1HQOA 3FMWA 4ZBBA 1O73A 4O32A 5A4UA 1FHMA 4PXOA 5J41A 1U88A 4IN0A 5B6NA 1JZRA 1T3BA 3ZREA 1J9BA 4ZL8A 1YKAA 3HZ4A 4ICYA 2M46A 5KN2A 3I43A 2CX3A 5CREA 5HR0A 3WT1A 1DBYA 2MS3A 3TJFA 5G1KA 1WE0A 1WP0A 4AJ7A 1YDKA 1ERTA 2H30A 3FY7A 1FB0A 1NNQA 1T4ZA 3KYVA 4Q5FA 3UARA 2YN1A 2H12A 3KYXA 4FYBA 2NBSA 3H1NA 2HNLA 4HUAA 1A8LA 1OYJA 4QL7A 2LJKA 1EOGA 3IK9A 2Z3QB 6RXNA 1OC9A 3DVXA 1YK4A 19GSA 5A4VA 1B2OA 2TIRA 2DC5A 2YCDA 1R0FA 5BRTA 5DQSA 1E8JA 1B9XC 3US3A 1GUHA 4K8MA 1XWBA 4LHNA 4PUAA 3LXTA 1TOFA 2L6DA 2D2ZA 3LGCA 1RDGA 1V40A 3PR8A 1FW1A 4K7OA 3L78A 4KDXA 5JCGA 4GLTA 4TR4A 5GAPD 3KD0A 4YWMA 1E2YA 3APQA 3N9JA 5EVOA 2P5RA 3Q19A 1IROA 1CQHA 4WETA 5CYYA 2GMGA 2GVPA 4MPFA 2GSRA 2MYGA 2YJ7A 2DJ0A 4MF7A 5CNWA 3DD3A 3TJBA 5J9CA 2CVKA 4AR5A 1U3AA 4GSSA 2YJHA 2NYDA 1A0FA 4YQVA 4CY6A 1JFUA 4PGTA 4POBA 4MK3A 2H66A 5GZZB 5CO3A 3EE2A 4JAGA 3HJPA 3FW2A 1BQ7A 4HDEA 3ERWA 2LRTA 3NOFA 4MH3A 1NXGA 4MP4A 4NXIA 4BVYB 4K5SA 3BJ5A 4PUFC 3EC3A 2HT9A 3U5RE 2DMMA 5BMUA 4GRFA 4EDYA 5D9WA 11GSA 1DX8A 1F9MA 1SL2B 3NIVA 3A2WA 5AI2A 3WD6A 1SU9A 2GQKA 2MMZA 2JADA 4O5UA 5COHA 4ISDA 3KYYA 4BA7A 3G7YA 1YY7A 3KEBA 3NZNA 2NDOA 4TXOA 4ECCA 3F0IA 2R0GA 2VLUA 3D6IA 2HRFA 4BVXA 3GKKA 1GL8A 1QK8A 3HHVA 4KSMA 5IQYA 1PA3A 4D73A 1WWJA 2K18A 1F2EA 3UEMA 2C6AA 4XS4A 4E8HA 4ZB6A 3MSZA 2PU9C 3ZRDA 20GSA 2E0QA 1ZYQB 1PL2A 4NMUA 2G2QA 4OFMA 1VF1A 2M4VA 4AR6A 1NM3A 4IQ1A 3ME7A 2XJTA 1M2AA 1XOAA 1X9MB 2HE3A 2PVXA 1NHYA 3CSHA 5ECMB 1B2JA 2DIZA 3GFKA 3GA4A 1PQNA 2A6HD 4OCEA 3QFBC 4GCIA 5ECPB 3TB2A 2JSYA 4POFA 1Y25A 1TDIA 1T4YA 1R0GA 1Q4JA 5LD0A 1IYHA 2R5GA 5JCUA 3F4TA 3IK7A 2A2PA 1HNCA 1SKSB 5RXNA 1U6TA 2GLRA 4EIPA 3EURA 2GSTA 1TK8B 5D9TA 2KKDA 3F8UA 1OVNA 2IL3A 3QDNA 2YPMA 4ML6A 3GTUA 1AW9A 5MFZA 1RB9A 3HDCA 2J23A 3APSA 2H72A 3F63A 2EC4A 1GULA 1WMJA 2PMTA 2VL6A 4TR0A 2OE1A 5IMDA 2GZYA 3ZFBA 3PKIA 2XJUA 2L6CA 1ML6A 3QR6A 1PSQA 1LBKA 2VD0A 3D0ZA 3M1GA 4X4JA 4ECJA 4MA9A 2RM5A 2FCHA 4WKWA 5E4WA 1OWCA 1PD21 1ST9A 3GL3A 3G7JA 4I8BA 1URMA 3GV1A 2CX4A 1QYBA 3FEUA 1A0RP 4IGJA 1M7TA 4Q5QA 3PPUA 2H0GA 1GLQA 3B0AB 3OR5A 2PN8A 2V6OA 3ZIJA 3ERGA 4UY81 4L8EA 3M9KA 4KNDA 3KH7A 3E3EA 2VCWA 1GSDA 5F06A 2N5BA 2CVDA 5DAKA 2WS2A 1YEPA 3DVWA 3QAWA 2XBIA 3VLNA 3C8EA 1USBA 1PX6A 1X0RA 8RXNA 3LJRA 1RWDA 2OACA 4OCFA 2TRXA 4QL9A 3A2VA 5GSSA 4HJMA 4MABA 4HQSA 4ZBDA 4BL7B 1ZRPA 1K0NA 2H70A 3KXOA 4XHMA 5GAGc 1RYQA 3VURA 17GSA 2GDRA 3E9JB 5FHIA 5ECOB 1O7UA 2MBTA 22GSA 5C00A 1S3CA 1A2LA 2GGTA 1IU6A 4F0CA 5ECNB 1K3LA 3RYGA 2REMA 3IRAA 3H4KA 4K2DA 1MEKA 5HR2A 1J0FA 1C09A 1OC8A 4I6XA 3LFLA 3ZVJA 2YANA 2K6VA 2IIYA 1DVBA 1O85A 2HRAA 1PKZA 1YUZA 1F3AA 6GSXA 2FGXA 3DXBA 1T00A 4KW6A 1QXHA 4F82A 1W89A 1FVJA 2VL2C 2A2SA 4MJAA 3LEFA 3QVDA 1VGLA 1ZZYA 3VPQA 2YZUA 5GADc 4V196 1ZMAA 4TVEA 1ZYEA 5F05A 1R0HA 2HRNA 4AR3A 4JADA 5E59A 2VD1A 2FWGA 3BCIA 2H76A 3RZTA 2IMIA 5D73A 1EZKA 2XHFA 1H4OA 2WB9A 2L57A 5J5NA 5D96A 5DALB 4N11A 2VM1A 4YAVA 2A69D 3KP9A 1CQGA 3TDGA 3CSJA 4KDUA 1SKRB 4WBRD 2LJAA 4LMVA 3P8BA 2GQLA 5ELGA 1Z7PA 2VCZA 2VCTA 2VCVA 2B7JA 5IPGA 4EE0A 4ULXA 2FHEA 4XS1A 2R3XA 1A2JA 4A5PA 2IFQA 2J9HA 1THOA 1HD2A 4J2FA 2PPTA 1S2ZA 2PVOC 4RI6A 4AHXA 2EIOA 4WXTA 1PX7A 4N0VA 2DIYA 2NVLA 5JVG1 5F07A 2OKAA 1GTIA 3KTBA 3LSZA 3FKFA 5ECLB 3BOAA 3EU4A 5GAEc 4O92A 1UN2A 3A5WA 1B48A 3KMOA 1SK2A 2LNSA 5GAND 2PYAA 1ERVA 3P7XA 4GSTA 2G0FA 3TJKA 1VRSD 3VWXA 1LJRA 1G6WA 4OWYA 4K7NA 1U87A 4OFTA 1JYBA 3PWFA 5ELAA 2XPDA 8GSSA 2X8HA 2H73A 2E2MA 3MIXA 4IBPA 2CT6A 4KDYA 1BFYA 3J7Yb 4GSNA 4IP6A 3F3QA 2L5OA 4RQRA 3HD5A 2R6KA 1ODHA 4TR3A 5IM9A 3LYPA 4ID0A 1R5PA 1DSBA 4G0LA 2IMKA 5IIZA 1M2BA 3FHKA 1C72A 2C0GA 2LRCA 2DKHA 3CSIA 2IPAA 3GH6A 2C0EA 3GKXA 4HJ2A 3UBLA 3B08B 1B71A 2H6XA 3U6VA 2YV9A 4MF5A 3AY8A 6GSSA 5K2ME 2VL2A 4XXBB 3TKSC 3O76A 3A2XA 2RM6A 4K0GA 1QQ2A 3QCPA 4MJEA 2ZCTA 1OE7A 5ID2B 4EDZA 5HFGA 1OAZA 4ACSA 4AI1A 1OC9B 6GSVA 4K9ZA 1XFLA 4RUVA 2DMLA 3ZL5A 1G7OA 3J7Y1 4DSSA 3LQ7A 5EL8A 2VLVA 2CQ9A 3TKSE 3WYWA 3UIWA 3GL5A 3QD9A 2E2GA 5B7CA 5CRHA 3GKNA 1LKMA 4TPUA 1WIKA 5KN3A 2V0EA 2AB6A 1T1VA 3K8NA 1XIYA 2QKEA 4EUYA 4F2IA 4WF5A 5IO0A 3GURA 2CR8A 2YNXA 5J4UA 4WR4A 1I9DA 4FYCA 3LPEB 2FLSA 1PN0A 3TRQA 2P31A 2GQMA 1PN9A 1BE7A 1PRXA 2FUG2 1IYIA 4G0IA 4AHZA 2QC7A 1FAAA 2DJ1A 3W6GA 4EKZA 1F3BA 2E7PA 2LCQA 5AN9H 2HYXA 5L71A 2KP1A 1RYTA 1G7EA 6GSWA 2HZEA 1BQ9A 4GWRA 3MSUA 2JACA 1WRYA 3KTLA 5ECRB 3HKRA 3VK9A 4IELA 4MH2A 3ZTLA 1MDIA 1ERUA 2C1YA 4IJ3A 2KP2A 2OBKA 2JI3A 1H75A 3R3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ALB A;  1K0M A;  4KCA A;  4K6X A;  4PQI A;  2K8S A;  2KHP A;  1ABA A;  1O6J A;  4POM A;  4EO3 A;  4YAP A;  1XWG A;  2PWJ A;  4HEA 2;  1O8W A;  4EVM A;  3TOT A;  3C7M A;  3RDW A;  1JZD A;  1XXU A;  2RUF A;  1MTC A;  5G1L A;  4WEY A;  2LNT A;  3H79 A;  2PBJ A;  1A24 A;  2C3N A;  1K3O A;  3RBT A;  2VUP A;  3RHB A;  4MZW A;  3PIN A;  1JZW A;  1K3Y A;  2WZ9 A;  3FR3 A;  2F8A A;  3A3T A;  1XWK A;  1YKC A;  4PUR A;  1GUK A;  3FRC A;  4BPY A;  1V9W A;  4HU9 A;  2QGV A;  2YV7 A;  1KNG A;  3C71 A;  4IW9 A;  4L5O A;  4BVY A;  3UJ1 A;  2VL3 A;  1Z5Y E;  5ECQ B;  2X99 A;  1FB6 A;  2X64 A;  3KIJ A;  2MZC A;  4J56 E;  4D73 B;  2H1G A;  1AUC A;  2LKU A;  4X43 A;  4L0U A;  2K9F A;  4IP1 A;  1UC7 A;  5DBQ A;  1RK4 A;  1NHO A;  1A8Y A;  4IHU A;  3HVS A;  3LXZ A;  2LEG A;  2FWF A;  1UVZ A;  3D4T A;  3TJG A;  3FR6 A;  3EWL A;  2ON5 A;  4LMW A;  3J7Y k;  2V32 A;  1GSE A;  1R5A A;  3TOU A;  1ZCP A;  5IMV A;  3EIN A;  1XPV A;  1GSS A;  1ZOF A;  4G10 A;  5JCW A;  3F6D A;  2BMX A;  4KGI A;  1XCC A;  1B8X A;  5AN1 A;  3HXS A;  1QFN A;  5CAX A;  3G7I A;  3HA9 A;  4ZL9 A;  5IO2 A;  2HXK A;  2OAD A;  1XWC A;  3ERF A;  5HR1 A;  2H71 A;  5KN1 A;  3HJM A;  5LCZ A;  1SK1 A;  2F51 A;  1V57 A;  3F3R A;  2I4A A;  3ZIV A;  1SD8 A;  4JR4 A;  4KB3 A;  3TKP A;  1M99 A;  4AJ8 A;  2XBQ A;  1TRU A;  4FO5 A;  4RI7 A;  2XC2 A;  3BBY A;  18GS A;  1GUM A;  5B8A A;  3EVI A;  4EL1 A;  2IJY A;  5LNK e;  4TN8 A;  2M72 A;  3FZ4 A;  3GTU B;  5ECS A;  4KX4 A;  5H5R A;  3SBC A;  4POL A;  3F4S A;  4ZIJ A;  5HR3 A;  3BCK A;  2DSA A;  13GS A;  3CTF A;  1ZGN A;  4I5Q A;  1QGV A;  1U3I A;  4XCS A;  3KZQ A;  2R2J A;  5IMZ A;  2K8V A;  4BWQ A;  4TR1 B;  2VLT A;  5ECI B;  2H0I A;  4JR6 A;  2X8C A;  2ZNM A;  3GHA A;  1BG5 A;  3KM6 A;  3RAZ A;  4LLR A;  1ILO A;  3L9U A;  2V2G A;  3TRP A;  1ACV A;  3L4N A;  2C0F A;  3ME8 A;  4PNG A;  2H01 A;  4F03 A;  3D4M A;  2BJX A;  1ON4 A;  6GSY A;  3KMN A;  5G5E A;  1GLP A;  3L0H A;  1EEM A;  5ECH B;  2C80 A;  2LQQ A;  3HCZ A;  4IS0 A;  3CRT A;  4ECI A;  4LL4 B;  2B3S A;  1TJD A;  2DJ2 A;  3I69 A;  1S3D A;  2PGT A;  2I81 A;  3LWA A;  1PGT A;  3HVX A;  3TJJ A;  1WOU A;  3HZ8 A;  3FZ9 A;  4OO4 A;  3GKM A;  2DJ3 A;  2WUL A;  4V1A g;  12GS A;  3DWV A;  3BD2 A;  3Q18 A;  4TKY A;  2WCI A;  2YZH A;  4JZQ A;  1XVW A;  1Y6E A;  2H74 A;  5G5F A;  3I6A A;  2VL9 A;  1R4W A;  2C6B A;  5D9V A;  3VWV A;  4IVF A;  2M80 A;  2A4V A;  3C1S A;  2PVQ A;  2GZZ A;  2GT6 A;  3KCM A;  4XIH A;  3CMI A;  3HVV A;  1TU7 A;  4CW9 A;  2FNO A;  1DE2 A;  3TCO A;  3IDV A;  1KBN A;  4MCU A;  2O8V B;  2EIQ A;  1TK5 B;  3IAM 2;  3M9J A;  4I2U A;  3DKS A;  3SWL A;  1MDJ A;  2PUK C;  4EXJ A;  3CTG A;  3VWW A;  1Q98 A;  3QFA C;  2B5Y A;  2YWI A;  4K7I A;  1GNE A;  1TU8 A;  2H19 A;  3HY2 A;  1V98 A;  3UAP A;  1Z3E A;  3GH9 A;  2DLX A;  1DUG A;  2FY6 A;  3QAG A;  2R37 A;  1SEN A;  1GTB A;  2A2R A;  9GSS A;  2F9S A;  4Q5R A;  4GXZ A;  3UL3 A;  1F6M C;  3QOU A;  1FVK A;  3EMP A;  5C04 A;  2JU5 A;  3LG6 A;  4L0W A;  1FO5 A;  1GP1 A;  1GTU A;  2O89 A;  2VO4 A;  1AC1 A;  1A2M A;  3KJY A;  3RHC A;  3UMA A;  3ZVJ D;  2MBS A;  4V2N A;  3IHQ A;  4ZXG A;  1FG4 A;  3I9V 2;  4AF2 A;  3F4R A;  4LL1 B;  1GSU A;  5DAL A;  3DML A;  1XWA A;  2GSS A;  1MDK A;  3C1R A;  1EV4 A;  2B1K A;  2VCX A;  2I1U A;  2L4C A;  3GX0 A;  4FYU A;  1GSQ A;  2H75 A;  1F37 A;  1X9S B;  4TOP A;  1B9Y C;  1GH2 A;  4E8E A;  2XPE A;  2LQO A;  3MNG A;  3TUE A;  1UA5 A;  2VM2 A;  4IKH A;  5IPH A;  1R7H A;  2HZF A;  1O8X A;  5IMA A;  1XW5 A;  3IV4 A;  3HJO A;  5AGY A;  1SJI A;  5ABR A;  1FHE A;  2CVB A;  3M0F A;  4NV5 A;  1OC3 A;  2B1L A;  4V2M A;  3FYG A;  3VPT A;  5JWO B;  4LA1 A;  5A4W A;  1K0C A;  1YF1 A;  2NPB A;  2GTU A;  3HYP A;  2JZT A;  1K0B A;  1OE8 A;  4JRR A;  3W8S A;  2HI7 A;  4NWY A;  3O3T A;  3TKQ A;  4KCE A;  4GQF A;  4HI7 A;  2JZR A;  4JBB A;  2J9U B;  4I97 A;  4JE1 A;  1EGR A;  2OA7 A;  2AYT A;  2FWE A;  5DJM A;  5FT3 A;  2IMD A;  3H93 A;  4G2E A;  1GNW A;  5J3R A;  2V41 A;  3M8N A;  3PH9 A;  3GUS A;  1EGO A;  5DCG A;  4DSS B;  4NHW A;  1JHB A;  1JLW A;  2H1B A;  3WT2 A;  3DYR A;  2LTK A;  3TKR A;  1QMV A;  4H86 A;  5HFK A;  2I3Y A;  2YWO A;  1TW9 A;  1OKT A;  16GS A;  1X5C A;  4I2T A;  2DBC A;  3JCM L;  1SJ6 A;  1K0D A;  2N5A A;  2IME A;  3CYN A;  2F8F A;  2AAW A;  4DSR A;  3ZIT A;  4KSO A;  2CAQ A;  2PER A;  5ID2 A;  4KH7 A;  3IA1 A;  4P3Y B;  2YWN A;  2ZUP A;  4O5R A;  4V2L A;  4N10 A;  1N2A A;  1BED A;  3QPM A;  2RUE A;  1TRW A;  2WJU A;  1B4P A;  2KOK A;  3VFI A;  2YWM A;  3IXR A;  4FIW A;  5D8I A;  2VAF A;  4JED A;  1MD4 A;  5F8B A;  2IN3 A;  2AV4 A;  2VCQ A;  2CV4 A;  5IOX A;  2HZE B;  4G9H A;  2B6M A;  4XRD A;  1Z6N A;  2RLI A;  2V6K A;  5EY6 A;  3GMF A;  5D9X A;  4X1U A;  1TK0 B;  4ZL7 A;  1JZO A;  3IAS 2;  2LV3 A;  3FR9 A;  3F6F A;  4OO5 A;  2LUS A;  3P90 A;  4ECB A;  4IJI A;  4F0B A;  4AGS A;  2V1M A;  3RPP A;  5AIX A;  3KH9 A;  1RQM A;  2AHE A;  1THX A;  2DJJ A;  2RII A;  4MZB A;  1EWX A;  3QAV A;  5IMC A;  2JZS A;  3ZML A;  3EYT A;  1R26 A;  1AAZ A;  2B5E A;  3D22 A;  4XS6 A;  1AQX A;  4CDO A;  1VF3 A;  7GSS A;  3UVT A;  1KEB A;  1JLV A;  2CAI A;  4TRX A;  3WGE A;  3GRX A;  3D21 A;  3P2A A;  4RQX A;  3IPZ A;  5GST A;  5F0G A;  4MDC A;  2H6Y A;  4TXO B;  3M3M A;  3KP8 A;  4GQC A;  2HFD A;  2H8L A;  6GSU A;  1TP9 A;  1SJZ A;  1GSY A;  2F3M A;  5DDL A;  4N0Z A;  2MMA A;  1VF2 A;  2Z9S A;  1A23 A;  2YP6 A;  5DJL A;  3UVH A;  3F9U A;  3VI5 A;  3TKS A;  1HNA A;  3ZYW A;  4XS4 B;  1T7P B;  1K0A A;  2WFC A;  3GNJ A;  3GX8 A;  1MD3 A;  5ENU A;  1GWC A;  2AUV A;  2HSY A;  2C4J A;  1XVQ A;  4DVC A;  5KEJ A;  1BX9 A;  3ED3 A;  4XTS A;  1BJX A;  1M9A A;  2OE0 A;  1E6B A;  3Q74 A;  4K0N A;  4KAE A;  1KTE A;  3UOM A;  1GSF A;  5J9B A;  2L5L A;  1XBS A;  1XW6 A;  2P5Q A;  4ZBA A;  3DEX A;  3IR4 A;  1G0T A;  1YZX A;  1EV9 A;  4BWS A;  1NW2 A;  4EC0 A;  3ZZX A;  1X5D A;  4NPB A;  5JWQ B;  2LRN A;  3RPN A;  5H5S A;  2KLX A;  2OBI A;  3D5J A;  4L5L A;  5DCH A;  1DE1 A;  2TRC P;  2DJK A;  2FD3 A;  3TRX A;  1YQ1 A;  2VIM A;  3GST A;  3Q6O A;  4N30 A;  1LU4 A;  14GS A;  1EP7 A;  4TW5 A;  5HFI A;  4EF0 A;  1M0U A;  2LST A;  1G6Y A;  3N5O A;  3KGK A;  4HS1 A;  1PL1 A;  4PX1 A;  4NHZ A;  4GTU A;  2GSQ A;  2VOC A;  3P8W A;  1SK0 A;  4HQZ A;  5KN0 A;  1TXX A;  5EPF A;  3ZLP A;  4J57 E;  4Q5N A;  5AIV A;  1ZL9 A;  1ERW A;  1SYR A;  4NV2 A;  5DVB A;  4DSQ A;  3LYK A;  1OKD A;  2FA8 A;  5CRD A;  4MLY A;  2JL4 A;  1W4V A;  2X8G A;  3DIE A;  2FA4 A;  3E0U A;  1AQV A;  4FH8 A;  1V2A A;  4TR1 A;  6GST A;  2N5F A;  5ECK B;  4KA0 A;  5DAK B;  4WBJ A;  4QQ7 A;  5DQY A;  4TXV A;  3VWU A;  1PKW A;  2MMO A;  4JU5 A;  1B4Q A;  4YH2 A;  4PQ1 A;  2O85 A;  1TI3 A;  3LOR A;  3MDK A;  4KUN A;  2HLS A;  2WDU A;  5B6M A;  2GZP A;  2CZ2 A;  5JWR B;  2CZ3 A;  5INY A;  4ML1 A;  2P0G A;  2GS3 A;  4NAX A;  4Z7X A;  1V58 A;  2NTO A;  1Z6M A;  2IMF A;  3FZA A;  1YF0 A;  4DEJ A;  3UBK A;  2QSI A;  1YJ6 A;  4OMV A;  1O81 A;  3W8J A;  3L9V A;  4WF4 A;  1T8E B;  3IC4 A;  1TKD B;  3WGD A;  1SL1 B;  1EOH A;  1WPI A;  2H6Z A;  2LS5 A;  4HOJ A;  5IOW A;  1YEX A;  4XRA A;  2B7K A;  1EEJ A;  4IQA A;  4PNF A;  3EU3 A;  4ILF A;  1RW1 A;  4YQU A;  4BL7 A;  1AXD A;  1BYE A;  4MMM A;  5FWG A;  3S9F A;  3C73 A;  3L9S A;  1S3A A;  4HZ2 A;  5AIS A;  3DRN A;  4YQM A;  4MJC A;  1SD9 A;  4OFN A;  4HU7 A;  2ON7 A;  2IWT A;  2AJQ B;  1BAY A;  1PMT A;  1X9W B;  1SKW B;  1N8J A;  3IOS A;  4ZB9 A;  2OJL A;  2C3T A;  5B8B A;  3GSS A;  3GN3 A;  3CRU A;  1TRS A;  1VF4 A;  1SYX A;  4O7H A;  2OE3 A;  4MF6 A;  1XOB A;  3FK8 A;  10GS A;  1QUW A;  2WRT A;  4F9Z A;  3V1W A;  1J08 A;  5CRG A;  4WR5 A;  5G31 A;  1Z7R A;  1M9B A;  1SL0 B;  2L4Q A;  1TTZ A;  2FWH A;  3FZ5 A;  2I9H A;  2LJR A;  5G2Z A;  2O87 A;  3ZMK A;  1AQW A;  3R2Q A;  2C3Q A;  4OD7 A;  3MAK A;  2IFQ B;  1M2D A;  3ISO A;  2JSZ A;  2WGR A;  3DGQ A;  2EIR A;  4G19 A;  1GTA A;  1AIU A;  1TRV A;  4CHS A;  1HNB A;  4GF0 A;  4K1F A;  5G30 A;  5H5Q A;  3APO A;  3G9B A;  4AJ6 A;  2CA8 A;  3PGT A;  1K0O A;  3IBH A;  4HZ4 A;  1TI1 A;  4X0X A;  1FOV A;  4MJB A;  2C8U A;  2H0H A;  3WGX A;  1Z9H A;  4V1A p;  1XZO A;  2GT5 A;  2H1A A;  4MZC A;  3GYK A;  2YOI A;  4PQH A;  2MMN A;  3IE3 A;  5HQP A;  3O6T A;  3TGZ A;  1I5G A;  5CRW A;  4MPG A;  2ES7 A;  2H1D A;  2O7K A;  2L59 A;  5D93 A;  2B5X A;  2C0D A;  5IMF A;  5A5K A;  3CXG A;  2BTO T;  1EP8 A;  1NSW A;  1X5E A;  2HSH A;  3EMX A;  1GRX A;  1WJK A;  4KE3 A;  4ZIL A;  3CBU A;  2R4V A;  3ZFL A;  3MWH A;  4ZB8 A;  3H8Q A;  1HYU A;  3QMX A;  4POK A;  3GIX A;  2KUC A;  5CP1 A;  1XW9 A;  3VI7 A;  1HQO A;  4ZBB A;  1O73 A;  4O32 A;  5A4U A;  4PXO A;  5J41 A;  1U88 A;  4IN0 A;  5B6N A;  1JZR A;  1T3B A;  3ZRE A;  1J9B A;  4ZL8 A;  1YKA A;  3HZ4 A;  2M46 A;  5KN2 A;  3I43 A;  2CX3 A;  5CRE A;  5HR0 A;  3WT1 A;  1DBY A;  3TJF A;  5G1K A;  1WE0 A;  1WP0 A;  4AJ7 A;  1YDK A;  1ERT A;  2H30 A;  3FY7 A;  1FB0 A;  1T4Z A;  3UAR A;  4Q5F A;  2YN1 A;  4FYB A;  2NBS A;  3H1N A;  2HNL A;  4HUA A;  1A8L A;  1OYJ A;  4QL7 A;  2LJK A;  1EOG A;  3IK9 A;  1OC9 A;  3DVX A;  19GS A;  5A4V A;  2TIR A;  2DC5 A;  2YCD A;  5DQS A;  1B9X C;  3US3 A;  1GUH A;  4K8M A;  1XWB A;  4PUA A;  3LXT A;  1TOF A;  2L6D A;  2D2Z A;  3LGC A;  1V40 A;  3PR8 A;  1FW1 A;  4K7O A;  3L78 A;  4KDX A;  5JCG A;  4GLT A;  4TR4 A;  5GAP D;  3KD0 A;  1E2Y A;  3APQ A;  3N9J A;  5EVO A;  2P5R A;  3Q19 A;  1CQH A;  4WET A;  5CYY A;  2GVP A;  4MPF A;  2GSR A;  2MYG A;  2YJ7 A;  2DJ0 A;  4MF7 A;  5CNW A;  3DD3 A;  3TJB A;  5J9C A;  2CVK A;  1U3A A;  4GSS A;  2YJH A;  1A0F A;  4YQV A;  1JFU A;  4PGT A;  4POB A;  4MK3 A;  2H66 A;  5GZZ B;  5CO3 A;  3EE2 A;  3HJP A;  3FW2 A;  1BQ7 A;  4HDE A;  3ERW A;  2LRT A;  3NOF A;  4MH3 A;  4MP4 A;  4NXI A;  3BJ5 A;  4PUF C;  3EC3 A;  2HT9 A;  3U5R E;  2DMM A;  4GRF A;  4EDY A;  5D9W A;  11GS A;  1F9M A;  1SL2 B;  3NIV A;  3A2W A;  3WD6 A;  1SU9 A;  2GQK A;  2MMZ A;  2JAD A;  5COH A;  4ISD A;  4BA7 A;  3G7Y A;  1YY7 A;  3KEB A;  3NZN A;  2NDO A;  4TXO A;  4ECC A;  3F0I A;  2VLU A;  3D6I A;  2HRF A;  4BVX A;  3GKK A;  1GL8 A;  1QK8 A;  3HHV A;  4KSM A;  5IQY A;  1PA3 A;  4D73 A;  1WWJ A;  2K18 A;  1F2E A;  3UEM A;  2C6A A;  4XS4 A;  4E8H A;  4ZB6 A;  3MSZ A;  2PU9 C;  3ZRD A;  20GS A;  2E0Q A;  1ZYQ B;  1PL2 A;  4NMU A;  2G2Q A;  4OFM A;  1VF1 A;  1NM3 A;  4IQ1 A;  3ME7 A;  1M2A A;  1XOA A;  1X9M B;  2HE3 A;  1NHY A;  3CSH A;  5ECM B;  2DIZ A;  3GFK A;  3GA4 A;  1PQN A;  4OCE A;  3QFB C;  4GCI A;  5ECP B;  3TB2 A;  2JSY A;  1Y25 A;  1TDI A;  1T4Y A;  1Q4J A;  5LD0 A;  1IYH A;  2R5G A;  5JCU A;  3F4T A;  3IK7 A;  1HNC A;  1SKS B;  1U6T A;  2GLR A;  3EUR A;  2GST A;  1TK8 B;  5D9T A;  3F8U A;  1OVN A;  2IL3 A;  3QDN A;  2YPM A;  4ML6 A;  3GTU A;  1AW9 A;  3HDC A;  2J23 A;  3APS A;  2H72 A;  3F63 A;  2EC4 A;  1GUL A;  1WMJ A;  2PMT A;  4TR0 A;  2OE1 A;  5IMD A;  2GZY A;  3ZFB A;  2L6C A;  1ML6 A;  3QR6 A;  1PSQ A;  1LBK A;  2VD0 A;  3D0Z A;  3M1G A;  4ECJ A;  4MA9 A;  2RM5 A;  2FCH A;  4WKW A;  5E4W A;  1PD2 1;  1ST9 A;  3GL3 A;  3G7J A;  4I8B A;  1URM A;  3GV1 A;  2CX4 A;  3FEU A;  1A0R P;  4IGJ A;  1M7T A;  4Q5Q A;  2H0G A;  1GLQ A;  3B0A B;  3OR5 A;  2PN8 A;  2V6O A;  3ZIJ A;  3ERG A;  4L8E A;  3M9K A;  4KND A;  3KH7 A;  3E3E A;  2VCW A;  1GSD A;  5F06 A;  2N5B A;  2CVD A;  5DAK A;  2WS2 A;  1YEP A;  3DVW A;  3QAW A;  2XBI A;  3VLN A;  3C8E A;  1USB A;  1PX6 A;  1X0R A;  3LJR A;  2OAC A;  4OCF A;  2TRX A;  4QL9 A;  3A2V A;  5GSS A;  4HJM A;  4MAB A;  4HQS A;  4ZBD A;  1K0N A;  2H70 A;  3KXO A;  4XHM A;  3VUR A;  17GS A;  2GDR A;  3E9J B;  5FHI A;  5ECO B;  1O7U A;  2MBT A;  22GS A;  5C00 A;  1S3C A;  1A2L A;  2GGT A;  4F0C A;  5ECN B;  1K3L A;  2REM A;  3IRA A;  3H4K A;  4K2D A;  1MEK A;  5HR2 A;  1J0F A;  1OC8 A;  4I6X A;  3LFL A;  3ZVJ A;  2YAN A;  2K6V A;  2IIY A;  1O85 A;  1PKZ A;  1F3A A;  6GSX A;  2FGX A;  3DXB A;  1T00 A;  4KW6 A;  1QXH A;  4F82 A;  1W89 A;  1FVJ A;  2VL2 C;  2A2S A;  4MJA A;  3LEF A;  1VGL A;  1ZZY A;  3VPQ A;  2YZU A;  1ZMA A;  4TVE A;  1ZYE A;  5F05 A;  2HRN A;  5E59 A;  2VD1 A;  2FWG A;  3BCI A;  2H76 A;  2IMI A;  5D73 A;  1EZK A;  2XHF A;  1H4O A;  2WB9 A;  2L57 A;  5J5N A;  5D96 A;  5DAL B;  4N11 A;  2VM1 A;  4YAV A;  3KP9 A;  1CQG A;  3TDG A;  3CSJ A;  4KDU A;  1SKR B;  4WBR D;  2LJA A;  4LMV A;  2GQL A;  5ELG A;  1Z7P A;  2VCZ A;  2VCT A;  2VCV A;  2B7J A;  5IPG A;  4EE0 A;  4ULX A;  2FHE A;  4XS1 A;  2R3X A;  1A2J A;  2IFQ A;  2J9H A;  1THO A;  1HD2 A;  4J2F A;  2PPT A;  2PVO C;  4RI6 A;  2EIO A;  4WXT A;  1PX7 A;  4N0V A;  2DIY A;  2NVL A;  5F07 A;  2OKA A;  1GTI A;  3KTB A;  3LSZ A;  3FKF A;  5ECL B;  3BOA A;  3EU4 A;  4O92 A;  1UN2 A;  3A5W A;  1B48 A;  3KMO A;  1SK2 A;  2LNS A;  5GAN D;  1ERV A;  3P7X A;  4GST A;  2G0F A;  3TJK A;  1VRS D;  3VWX A;  1LJR A;  1G6W A;  4OWY A;  4K7N A;  1U87 A;  4OFT A;  5ELA A;  2XPD A;  8GSS A;  2X8H A;  2H73 A;  2E2M A;  4IBP A;  2CT6 A;  4KDY A;  3J7Y b;  4GSN A;  4IP6 A;  4RQR A;  2L5O A;  3F3Q A;  3HD5 A;  2R6K A;  4TR3 A;  5IM9 A;  3LYP A;  4ID0 A;  1R5P A;  1DSB A;  2IMK A;  5IIZ A;  1M2B A;  3FHK A;  1C72 A;  2C0G A;  2LRC A;  3CSI A;  2IPA A;  3GH6 A;  2C0E A;  3GKX A;  4HJ2 A;  3UBL A;  3B08 B;  2H6X A;  3U6V A;  2YV9 A;  4MF5 A;  3AY8 A;  6GSS A;  2VL2 A;  4XXB B;  3TKS C;  3O76 A;  3A2X A;  2RM6 A;  4K0G A;  1QQ2 A;  3QCP A;  4MJE A;  2ZCT A;  1OE7 A;  5ID2 B;  4EDZ A;  5HFG A;  1OAZ A;  4ACS A;  1OC9 B;  6GSV A;  4K9Z A;  1XFL A;  4RUV A;  2DML A;  3ZL5 A;  1G7O A;  4DSS A;  3LQ7 A;  5EL8 A;  2VLV A;  2CQ9 A;  3TKS E;  3WYW A;  3UIW A;  3GL5 A;  3QD9 A;  2E2G A;  5B7C A;  5CRH A;  3GKN A;  1WIK A;  5KN3 A;  2AB6 A;  1T1V A;  3K8N A;  1XIY A;  2QKE A;  4EUY A;  4F2I A;  4WF5 A;  5IO0 A;  3GUR A;  2YNX A;  5J4U A;  4WR4 A;  1I9D A;  4FYC A;  2FLS A;  3TRQ A;  2P31 A;  2GQM A;  1PN9 A;  1PRX A;  2FUG 2;  1IYI A;  2QC7 A;  1FAA A;  2DJ1 A;  3W6G A;  4EKZ A;  1F3B A;  2E7P A;  2HYX A;  5L71 A;  2KP1 A;  1G7E A;  6GSW A;  2HZE A;  4GWR A;  2JAC A;  1WRY A;  3KTL A;  5ECR B;  3HKR A;  3VK9 A;  4IEL A;  4MH2 A;  3ZTL A;  1MDI A;  1ERU A;  2C1Y A;  4IJ3 A;  2KP2 A;  2OBK A;  1H75 A; 
#chains in the Genus database with same CATH topology
 1VCX A;  3H97 A;  4AHW A;  2ALB A;  1K0M A;  4KCA A;  4K6X A;  4PQI A;  2K8S A;  2KHP A;  1ABA A;  1O6J A;  4POM A;  4EO3 A;  4YAP A;  1XWG A;  2JA6 L;  2PWJ A;  4HEA 2;  1O8W A;  4EVM A;  3TOT A;  3C7M A;  3LWV B;  3RDW A;  4XGH A;  1JZD A;  1XXU A;  1MTC A;  2RUF A;  5G1L A;  2E2H L;  4WEY A;  2LNT A;  3H79 A;  2PBJ A;  1A24 A;  2C3N A;  1K3O A;  3RBT A;  2A68 D;  2VUP A;  3RHB A;  4MZW A;  3PIN A;  1JZW A;  1K3Y A;  2WZ9 A;  3FR3 A;  2F8A A;  3PO3 L;  3A3T A;  1XWK A;  1YKC A;  4BVX B;  4PUR A;  1GUK A;  3FRC A;  4BPY A;  1V9W A;  4HU9 A;  2QGV A;  2YV7 A;  4RXN A;  1KNG A;  3C71 A;  4IW9 A;  4L5O A;  4BVY A;  3UJ1 A;  2VL3 A;  1Z5Y E;  5ECQ B;  2X99 A;  1FB6 A;  2X64 A;  3KIJ A;  4K2X A;  2MZC A;  4J56 E;  4D73 B;  2H1G A;  1AUC A;  2LKU A;  4X43 A;  4L0U A;  1PZX A;  2K9F A;  4IP1 A;  1UC7 A;  5DBQ A;  1RK4 A;  1NHO A;  1S3R A;  1A8Y A;  4IHU A;  3HVS A;  3LXZ A;  2Y0S P;  1PFV A;  2LEG A;  2FWF A;  1UVZ A;  3D4T A;  3TJG A;  3FR6 A;  3EWL A;  2ON5 A;  4LMW A;  3J7Z 1;  3J7Y k;  2V32 A;  1GSE A;  1R5A A;  3TOU A;  1ZCP A;  5IMV A;  3EIN A;  1XPV A;  1GSS A;  1ZOF A;  4G10 A;  4AI2 A;  5JCW A;  3F6D A;  2BMX A;  4KGI A;  1XCC A;  1B8X A;  5AN1 A;  2AQC A;  2ERJ A;  3HXS A;  1QFN A;  5CAX A;  3G7I A;  3HA9 A;  4ZL9 A;  5IO2 A;  2HXK A;  2OAD A;  1XWC A;  3ERF A;  5HR1 A;  2H71 A;  5KN1 A;  3HJM A;  2X49 A;  5LCZ A;  1SK1 A;  2F51 A;  1V57 A;  3F3R A;  2I4A A;  3ZIV A;  1SD8 A;  4JR4 A;  4KB3 A;  3TKP A;  1M99 A;  4AJ8 A;  2XBQ A;  1TRU A;  4FO5 A;  4RI7 A;  2XC2 A;  3BBY A;  4Z2U A;  18GS A;  1GUM A;  5B8A A;  3EVI A;  4EL1 A;  2IJY A;  5LNK e;  1WCM L;  4TN8 A;  2M72 A;  3FZ4 A;  3GTU B;  5ECS A;  4KX4 A;  5H5R A;  3SBC A;  4POL A;  3F4S A;  4ZIJ A;  5HR3 A;  3RZ6 A;  3S1R L;  3BCK A;  2DSA A;  13GS A;  3S14 L;  3CTF A;  1ZGN A;  1F4L A;  4I5Q A;  1QGV A;  3HJY B;  1U3I A;  4XCS A;  2B5I D;  3KZQ A;  2R2J A;  5IMZ A;  2K8V A;  4BWQ A;  4Y7N L;  4TR1 B;  1TWF L;  2VLT A;  5ECI B;  2H0I A;  4JR6 A;  2X8C A;  1NXE A;  2ZNM A;  3GHA A;  1BG5 A;  2M4Y A;  3KM6 A;  3RAZ A;  4LLR A;  1ILO A;  4C3I L;  3L9U A;  2V2G A;  3TRP A;  1ACV A;  3L4N A;  2C0F A;  3ME8 A;  4PNG A;  2H01 A;  4F03 A;  3D4M A;  2BJX A;  1ON4 A;  6GSY A;  3KMN A;  5G5E A;  1GLP A;  3L0H A;  1EEM A;  5ECH B;  2C80 A;  2LQQ A;  1YK5 A;  4AI3 A;  4A3J L;  3HCZ A;  2KN9 A;  4IS0 A;  3CRT A;  4ECI A;  4LL4 B;  2B3S A;  2Z3R B;  1TJD A;  3FDJ A;  2DJ2 A;  1YV1 A;  3I69 A;  2XJQ A;  2JA7 L;  1S3D A;  2PGT A;  2I81 A;  3LWA A;  1PGT A;  4ME3 A;  3HVX A;  5MGN A;  3TJJ A;  1WOU A;  3HZ8 A;  1ZYN A;  3FZ9 A;  4OO4 A;  3GKM A;  2V3B B;  1CAD A;  1T9P A;  2DJ3 A;  2WUL A;  4V1A g;  12GS A;  3DWV A;  3BD2 A;  3Q18 A;  4TKY A;  2WCI A;  4USS A;  3HOV L;  2YZH A;  4JZQ A;  2NVQ L;  1XVW A;  1Y6E A;  2H74 A;  2DSX A;  5G5F A;  3I6A A;  2VL9 A;  4A3K L;  2V0F A;  1R4W A;  2XJP A;  2C6B A;  5D9V A;  3VWV A;  4IVF A;  3QQC E;  2M80 A;  2A4V A;  2AUS B;  3C1S A;  2PVQ A;  4AHY A;  2GZZ A;  2GT6 A;  3GTL L;  3KCM A;  4XIH A;  1H7V A;  4YWL A;  3CMI A;  3HVV A;  1TU7 A;  3S15 L;  4CW9 A;  2FNO A;  1DE2 A;  3TCO A;  3IDV A;  1KBN A;  4MCU A;  2PMZ P;  2PVE A;  2EIQ A;  2O8V B;  1TK5 B;  3IAM 2;  2AYJ A;  3M9J A;  4I2U A;  4YKG A;  3DKS A;  3SWL A;  1MDJ A;  2PUK C;  5KOW A;  4EXJ A;  3CTG A;  3VWW A;  1IW7 D;  4TVM A;  1Q98 A;  3QFA C;  2B5Y A;  1QCV A;  2YWI A;  4K7I A;  1GNE A;  1ZYP A;  1TU8 A;  2H19 A;  3HY2 A;  1V98 A;  3UAP A;  1Z3E A;  3GH9 A;  2DLX A;  1DUG A;  4JAF A;  2FY6 A;  3QAG A;  2R37 A;  1SEN A;  2RFK B;  1GTB A;  2A2R A;  9GSS A;  2F9S A;  4Q5R A;  3ZG6 A;  4GXZ A;  3IC8 A;  2HSM A;  3UL3 A;  1F6M C;  3QOU A;  1FVK A;  3EMP A;  5C04 A;  2JU5 A;  3LG6 A;  4L0W A;  1FO5 A;  1GP1 A;  1GTU A;  2O89 A;  2VO4 A;  1AC1 A;  1A2M A;  3KJY A;  1T9O A;  2XJS A;  3RHC A;  3EPT A;  3UMA A;  3ZVJ D;  4FQU A;  2MBS A;  3MYD A;  5M3F L;  4V2N A;  3IHQ A;  2XJV A;  4ZXG A;  3GTG L;  1FG4 A;  3IU3 I;  3I9V 2;  3F4R A;  4AF2 A;  4LL1 B;  5DM7 1;  1GSU A;  5DAL A;  3S2H L;  3DML A;  1XWA A;  2GSS A;  1MDK A;  3C1R A;  1EV4 A;  2B1K A;  2VCX A;  2I1U A;  3SS2 A;  2L4C A;  3GX0 A;  4FYU A;  1GSQ A;  2H75 A;  1F37 A;  1X9S B;  4TOP A;  4ZN3 B;  4A3M L;  1B9Y C;  1S24 A;  1GH2 A;  4E8E A;  2XPE A;  1BQ8 A;  2LQO A;  4A3E L;  3MNG A;  3TUE A;  1UA5 A;  2VM2 A;  4IKH A;  5IPH A;  1R7H A;  2HZF A;  1O8X A;  5IMA A;  1XW5 A;  3MPS A;  3IV4 A;  3HJO A;  5AGY A;  2A4H A;  1SJI A;  5ABR A;  1FHE A;  4EIQ A;  1S30 A;  2CVB A;  3M0F A;  4NV5 A;  1OC3 A;  1SMM A;  2B1L A;  4V2M A;  3FYG A;  2CKC A;  1B13 A;  3VPT A;  5JWO B;  3PKJ A;  4LA1 A;  5A4W A;  1K0C A;  1YF1 A;  3HOW L;  2NPB A;  2GTU A;  3HYP A;  2JZT A;  1K0B A;  3LW9 A;  1OE8 A;  4JRR A;  3W8S A;  2HI7 A;  1T9Q A;  3NFP I;  4NWY A;  3O3T A;  3TKQ A;  3GTK L;  4KCE A;  4GQF A;  4HI7 A;  2JZR A;  4JBB A;  2J9U B;  5IYC L;  4I97 A;  4JE1 A;  2OA7 A;  1EGR A;  3CQF A;  2AYT A;  2FWE A;  5DJM A;  5FT3 A;  2IMD A;  3H93 A;  4G2E A;  1GNW A;  3LNL A;  4A3D L;  5M5X L;  5J3R A;  2V41 A;  1I50 L;  3M8N A;  3PH9 A;  4QIW P;  3GUS A;  1EGO A;  5DCG A;  4DSS B;  4NHW A;  1JHB A;  1JLW A;  2H1B A;  3WT2 A;  3DYR A;  2LTK A;  3TKR A;  1QMV A;  1FOH A;  4H86 A;  5HFK A;  1LTL A;  2I3Y A;  2YWO A;  2XJR A;  4WFN 1;  1TW9 A;  1OKT A;  16GS A;  2HR5 A;  1Y1V L;  1X5C A;  4I2T A;  2DBC A;  3JCM L;  1SJ6 A;  1K0D A;  2N5A A;  2IME A;  3CYN A;  2F8F A;  2AAW A;  4DSR A;  4K5R A;  3ZIT A;  4KSO A;  5EIO C;  2CAQ A;  1TWG L;  5M3M L;  4Z2R A;  2PER A;  5ID2 A;  3WWL A;  4KH7 A;  3IA1 A;  4P3Y B;  2YWN A;  2ZUP A;  2R0C A;  2HVY C;  4O5R A;  4V2L A;  4N10 A;  5C4J L;  1BED A;  1N2A A;  3QPM A;  2RUE A;  4G6B A;  1TRW A;  2WJU A;  1SMW A;  1SFO L;  1B4P A;  2KOK A;  3VFI A;  3H99 A;  2YWM A;  3JR7 A;  3IXR A;  4FIW A;  5D8I A;  2VAF A;  4JED A;  1MD4 A;  5F8B A;  2IN3 A;  2AV4 A;  2VCQ A;  2CV4 A;  5IOX A;  2HZE B;  5MFP A;  4G9H A;  2B6M A;  4XRD A;  1Z6N A;  3RZO L;  2RLI A;  2V6K A;  5EY6 A;  3GMF A;  5D9X A;  4LHL A;  4X1U A;  1TK0 B;  4ZL7 A;  1JZO A;  3IAS 2;  2ERS A;  2LV3 A;  1FHH A;  3FR9 A;  3F6F A;  4OO5 A;  2LUS A;  3P90 A;  4ECB A;  1P7P A;  4IJI A;  1TWC L;  4F0B A;  2QA1 A;  4AGS A;  2V1M A;  3RPP A;  5AIX A;  3KH9 A;  1RQM A;  2AHE A;  1THX A;  2DJJ A;  2RII A;  4MZB A;  1EWX A;  3QAV A;  5IMC A;  2JZS A;  3ZML A;  3EYT A;  1R26 A;  1AAZ A;  2B5E A;  3D22 A;  4XS6 A;  1AQX A;  4CDO A;  3IHG A;  1VF3 A;  2PSM C;  7GSS A;  3UVT A;  7RXN A;  2HRK A;  4KF9 A;  1KEB A;  1JLV A;  2CAI A;  4TRX A;  3WGE A;  3GRX A;  3D21 A;  2QA2 A;  2NVT L;  3P2A A;  4RQX A;  3IPZ A;  5GST A;  2R7Z L;  5F0G A;  3S1Q L;  4MDC A;  2H6Y A;  4TXO B;  3M3M A;  3KP8 A;  3KYU A;  4GQC A;  4POG A;  2QL0 A;  2HFD A;  2R0P A;  2H8L A;  6GSU A;  1TP9 A;  1SJZ A;  1GSY A;  2F3M A;  5DDL A;  4N0Z A;  2MMA A;  1VF2 A;  2Z9S A;  3GTO L;  1A23 A;  2YP6 A;  5DJL A;  3UVH A;  3F9U A;  3VI5 A;  3TKS A;  1HNA A;  3ZYW A;  4XS4 B;  2JI1 A;  1T7P B;  1K0A A;  1WJV A;  2WFC A;  3GNJ A;  3GX8 A;  1R0J A;  1MD3 A;  5ENU A;  1GWC A;  2AUV A;  2HSY A;  2C4J A;  1XVQ A;  4DVC A;  5GAH c;  5KEJ A;  1BX9 A;  3ED3 A;  4XTS A;  1BJX A;  3CQZ L;  1M9A A;  2OE0 A;  1E6B A;  2M6O A;  3Q74 A;  4K0N A;  5KOX A;  4KAE A;  1KTE A;  3UOM A;  1GSF A;  5J9B A;  4K9F A;  2L5L A;  1XBS A;  1XW6 A;  2P5Q A;  4C3H L;  4ZBA A;  3DEX A;  3IR4 A;  1G0T A;  1YZX A;  1EV9 A;  4BWS A;  1NW2 A;  1BRF A;  4EC0 A;  3ZZX A;  1X5D A;  1LKO A;  4NPB A;  5AI3 A;  4YKF A;  5JWQ B;  2LRN A;  3RPN A;  5H5S A;  2KLX A;  2OBI A;  3D5J A;  4L5L A;  4BY7 L;  2BE5 D;  3H9B A;  2DKI A;  4MNN A;  5DCH A;  1DE1 A;  2TRC P;  2DJK A;  2FD3 A;  3TRX A;  1YQ1 A;  3HOZ L;  3S1N L;  2VIM A;  3GST A;  3Q6O A;  4N30 A;  1LU4 A;  14GS A;  1EP7 A;  4TW5 A;  4U67 1;  5HFI A;  4EF0 A;  1M0U A;  2LST A;  1G6Y A;  2VUM L;  3N5O A;  3KGK A;  1M3I A;  4HS1 A;  4JAE A;  4O5Q A;  1PL1 A;  4PX1 A;  4NHZ A;  4GTU A;  2GSQ A;  2VOC A;  3P8W A;  1SK0 A;  4HQZ A;  5KN0 A;  1TXX A;  5EPF A;  3ZLP A;  4J57 E;  4Q5N A;  5AIV A;  1ZL9 A;  1ERW A;  1SYR A;  4NV2 A;  5DVB A;  3FKI L;  4DSQ A;  5H1S c;  3LYK A;  1OKD A;  2FA8 A;  5CRD A;  1VZH A;  4MLY A;  3WWN B;  2JL4 A;  1W4V A;  2X8G A;  3DIE A;  3LWP B;  1LKP A;  2FA4 A;  3E0U A;  1AQV A;  4FH8 A;  5JVH 1;  1V2A A;  4TR1 A;  5DM6 1;  6GST A;  2N5F A;  5ECK B;  1K83 L;  4KA0 A;  5DAK B;  4WBJ A;  4QQ7 A;  5DQY A;  5IYB L;  2ZIX A;  4TXV A;  1VZI A;  3VWU A;  1PKW A;  2MMO A;  4JU5 A;  1B4Q A;  1IRN A;  1RDV A;  2RDV A;  4YH2 A;  4PQ1 A;  2O85 A;  1TI3 A;  3LOR A;  3MDK A;  4KUN A;  2HLS A;  2WDU A;  5B6M A;  5MF6 A;  2GZP A;  2X4A A;  3GTQ L;  2CZ2 A;  5JWR B;  2CZ3 A;  4AYB P;  5INY A;  4ML1 A;  2P0G A;  4GS7 D;  2GS3 A;  4NAX A;  4Z7X A;  1V58 A;  2NTO A;  1M3J A;  1Z6M A;  2IMF A;  3FZA A;  1YF0 A;  4DEJ A;  5MLC 3;  3UBK A;  2QSI A;  1YJ6 A;  4OMV A;  4E6Y A;  1O81 A;  3W8J A;  3L9V A;  4WF4 A;  1T8E B;  3IC4 A;  2K2D A;  1TKD B;  3WGD A;  1R0I A;  1SL1 B;  1EOH A;  1WPI A;  2H6Z A;  2LS5 A;  4HOJ A;  5IOW A;  1YUX A;  3K35 A;  1YEX A;  4XRA A;  2B7K A;  1EEJ A;  4G0K A;  4IQA A;  4PNF A;  3EU3 A;  4ILF A;  1RW1 A;  3LWQ B;  4YQU A;  4BL7 A;  1AXD A;  2JI2 A;  1BYE A;  4MMM A;  1OWB A;  2A6E D;  5FWG A;  3M3Y L;  3GTP L;  3S9F A;  3C73 A;  3L9S A;  1S3A A;  4HZ2 A;  5AIS A;  3DRN A;  4YQM A;  4MJC A;  1SD9 A;  4OFN A;  4HU7 A;  2ON7 A;  2IWT A;  2AJQ B;  3PZA A;  1BAY A;  1PMT A;  1X9W B;  1SKW B;  2E2I L;  1N8J A;  1VZG A;  3IOS A;  4ZB9 A;  2E2J L;  2OJL A;  2C3T A;  5B8B A;  3GSS A;  3GN3 A;  3CRU A;  1TRS A;  3S16 L;  1I6H L;  1VF4 A;  1SYX A;  4O7H A;  2OE3 A;  4Z2T A;  4MF6 A;  1XOB A;  3FK8 A;  10GS A;  1QUW A;  2WRT A;  4F9Z A;  3V1W A;  1J08 A;  2CKA A;  5CRG A;  4WR5 A;  4AR4 A;  5G31 A;  1Z7R A;  1IU5 A;  1M9B A;  1SL0 B;  3PIP 1;  2L4Q A;  1TTZ A;  2FWH A;  3FZ5 A;  2I9H A;  2LJR A;  1TWA L;  4PTS A;  5G2Z A;  2O87 A;  3ZMK A;  1AQW A;  3R2Q A;  2C3Q A;  4OD7 A;  3KYW A;  3MAK A;  2IFQ B;  1M2D A;  3ISO A;  4A93 L;  2JSZ A;  3PIO 1;  2WGR A;  3DGQ A;  2EIR A;  4ZN1 B;  4G19 A;  4B8C D;  1GTA A;  1AIU A;  1TRV A;  1Z92 B;  4CHS A;  2O5J D;  3MQK B;  1HNB A;  4GF0 A;  3A5I A;  4K1F A;  5G30 A;  5H5Q A;  2R93 L;  3APO A;  3G9B A;  4AJ6 A;  2CA8 A;  3PGT A;  1K0O A;  3A44 A;  4AI0 A;  1SMU A;  3IBH A;  4HZ4 A;  1TI1 A;  1CAA A;  4X0X A;  3LWO B;  1FOV A;  1PFO A;  3VPB E;  4MJB A;  2C8U A;  2H0H A;  4CY8 A;  4BBR L;  3WGX A;  1Z9H A;  3HOU L;  4V1A p;  1XZO A;  2L0Z A;  2GT5 A;  2H1A A;  4MZC A;  3GYK A;  2YOI A;  4PQH A;  2MMN A;  3IE3 A;  5HQP A;  3O6T A;  1PFU A;  4A3C L;  3TGZ A;  1I5G A;  5CRW A;  4MPG A;  5EIN C;  2ES7 A;  2H1D A;  2O7K A;  2L59 A;  5D93 A;  2B5X A;  2C0D A;  5IMF A;  5A5K A;  2UZ8 A;  3CXG A;  2BTO T;  1EP8 A;  5FJ8 L;  1NSW A;  1X5E A;  2HSH A;  3EMX A;  1GRX A;  1WJK A;  4KE3 A;  4ZIL A;  5M5W L;  2R4V A;  3CBU A;  3ZFL A;  3HJW B;  3MWH A;  5IY0 A;  4ZB8 A;  3H8Q A;  1HYU A;  3QMX A;  4POK A;  3GIX A;  2M6P A;  2KUC A;  5CP1 A;  1XW9 A;  4C3J L;  1HQO A;  3VI7 A;  3FMW A;  4ZBB A;  1O73 A;  4O32 A;  5A4U A;  1FHM A;  4PXO A;  5J41 A;  1U88 A;  4IN0 A;  4HSC X;  5B6N A;  1JZR A;  1T3B A;  3ZRE A;  1J9B A;  4ZL8 A;  1YKA A;  3HZ4 A;  4ICY A;  5C4X L;  2M46 A;  5KN2 A;  3I43 A;  2CX3 A;  5CRE A;  5HR0 A;  3WT1 A;  1DBY A;  1TWH L;  2MS3 A;  3TJF A;  5G1K A;  1WE0 A;  1WP0 A;  3GTM L;  4AJ7 A;  1YDK A;  1ERT A;  2H30 A;  3FY7 A;  1FB0 A;  2WAQ P;  1NNQ A;  1T4Z A;  3KYV A;  4Q5F A;  3UAR A;  2YN1 A;  2H12 A;  3KYX A;  4FYB A;  2NBS A;  3H1N A;  2HNL A;  4HUA A;  1A8L A;  1OYJ A;  3H0G L;  4QL7 A;  2LJK A;  1EOG A;  3IK9 A;  5FLM L;  2Z3Q B;  6RXN A;  1OC9 A;  3DVX A;  1YK4 A;  19GS A;  5A4V A;  1B2O A;  2TIR A;  2DC5 A;  2YCD A;  1R0F A;  5BRT A;  3I4M L;  5DQS A;  1E8J A;  1B9X C;  3US3 A;  1GUH A;  4K8M A;  2JA8 L;  1XWB A;  4LHN A;  4PUA A;  3LXT A;  1TOF A;  2L6D A;  2WB1 P;  2D2Z A;  3LGC A;  1RDG A;  1V40 A;  3PR8 A;  1FW1 A;  4K7O A;  3L78 A;  4KDX A;  5JCG A;  4GLT A;  4TR4 A;  5GAP D;  3KD0 A;  4YWM A;  1E2Y A;  3APQ A;  3N9J A;  5EVO A;  2P5R A;  3Q19 A;  3S1M L;  3M4O L;  1IRO A;  3H9C A;  1CQH A;  4WET A;  5CYY A;  4Y52 L;  2GMG A;  2GVP A;  4MPF A;  2GSR A;  2MYG A;  2YJ7 A;  2DJ0 A;  4MF7 A;  5CNW A;  3DD3 A;  3TJB A;  5J9C A;  3PL5 A;  4AR5 A;  2CVK A;  1U3A A;  4GSS A;  2YJH A;  3I4N L;  2NYD A;  1A0F A;  4YQV A;  4CY6 A;  1JFU A;  4PGT A;  4POB A;  4MK3 A;  2H66 A;  5GZZ B;  5CO3 A;  3EE2 A;  4JAG A;  3HJP A;  3FW2 A;  1BQ7 A;  4HDE A;  3ERW A;  2LRT A;  3NOF A;  4MH3 A;  5IYD L;  1NXG A;  4MP4 A;  4NXI A;  4BVY B;  4K5S A;  4A3B L;  3BJ5 A;  4PUF C;  3EC3 A;  2HT9 A;  3U5R E;  2DMM A;  5BMU A;  4GRF A;  3HOX L;  4EDY A;  5D9W A;  11GS A;  1DX8 A;  1F9M A;  1SL2 B;  3NIV A;  3A2W A;  5AI2 A;  1QQT A;  3WD6 A;  1SU9 A;  2GQK A;  2MMZ A;  2JAD A;  4O5U A;  5COH A;  4ISD A;  3KYY A;  4BA7 A;  3G7Y A;  1YY7 A;  3KEB A;  3NZN A;  2NDO A;  4TXO A;  4ECC A;  3F0I A;  2R0G A;  1XG8 A;  2VLU A;  3D6I A;  2HRF A;  4BVX A;  3GKK A;  1GL8 A;  1QK8 A;  3HHV A;  4KSM A;  5IQY A;  1PA3 A;  4D73 A;  1WWJ A;  2K18 A;  1F2E A;  3UEM A;  2C6A A;  4XS4 A;  4E8H A;  4ZB6 A;  5C3E L;  3MSZ A;  2PU9 C;  4A3I L;  3ZRD A;  20GS A;  2E0Q A;  1ZYQ B;  1PL2 A;  4NMU A;  2G2Q A;  4OFM A;  1VF1 A;  2M4V A;  4AR6 A;  1NM3 A;  4IQ1 A;  3ME7 A;  2XJT A;  1M2A A;  1XOA A;  1X9M B;  3HAX C;  2HE3 A;  2PVX A;  1NHY A;  3CSH A;  5ECM B;  1B2J A;  2DIZ A;  3GFK A;  3GA4 A;  1PQN A;  2A6H D;  4OCE A;  3QFB C;  4GCI A;  5ECP B;  3TB2 A;  2JSY A;  4POF A;  1Y25 A;  1TDI A;  3S2D L;  1T4Y A;  1R0G A;  1Q4J A;  5LD0 A;  1IYH A;  2R5G A;  5JCU A;  3F4T A;  3IK7 A;  2A2P A;  1HNC A;  1SKS B;  5RXN A;  1U6T A;  2GLR A;  4EIP A;  2YU9 L;  3EUR A;  2GST A;  1TK8 B;  5D9T A;  2KKD A;  3F8U A;  1OVN A;  2IL3 A;  3QDN A;  2YPM A;  5IP7 L;  4ML6 A;  3GTU A;  1AW9 A;  5MFZ A;  1RB9 A;  3HDC A;  2J23 A;  3APS A;  2H72 A;  3F63 A;  2EC4 A;  1GUL A;  1WMJ A;  2PMT A;  2VL6 A;  4TR0 A;  2OE1 A;  5IMD A;  2GZY A;  3ZFB A;  3PKI A;  2XJU A;  2L6C A;  1ML6 A;  3QR6 A;  1PSQ A;  1LBK A;  2VD0 A;  3D0Z A;  3M1G A;  4X4J A;  4ECJ A;  4MA9 A;  2RM5 A;  2FCH A;  4WKW A;  5E4W A;  1OWC A;  1PD2 1;  1ST9 A;  3GL3 A;  3G7J A;  4I8B A;  1URM A;  3GV1 A;  2CX4 A;  1QYB A;  3FEU A;  1A0R P;  4IGJ A;  1M7T A;  4Q5Q A;  2B63 L;  3PPU A;  2H0G A;  1GLQ A;  3B0A B;  3OR5 A;  2PN8 A;  4X6A L;  2V6O A;  3ZIJ A;  3ERG A;  4UY8 1;  4L8E A;  3M9K A;  4KND A;  4BXX L;  3KH7 A;  3E3E A;  2VCW A;  2JA5 L;  1GSD A;  5F06 A;  2N5B A;  2CVD A;  5DAK A;  2WS2 A;  1YEP A;  3DVW A;  3QAW A;  2XBI A;  3VLN A;  3C8E A;  1USB A;  3GTJ L;  1PX6 A;  1X0R A;  8RXN A;  3S17 L;  3LJR A;  1RWD A;  2OAC A;  4OCF A;  2TRX A;  5M5Y L;  3A2V A;  4QL9 A;  5GSS A;  4HJM A;  4MAB A;  4HQS A;  4ZBD A;  4BL7 B;  1ZRP A;  1K0N A;  2H70 A;  3KXO A;  4XHM A;  5GAG c;  1RYQ A;  3VUR A;  17GS A;  2GDR A;  3E9J B;  5FHI A;  5ECO B;  2NVY L;  1O7U A;  2MBT A;  1R9T L;  22GS A;  5C00 A;  1S3C A;  1A2L A;  5IP9 L;  2GGT A;  1IU6 A;  4F0C A;  5ECN B;  1K3L A;  3RYG A;  2REM A;  3IRA A;  2NVX L;  3H4K A;  4K2D A;  1MEK A;  5HR2 A;  1J0F A;  1C09 A;  1OC8 A;  3HVN A;  4I6X A;  3LFL A;  3ZVJ A;  2YAN A;  2K6V A;  2IIY A;  1DVB A;  1O85 A;  2HRA A;  1PKZ A;  4A3G L;  1YUZ A;  1F3A A;  6GSX A;  2FGX A;  3DXB A;  1T00 A;  4KW6 A;  1QXH A;  4F82 A;  1W89 A;  1FVJ A;  2VL2 C;  1I3Q L;  2A2S A;  4MJA A;  3LEF A;  3QVD A;  1VGL A;  1ZZY A;  3VPQ A;  2YZU A;  5GAD c;  4V19 6;  1ZMA A;  4TVE A;  1ZYE A;  5F05 A;  1R0H A;  3LWR B;  2HRN A;  4AR3 A;  4JAD A;  5E59 A;  2VD1 A;  2FWG A;  3BCI A;  2H76 A;  2APO B;  3RZT A;  2IMI A;  5D73 A;  1EZK A;  2XHF A;  1H4O A;  2WB9 A;  2L57 A;  5J5N A;  5D96 A;  5DAL B;  4N11 A;  2VM1 A;  4YAV A;  4C2M 1;  2A69 D;  3KP9 A;  1CQG A;  3TDG A;  3CSJ A;  4KDU A;  1SKR B;  4WBR D;  2LJA A;  4LMV A;  3P8B A;  2GQL A;  5ELG A;  1Z7P A;  2VCZ A;  2VCT A;  2VCV A;  2B7J A;  5IPG A;  4EE0 A;  4ULX A;  2FHE A;  4XS1 A;  2R3X A;  2EY4 E;  1A2J A;  4A5P A;  2R92 L;  2IFQ A;  2J9H A;  1THO A;  1HD2 A;  4J2F A;  2PPT A;  3K7A L;  1S2Z A;  2PVO C;  4RI6 A;  4AHX A;  2EIO A;  4WXT A;  1PX7 A;  4N0V A;  2DIY A;  2NVL A;  5JVG 1;  5F07 A;  2OKA A;  1GTI A;  3KTB A;  3LSZ A;  3FKF A;  5ECL B;  3BOA A;  3EU4 A;  5GAE c;  4O92 A;  1UN2 A;  3A5W A;  1B48 A;  3KMO A;  1SK2 A;  2LNS A;  5GAN D;  2PYA A;  1ERV A;  3P7X A;  4GST A;  2G0F A;  1PFW A;  3HOY L;  3TJK A;  4BY1 L;  1VRS D;  3VWX A;  1LJR A;  1G6W A;  5C44 L;  4OWY A;  4K7N A;  1U87 A;  4OFT A;  1JYB A;  3PWF A;  5ELA A;  2XPD A;  8GSS A;  2X8H A;  2H73 A;  2E2M A;  3MIX A;  4IBP A;  2CT6 A;  4KDY A;  1BFY A;  3HKZ P;  3J7Y b;  4GSN A;  4IP6 A;  3F3Q A;  2L5O A;  4RQR A;  3HD5 A;  2R6K A;  1ODH A;  4TR3 A;  5IM9 A;  3LYP A;  4ID0 A;  1R5P A;  1DSB A;  4G0L A;  2IMK A;  5IIZ A;  1M2B A;  4BIK A;  3FHK A;  1C72 A;  2C0G A;  2LRC A;  2DKH A;  3CSI A;  2IPA A;  3GH6 A;  2C0E A;  3GKX A;  3RZD L;  4HJ2 A;  3UBL A;  3B08 B;  1B71 A;  2H6X A;  3U6V A;  2YV9 A;  4MF5 A;  3AY8 A;  6GSS A;  5K2M E;  2VL2 A;  4XXB B;  3TKS C;  3O76 A;  3A2X A;  2RM6 A;  4K0G A;  1QQ2 A;  3QCP A;  4MJE A;  2ZCT A;  1OE7 A;  5ID2 B;  4EDZ A;  5HFG A;  1OAZ A;  4ACS A;  4AI1 A;  1OC9 B;  6GSV A;  4K9Z A;  1XFL A;  4RUV A;  2DML A;  3ZL5 A;  1G7O A;  3J7Y 1;  4DSS A;  3LQ7 A;  5EL8 A;  2VLV A;  2CQ9 A;  4BBS L;  3H3V M;  3TKS E;  3WYW A;  3UIW A;  3GL5 A;  3QD9 A;  2E2G A;  5B7C A;  5CRH A;  4A3L L;  3GKN A;  1LKM A;  4TPU A;  1WIK A;  5KN3 A;  2V0E A;  2AB6 A;  1T1V A;  3K8N A;  1XIY A;  2QKE A;  4EUY A;  4F2I A;  3PO2 L;  4WF5 A;  5IO0 A;  3GUR A;  2CR8 A;  2YNX A;  1PFY A;  5J4U A;  4WR4 A;  1I9D A;  4FYC A;  3LPE B;  2FLS A;  4A3F L;  1PN0 A;  3TRQ A;  2P31 A;  2GQM A;  1PN9 A;  1BE7 A;  1PRX A;  2FUG 2;  1IYI A;  4G0I A;  4AHZ A;  2QC7 A;  1FAA A;  2DJ1 A;  3W6G A;  4EKZ A;  1F3B A;  2E7P A;  2LCQ A;  5AN9 H;  2HYX A;  5L71 A;  2KP1 A;  1RYT A;  1G7E A;  6GSW A;  2HZE A;  1BQ9 A;  4GWR A;  3MSU A;  2JAC A;  1WRY A;  3KTL A;  5ECR B;  3HKR A;  3VK9 A;  4IEL A;  4MH2 A;  3ZTL A;  1Y1W L;  1MDI A;  1ERU A;  2C1Y A;  4IJ3 A;  2KP2 A;  2OBK A;  2JI3 A;  1H75 A;  3R3E A; 
#chains in the Genus database with same CATH homology
 1VCX A;  4AHW A;  2ALB A;  1K0M A;  4KCA A;  4K6X A;  4PQI A;  2K8S A;  2KHP A;  1ABA A;  1O6J A;  4POM A;  4EO3 A;  4YAP A;  1XWG A;  2PWJ A;  4HEA 2;  1O8W A;  4EVM A;  3TOT A;  3C7M A;  3RDW A;  4XGH A;  1JZD A;  1XXU A;  1MTC A;  2RUF A;  5G1L A;  4WEY A;  2LNT A;  3H79 A;  2PBJ A;  1A24 A;  2C3N A;  1K3O A;  3RBT A;  2A68 D;  2VUP A;  3RHB A;  4MZW A;  3PIN A;  1JZW A;  1K3Y A;  2WZ9 A;  3FR3 A;  2F8A A;  3A3T A;  1XWK A;  1YKC A;  4BVX B;  4PUR A;  1GUK A;  3FRC A;  4BPY A;  1V9W A;  4HU9 A;  2QGV A;  2YV7 A;  4RXN A;  1KNG A;  3C71 A;  4IW9 A;  4L5O A;  4BVY A;  3UJ1 A;  2VL3 A;  1Z5Y E;  5ECQ B;  2X99 A;  1FB6 A;  2X64 A;  3KIJ A;  4K2X A;  2MZC A;  4J56 E;  4D73 B;  2H1G A;  1AUC A;  2LKU A;  4X43 A;  4L0U A;  2K9F A;  4IP1 A;  1UC7 A;  5DBQ A;  1RK4 A;  1NHO A;  1A8Y A;  4IHU A;  3HVS A;  3LXZ A;  2LEG A;  2FWF A;  1UVZ A;  3D4T A;  3TJG A;  3FR6 A;  3EWL A;  2ON5 A;  4LMW A;  3J7Z 1;  3J7Y k;  2V32 A;  1GSE A;  1R5A A;  3TOU A;  1ZCP A;  5IMV A;  3EIN A;  1XPV A;  1GSS A;  1ZOF A;  4G10 A;  4AI2 A;  5JCW A;  3F6D A;  2BMX A;  4KGI A;  1XCC A;  1B8X A;  5AN1 A;  2ERJ A;  3HXS A;  1QFN A;  5CAX A;  3G7I A;  3HA9 A;  4ZL9 A;  5IO2 A;  2HXK A;  2OAD A;  1XWC A;  3ERF A;  5HR1 A;  2H71 A;  5KN1 A;  3HJM A;  2X49 A;  5LCZ A;  1SK1 A;  2F51 A;  1V57 A;  3F3R A;  2I4A A;  3ZIV A;  1SD8 A;  4JR4 A;  4KB3 A;  3TKP A;  1M99 A;  4AJ8 A;  2XBQ A;  1TRU A;  4FO5 A;  4RI7 A;  2XC2 A;  3BBY A;  4Z2U A;  18GS A;  1GUM A;  5B8A A;  3EVI A;  4EL1 A;  2IJY A;  5LNK e;  4TN8 A;  2M72 A;  3FZ4 A;  3GTU B;  5ECS A;  4KX4 A;  5H5R A;  3SBC A;  4POL A;  3F4S A;  4ZIJ A;  5HR3 A;  3RZ6 A;  3BCK A;  2DSA A;  13GS A;  3CTF A;  1ZGN A;  4I5Q A;  1QGV A;  1U3I A;  4XCS A;  2B5I D;  3KZQ A;  2R2J A;  5IMZ A;  2K8V A;  4BWQ A;  4TR1 B;  2VLT A;  5ECI B;  2H0I A;  4JR6 A;  2X8C A;  1NXE A;  2ZNM A;  3GHA A;  1BG5 A;  2M4Y A;  3KM6 A;  3RAZ A;  4LLR A;  1ILO A;  3L9U A;  2V2G A;  3TRP A;  1ACV A;  3L4N A;  2C0F A;  3ME8 A;  4PNG A;  2H01 A;  4F03 A;  3D4M A;  2BJX A;  1ON4 A;  6GSY A;  3KMN A;  5G5E A;  1GLP A;  3L0H A;  1EEM A;  5ECH B;  2C80 A;  2LQQ A;  1YK5 A;  4AI3 A;  3HCZ A;  2KN9 A;  4IS0 A;  3CRT A;  4ECI A;  4LL4 B;  2B3S A;  2Z3R B;  1TJD A;  2DJ2 A;  1YV1 A;  3I69 A;  2XJQ A;  1S3D A;  2PGT A;  2I81 A;  3LWA A;  1PGT A;  4ME3 A;  3HVX A;  5MGN A;  3TJJ A;  1WOU A;  3HZ8 A;  1ZYN A;  3FZ9 A;  4OO4 A;  3GKM A;  2V3B B;  1CAD A;  1T9P A;  2DJ3 A;  2WUL A;  4V1A g;  12GS A;  3DWV A;  3BD2 A;  3Q18 A;  4TKY A;  2WCI A;  4USS A;  2YZH A;  4JZQ A;  1XVW A;  1Y6E A;  2H74 A;  2DSX A;  5G5F A;  3I6A A;  2VL9 A;  2V0F A;  1R4W A;  2XJP A;  2C6B A;  5D9V A;  3VWV A;  4IVF A;  3QQC E;  2M80 A;  2A4V A;  3C1S A;  2PVQ A;  4AHY A;  2GZZ A;  2GT6 A;  3KCM A;  4XIH A;  1H7V A;  4YWL A;  3CMI A;  3HVV A;  1TU7 A;  4CW9 A;  2FNO A;  1DE2 A;  3TCO A;  3IDV A;  1KBN A;  4MCU A;  2PVE A;  2EIQ A;  2O8V B;  1TK5 B;  3IAM 2;  2AYJ A;  3M9J A;  4I2U A;  4YKG A;  3DKS A;  3SWL A;  1MDJ A;  2PUK C;  5KOW A;  4EXJ A;  3CTG A;  3VWW A;  1IW7 D;  4TVM A;  1Q98 A;  3QFA C;  2B5Y A;  1QCV A;  2YWI A;  4K7I A;  1GNE A;  1ZYP A;  1TU8 A;  2H19 A;  3HY2 A;  1V98 A;  3UAP A;  1Z3E A;  3GH9 A;  2DLX A;  1DUG A;  4JAF A;  2FY6 A;  3QAG A;  2R37 A;  1SEN A;  1GTB A;  2A2R A;  9GSS A;  2F9S A;  4Q5R A;  3ZG6 A;  4GXZ A;  3IC8 A;  2HSM A;  3UL3 A;  1F6M C;  3QOU A;  1FVK A;  3EMP A;  5C04 A;  2JU5 A;  3LG6 A;  4L0W A;  1FO5 A;  1GP1 A;  1GTU A;  2O89 A;  2VO4 A;  1AC1 A;  1A2M A;  3KJY A;  1T9O A;  2XJS A;  3RHC A;  3EPT A;  3UMA A;  3ZVJ D;  4FQU A;  2MBS A;  3MYD A;  4V2N A;  3IHQ A;  2XJV A;  4ZXG A;  1FG4 A;  3IU3 I;  3I9V 2;  3F4R A;  4AF2 A;  4LL1 B;  5DM7 1;  1GSU A;  5DAL A;  3DML A;  1XWA A;  2GSS A;  1MDK A;  3C1R A;  1EV4 A;  2B1K A;  2VCX A;  2I1U A;  3SS2 A;  2L4C A;  3GX0 A;  4FYU A;  1GSQ A;  2H75 A;  1F37 A;  1X9S B;  4TOP A;  4ZN3 B;  1B9Y C;  1S24 A;  1GH2 A;  4E8E A;  2XPE A;  1BQ8 A;  2LQO A;  3MNG A;  3TUE A;  1UA5 A;  2VM2 A;  4IKH A;  5IPH A;  1R7H A;  2HZF A;  1O8X A;  5IMA A;  1XW5 A;  3MPS A;  3IV4 A;  3HJO A;  5AGY A;  2A4H A;  1SJI A;  5ABR A;  1FHE A;  4EIQ A;  1S30 A;  2CVB A;  3M0F A;  4NV5 A;  1OC3 A;  1SMM A;  2B1L A;  4V2M A;  3FYG A;  2CKC A;  1B13 A;  3VPT A;  5JWO B;  3PKJ A;  4LA1 A;  5A4W A;  1K0C A;  1YF1 A;  2NPB A;  2GTU A;  3HYP A;  2JZT A;  1K0B A;  3LW9 A;  1OE8 A;  4JRR A;  3W8S A;  2HI7 A;  1T9Q A;  3NFP I;  4NWY A;  3O3T A;  3TKQ A;  4KCE A;  4GQF A;  4HI7 A;  2JZR A;  4JBB A;  2J9U B;  4I97 A;  4JE1 A;  1EGR A;  2OA7 A;  2AYT A;  2FWE A;  5DJM A;  5FT3 A;  2IMD A;  3H93 A;  4G2E A;  1GNW A;  3LNL A;  5J3R A;  2V41 A;  3M8N A;  3PH9 A;  3GUS A;  1EGO A;  5DCG A;  4DSS B;  4NHW A;  1JHB A;  1JLW A;  2H1B A;  3WT2 A;  3DYR A;  2LTK A;  3TKR A;  1QMV A;  1FOH A;  4H86 A;  5HFK A;  1LTL A;  2I3Y A;  2YWO A;  2XJR A;  4WFN 1;  1TW9 A;  1OKT A;  16GS A;  2HR5 A;  1X5C A;  4I2T A;  2DBC A;  3JCM L;  1SJ6 A;  1K0D A;  2N5A A;  2IME A;  3CYN A;  2F8F A;  2AAW A;  4DSR A;  4K5R A;  3ZIT A;  4KSO A;  5EIO C;  2CAQ A;  4Z2R A;  2PER A;  5ID2 A;  3WWL A;  4KH7 A;  3IA1 A;  4P3Y B;  2YWN A;  2ZUP A;  2R0C A;  4O5R A;  4V2L A;  4N10 A;  1N2A A;  1BED A;  3QPM A;  2RUE A;  4G6B A;  1TRW A;  2WJU A;  1SMW A;  1B4P A;  2KOK A;  3VFI A;  2YWM A;  3IXR A;  4FIW A;  5D8I A;  2VAF A;  4JED A;  1MD4 A;  5F8B A;  2IN3 A;  2AV4 A;  2VCQ A;  2CV4 A;  5IOX A;  2HZE B;  5MFP A;  4G9H A;  2B6M A;  4XRD A;  1Z6N A;  2RLI A;  2V6K A;  5EY6 A;  3GMF A;  5D9X A;  4LHL A;  4X1U A;  1TK0 B;  4ZL7 A;  1JZO A;  3IAS 2;  2ERS A;  2LV3 A;  1FHH A;  3FR9 A;  3F6F A;  4OO5 A;  2LUS A;  3P90 A;  4ECB A;  4IJI A;  4F0B A;  2QA1 A;  4AGS A;  2V1M A;  3RPP A;  5AIX A;  3KH9 A;  1RQM A;  2AHE A;  1THX A;  2DJJ A;  2RII A;  4MZB A;  1EWX A;  3QAV A;  5IMC A;  2JZS A;  3ZML A;  3EYT A;  1R26 A;  1AAZ A;  2B5E A;  3D22 A;  4XS6 A;  1AQX A;  4CDO A;  3IHG A;  1VF3 A;  2PSM C;  7GSS A;  3UVT A;  7RXN A;  2HRK A;  4KF9 A;  1KEB A;  1JLV A;  2CAI A;  4TRX A;  3WGE A;  3GRX A;  3D21 A;  2QA2 A;  3P2A A;  4RQX A;  3IPZ A;  5GST A;  5F0G A;  4MDC A;  2H6Y A;  4TXO B;  3M3M A;  3KP8 A;  3KYU A;  4GQC A;  4POG A;  2QL0 A;  2HFD A;  2R0P A;  2H8L A;  6GSU A;  1TP9 A;  1SJZ A;  1GSY A;  2F3M A;  5DDL A;  4N0Z A;  2MMA A;  1VF2 A;  2Z9S A;  1A23 A;  2YP6 A;  5DJL A;  3UVH A;  3F9U A;  3VI5 A;  3TKS A;  1HNA A;  3ZYW A;  4XS4 B;  2JI1 A;  1T7P B;  1K0A A;  1WJV A;  2WFC A;  3GNJ A;  3GX8 A;  1R0J A;  1MD3 A;  5ENU A;  1GWC A;  2AUV A;  2HSY A;  2C4J A;  1XVQ A;  4DVC A;  5GAH c;  5KEJ A;  1BX9 A;  3ED3 A;  4XTS A;  1BJX A;  1M9A A;  2OE0 A;  1E6B A;  2M6O A;  3Q74 A;  4K0N A;  5KOX A;  4KAE A;  1KTE A;  3UOM A;  1GSF A;  5J9B A;  4K9F A;  2L5L A;  1XBS A;  1XW6 A;  2P5Q A;  4ZBA A;  3DEX A;  3IR4 A;  1G0T A;  1YZX A;  1EV9 A;  4BWS A;  1NW2 A;  1BRF A;  4EC0 A;  3ZZX A;  1X5D A;  1LKO A;  4NPB A;  5AI3 A;  4YKF A;  5JWQ B;  2LRN A;  3RPN A;  5H5S A;  2KLX A;  2OBI A;  3D5J A;  4L5L A;  2BE5 D;  2DKI A;  4MNN A;  5DCH A;  1DE1 A;  2TRC P;  2DJK A;  2FD3 A;  3TRX A;  1YQ1 A;  2VIM A;  3GST A;  3Q6O A;  4N30 A;  1LU4 A;  14GS A;  1EP7 A;  4TW5 A;  4U67 1;  5HFI A;  4EF0 A;  1M0U A;  2LST A;  1G6Y A;  3N5O A;  3KGK A;  4HS1 A;  4JAE A;  4O5Q A;  1PL1 A;  4PX1 A;  4NHZ A;  4GTU A;  2GSQ A;  2VOC A;  3P8W A;  1SK0 A;  4HQZ A;  5KN0 A;  1TXX A;  5EPF A;  3ZLP A;  4J57 E;  4Q5N A;  5AIV A;  1ZL9 A;  1ERW A;  1SYR A;  4NV2 A;  5DVB A;  4DSQ A;  5H1S c;  3LYK A;  1OKD A;  2FA8 A;  5CRD A;  1VZH A;  4MLY A;  3WWN B;  2JL4 A;  1W4V A;  2X8G A;  3DIE A;  1LKP A;  2FA4 A;  3E0U A;  1AQV A;  4FH8 A;  5JVH 1;  1V2A A;  4TR1 A;  5DM6 1;  6GST A;  2N5F A;  5ECK B;  4KA0 A;  5DAK B;  4WBJ A;  4QQ7 A;  5DQY A;  2ZIX A;  4TXV A;  1VZI A;  3VWU A;  1PKW A;  2MMO A;  4JU5 A;  1B4Q A;  1IRN A;  1RDV A;  2RDV A;  4YH2 A;  4PQ1 A;  2O85 A;  1TI3 A;  3LOR A;  3MDK A;  4KUN A;  2HLS A;  2WDU A;  5B6M A;  5MF6 A;  2GZP A;  2X4A A;  2CZ2 A;  5JWR B;  2CZ3 A;  5INY A;  4ML1 A;  2P0G A;  4GS7 D;  2GS3 A;  4NAX A;  4Z7X A;  1V58 A;  2NTO A;  1Z6M A;  2IMF A;  3FZA A;  1YF0 A;  4DEJ A;  5MLC 3;  3UBK A;  2QSI A;  1YJ6 A;  4OMV A;  4E6Y A;  1O81 A;  3W8J A;  3L9V A;  4WF4 A;  1T8E B;  3IC4 A;  2K2D A;  1TKD B;  3WGD A;  1R0I A;  1SL1 B;  1EOH A;  1WPI A;  2H6Z A;  2LS5 A;  4HOJ A;  5IOW A;  1YUX A;  3K35 A;  1YEX A;  4XRA A;  2B7K A;  1EEJ A;  4G0K A;  4IQA A;  4PNF A;  3EU3 A;  4ILF A;  1RW1 A;  4YQU A;  4BL7 A;  1AXD A;  2JI2 A;  1BYE A;  4MMM A;  1OWB A;  2A6E D;  5FWG A;  3S9F A;  3C73 A;  3L9S A;  1S3A A;  4HZ2 A;  5AIS A;  3DRN A;  4YQM A;  4MJC A;  1SD9 A;  4OFN A;  4HU7 A;  2ON7 A;  2IWT A;  2AJQ B;  3PZA A;  1BAY A;  1PMT A;  1X9W B;  1SKW B;  1N8J A;  1VZG A;  3IOS A;  4ZB9 A;  2OJL A;  2C3T A;  5B8B A;  3GSS A;  3GN3 A;  3CRU A;  1TRS A;  1VF4 A;  1SYX A;  4O7H A;  2OE3 A;  4Z2T A;  4MF6 A;  1XOB A;  3FK8 A;  10GS A;  1QUW A;  2WRT A;  4F9Z A;  3V1W A;  1J08 A;  2CKA A;  5CRG A;  4WR5 A;  4AR4 A;  5G31 A;  1Z7R A;  1IU5 A;  1M9B A;  1SL0 B;  3PIP 1;  2L4Q A;  1TTZ A;  2FWH A;  3FZ5 A;  2I9H A;  2LJR A;  4PTS A;  5G2Z A;  2O87 A;  3ZMK A;  1AQW A;  3R2Q A;  2C3Q A;  4OD7 A;  3KYW A;  3MAK A;  2IFQ B;  1M2D A;  3ISO A;  2JSZ A;  3PIO 1;  2WGR A;  3DGQ A;  2EIR A;  4ZN1 B;  4G19 A;  4B8C D;  1GTA A;  1AIU A;  1TRV A;  1Z92 B;  4CHS A;  2O5J D;  1HNB A;  4GF0 A;  3A5I A;  4K1F A;  5G30 A;  5H5Q A;  3APO A;  3G9B A;  4AJ6 A;  2CA8 A;  3PGT A;  1K0O A;  3A44 A;  4AI0 A;  1SMU A;  3IBH A;  4HZ4 A;  1TI1 A;  1CAA A;  4X0X A;  1FOV A;  3VPB E;  4MJB A;  2C8U A;  2H0H A;  4CY8 A;  3WGX A;  1Z9H A;  4V1A p;  1XZO A;  2L0Z A;  2GT5 A;  2H1A A;  4MZC A;  3GYK A;  2YOI A;  4PQH A;  2MMN A;  3IE3 A;  5HQP A;  3O6T A;  3TGZ A;  1I5G A;  5CRW A;  4MPG A;  5EIN C;  2ES7 A;  2H1D A;  2O7K A;  2L59 A;  5D93 A;  2B5X A;  2C0D A;  5IMF A;  5A5K A;  2UZ8 A;  3CXG A;  2BTO T;  1EP8 A;  1NSW A;  1X5E A;  2HSH A;  3EMX A;  1GRX A;  1WJK A;  4KE3 A;  4ZIL A;  3CBU A;  2R4V A;  3ZFL A;  3MWH A;  5IY0 A;  4ZB8 A;  3H8Q A;  1HYU A;  3QMX A;  4POK A;  3GIX A;  2M6P A;  2KUC A;  5CP1 A;  1XW9 A;  3VI7 A;  1HQO A;  3FMW A;  4ZBB A;  1O73 A;  4O32 A;  5A4U A;  1FHM A;  4PXO A;  5J41 A;  1U88 A;  4IN0 A;  5B6N A;  1JZR A;  1T3B A;  3ZRE A;  1J9B A;  4ZL8 A;  1YKA A;  3HZ4 A;  4ICY A;  2M46 A;  5KN2 A;  3I43 A;  2CX3 A;  5CRE A;  5HR0 A;  3WT1 A;  1DBY A;  2MS3 A;  3TJF A;  5G1K A;  1WE0 A;  1WP0 A;  4AJ7 A;  1YDK A;  1ERT A;  2H30 A;  3FY7 A;  1FB0 A;  1NNQ A;  1T4Z A;  3KYV A;  4Q5F A;  3UAR A;  2YN1 A;  2H12 A;  3KYX A;  4FYB A;  2NBS A;  3H1N A;  2HNL A;  4HUA A;  1A8L A;  1OYJ A;  4QL7 A;  2LJK A;  1EOG A;  3IK9 A;  2Z3Q B;  6RXN A;  1OC9 A;  3DVX A;  1YK4 A;  19GS A;  5A4V A;  1B2O A;  2TIR A;  2DC5 A;  2YCD A;  1R0F A;  5BRT A;  5DQS A;  1E8J A;  1B9X C;  3US3 A;  1GUH A;  4K8M A;  1XWB A;  4LHN A;  4PUA A;  3LXT A;  1TOF A;  2L6D A;  2D2Z A;  3LGC A;  1RDG A;  1V40 A;  3PR8 A;  1FW1 A;  4K7O A;  3L78 A;  4KDX A;  5JCG A;  4GLT A;  4TR4 A;  5GAP D;  3KD0 A;  4YWM A;  1E2Y A;  3APQ A;  3N9J A;  5EVO A;  2P5R A;  3Q19 A;  1IRO A;  1CQH A;  4WET A;  5CYY A;  2GMG A;  2GVP A;  4MPF A;  2GSR A;  2MYG A;  2YJ7 A;  2DJ0 A;  4MF7 A;  5CNW A;  3DD3 A;  3TJB A;  5J9C A;  2CVK A;  4AR5 A;  1U3A A;  4GSS A;  2YJH A;  2NYD A;  1A0F A;  4YQV A;  4CY6 A;  1JFU A;  4PGT A;  4POB A;  4MK3 A;  2H66 A;  5GZZ B;  5CO3 A;  3EE2 A;  4JAG A;  3HJP A;  3FW2 A;  1BQ7 A;  4HDE A;  3ERW A;  2LRT A;  3NOF A;  4MH3 A;  1NXG A;  4MP4 A;  4NXI A;  4BVY B;  4K5S A;  3BJ5 A;  4PUF C;  3EC3 A;  2HT9 A;  3U5R E;  2DMM A;  5BMU A;  4GRF A;  4EDY A;  5D9W A;  11GS A;  1DX8 A;  1F9M A;  1SL2 B;  3NIV A;  3A2W A;  5AI2 A;  3WD6 A;  1SU9 A;  2GQK A;  2MMZ A;  2JAD A;  4O5U A;  5COH A;  4ISD A;  3KYY A;  4BA7 A;  3G7Y A;  1YY7 A;  3KEB A;  3NZN A;  2NDO A;  4TXO A;  4ECC A;  3F0I A;  2R0G A;  2VLU A;  3D6I A;  2HRF A;  4BVX A;  3GKK A;  1GL8 A;  1QK8 A;  3HHV A;  4KSM A;  5IQY A;  1PA3 A;  4D73 A;  1WWJ A;  2K18 A;  1F2E A;  3UEM A;  2C6A A;  4XS4 A;  4E8H A;  4ZB6 A;  3MSZ A;  2PU9 C;  3ZRD A;  20GS A;  2E0Q A;  1ZYQ B;  1PL2 A;  4NMU A;  2G2Q A;  4OFM A;  1VF1 A;  2M4V A;  4AR6 A;  1NM3 A;  4IQ1 A;  3ME7 A;  2XJT A;  1M2A A;  1XOA A;  1X9M B;  2HE3 A;  2PVX A;  1NHY A;  3CSH A;  5ECM B;  1B2J A;  2DIZ A;  3GFK A;  3GA4 A;  1PQN A;  2A6H D;  4OCE A;  3QFB C;  4GCI A;  5ECP B;  3TB2 A;  2JSY A;  4POF A;  1Y25 A;  1TDI A;  1T4Y A;  1R0G A;  1Q4J A;  5LD0 A;  1IYH A;  2R5G A;  5JCU A;  3F4T A;  3IK7 A;  2A2P A;  1HNC A;  1SKS B;  5RXN A;  1U6T A;  2GLR A;  4EIP A;  3EUR A;  2GST A;  1TK8 B;  5D9T A;  2KKD A;  3F8U A;  1OVN A;  2IL3 A;  3QDN A;  2YPM A;  4ML6 A;  3GTU A;  1AW9 A;  5MFZ A;  1RB9 A;  3HDC A;  2J23 A;  3APS A;  2H72 A;  3F63 A;  2EC4 A;  1GUL A;  1WMJ A;  2PMT A;  2VL6 A;  4TR0 A;  2OE1 A;  5IMD A;  2GZY A;  3ZFB A;  3PKI A;  2XJU A;  2L6C A;  1ML6 A;  3QR6 A;  1PSQ A;  1LBK A;  2VD0 A;  3D0Z A;  3M1G A;  4X4J A;  4ECJ A;  4MA9 A;  2RM5 A;  2FCH A;  4WKW A;  5E4W A;  1OWC A;  1PD2 1;  1ST9 A;  3GL3 A;  3G7J A;  4I8B A;  1URM A;  3GV1 A;  2CX4 A;  1QYB A;  3FEU A;  1A0R P;  4IGJ A;  1M7T A;  4Q5Q A;  3PPU A;  2H0G A;  1GLQ A;  3B0A B;  3OR5 A;  2PN8 A;  2V6O A;  3ZIJ A;  3ERG A;  4UY8 1;  4L8E A;  3M9K A;  4KND A;  3KH7 A;  3E3E A;  2VCW A;  1GSD A;  5F06 A;  2N5B A;  2CVD A;  5DAK A;  2WS2 A;  1YEP A;  3DVW A;  3QAW A;  2XBI A;  3VLN A;  3C8E A;  1USB A;  1PX6 A;  1X0R A;  8RXN A;  3LJR A;  1RWD A;  2OAC A;  4OCF A;  2TRX A;  4QL9 A;  3A2V A;  5GSS A;  4HJM A;  4MAB A;  4HQS A;  4ZBD A;  4BL7 B;  1ZRP A;  1K0N A;  2H70 A;  3KXO A;  4XHM A;  5GAG c;  1RYQ A;  3VUR A;  17GS A;  2GDR A;  3E9J B;  5FHI A;  5ECO B;  1O7U A;  2MBT A;  22GS A;  5C00 A;  1S3C A;  1A2L A;  2GGT A;  1IU6 A;  4F0C A;  5ECN B;  1K3L A;  3RYG A;  2REM A;  3IRA A;  3H4K A;  4K2D A;  1MEK A;  5HR2 A;  1J0F A;  1C09 A;  1OC8 A;  4I6X A;  3LFL A;  3ZVJ A;  2YAN A;  2K6V A;  2IIY A;  1DVB A;  1O85 A;  2HRA A;  1PKZ A;  1YUZ A;  1F3A A;  6GSX A;  2FGX A;  3DXB A;  1T00 A;  4KW6 A;  1QXH A;  4F82 A;  1W89 A;  1FVJ A;  2VL2 C;  2A2S A;  4MJA A;  3LEF A;  3QVD A;  1VGL A;  1ZZY A;  3VPQ A;  2YZU A;  5GAD c;  4V19 6;  1ZMA A;  4TVE A;  1ZYE A;  5F05 A;  1R0H A;  2HRN A;  4AR3 A;  4JAD A;  5E59 A;  2VD1 A;  2FWG A;  3BCI A;  2H76 A;  3RZT A;  2IMI A;  5D73 A;  1EZK A;  2XHF A;  1H4O A;  2WB9 A;  2L57 A;  5J5N A;  5D96 A;  5DAL B;  4N11 A;  2VM1 A;  4YAV A;  2A69 D;  3KP9 A;  1CQG A;  3TDG A;  3CSJ A;  4KDU A;  1SKR B;  4WBR D;  2LJA A;  4LMV A;  3P8B A;  2GQL A;  5ELG A;  1Z7P A;  2VCZ A;  2VCT A;  2VCV A;  2B7J A;  5IPG A;  4EE0 A;  4ULX A;  2FHE A;  4XS1 A;  2R3X A;  1A2J A;  4A5P A;  2IFQ A;  2J9H A;  1THO A;  1HD2 A;  4J2F A;  2PPT A;  1S2Z A;  2PVO C;  4RI6 A;  4AHX A;  2EIO A;  4WXT A;  1PX7 A;  4N0V A;  2DIY A;  2NVL A;  5JVG 1;  5F07 A;  2OKA A;  1GTI A;  3KTB A;  3LSZ A;  3FKF A;  5ECL B;  3BOA A;  3EU4 A;  5GAE c;  4O92 A;  1UN2 A;  3A5W A;  1B48 A;  3KMO A;  1SK2 A;  2LNS A;  5GAN D;  2PYA A;  1ERV A;  3P7X A;  4GST A;  2G0F A;  3TJK A;  1VRS D;  3VWX A;  1LJR A;  1G6W A;  4OWY A;  4K7N A;  1U87 A;  4OFT A;  1JYB A;  3PWF A;  5ELA A;  2XPD A;  8GSS A;  2X8H A;  2H73 A;  2E2M A;  3MIX A;  4IBP A;  2CT6 A;  4KDY A;  1BFY A;  3J7Y b;  4GSN A;  4IP6 A;  3F3Q A;  2L5O A;  4RQR A;  3HD5 A;  2R6K A;  1ODH A;  4TR3 A;  5IM9 A;  3LYP A;  4ID0 A;  1R5P A;  1DSB A;  4G0L A;  2IMK A;  5IIZ A;  1M2B A;  3FHK A;  1C72 A;  2C0G A;  2LRC A;  2DKH A;  3CSI A;  2IPA A;  3GH6 A;  2C0E A;  3GKX A;  4HJ2 A;  3UBL A;  3B08 B;  1B71 A;  2H6X A;  3U6V A;  2YV9 A;  4MF5 A;  3AY8 A;  6GSS A;  5K2M E;  2VL2 A;  4XXB B;  3TKS C;  3O76 A;  3A2X A;  2RM6 A;  4K0G A;  1QQ2 A;  3QCP A;  4MJE A;  2ZCT A;  1OE7 A;  5ID2 B;  4EDZ A;  5HFG A;  1OAZ A;  4ACS A;  4AI1 A;  1OC9 B;  6GSV A;  4K9Z A;  1XFL A;  4RUV A;  2DML A;  3ZL5 A;  1G7O A;  3J7Y 1;  4DSS A;  3LQ7 A;  5EL8 A;  2VLV A;  2CQ9 A;  3TKS E;  3WYW A;  3UIW A;  3GL5 A;  3QD9 A;  2E2G A;  5B7C A;  5CRH A;  3GKN A;  1LKM A;  4TPU A;  1WIK A;  5KN3 A;  2V0E A;  2AB6 A;  1T1V A;  3K8N A;  1XIY A;  2QKE A;  4EUY A;  4F2I A;  4WF5 A;  5IO0 A;  3GUR A;  2CR8 A;  2YNX A;  5J4U A;  4WR4 A;  1I9D A;  4FYC A;  3LPE B;  2FLS A;  1PN0 A;  3TRQ A;  2P31 A;  2GQM A;  1PN9 A;  1BE7 A;  1PRX A;  2FUG 2;  1IYI A;  4G0I A;  4AHZ A;  2QC7 A;  1FAA A;  2DJ1 A;  3W6G A;  4EKZ A;  1F3B A;  2E7P A;  2LCQ A;  5AN9 H;  2HYX A;  5L71 A;  2KP1 A;  1RYT A;  1G7E A;  6GSW A;  2HZE A;  1BQ9 A;  4GWR A;  3MSU A;  2JAC A;  1WRY A;  3KTL A;  5ECR B;  3HKR A;  3VK9 A;  4IEL A;  4MH2 A;  3ZTL A;  1MDI A;  1ERU A;  2C1Y A;  4IJ3 A;  2KP2 A;  2OBK A;  2JI3 A;  1H75 A;  3R3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...