2PPTA

Crystal structure of thioredoxin-2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
149
structure length
149
Chain Sequence
MMGAKMAESLRLTCLACGQANKVPSDRLAAGPKCGICGAGLITGKVAGIDPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin-2
publication title Crystal Structure of thioredoxin-2
rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 39
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2007-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.140 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2pptA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pptA02
4JEDA 3TRQA 3P8WA 10GSA 3F4TA 2GQMA 1MDKA 3VI7A 2H6YA 4D73B 3TKPA 5IPGA 2QC7A 5G5FA 3L4NA 3C73A 2GS3A 4ZL7A 3M9KA 2EIRA 2XPDA 5ECMB 1YJ6A 4V2LA 1S3DA 2VM1A 3ERWA 4ILFA 2GSSA 2L5LA 4TR4A 3GNJA 2R6KA 1MTCA 2IFQB 1EEMA 1OKDA 3VWXA 5CREA 4HDEA 1XW9A 1JZOA 2VL3A 5D8IA 1CQGA 4HOJA 2NBSA 3L0HA 2L4QA 5DAKA 1GL8A 3CYNA 1AXDA 2B1LA 1ZYQB 4XXBB 4I8BA 4XS6A 1XW6A 1BYEA 1THOA 2X64A 4HQSA 2C0GA 2LS5A 1K0MA 4LMVA 5HFGA 2V6KA 2JSYA 3DVWA 1XPVA 5CRGA 3TKSE 8GSSA 1OKTA 3IBHA 3N9JA 1F9MA 2G0FA 4KW6A 1GSSA 4MF6A 4O92A 4V1Ag 4PGTA 2VLTA 4TR0A 3TDGA 1B4PA 2MZCA 4E8EA 3LXTA 3HDCA 1SKWB 1TRSA 4MJBA 1AW9A 1EZKA 1SD9A 1O8WA 4ECCA 3GSSA 4GQFA 2DJKA 2YNXA 4BVYA 1SYRA 1XXUA 2GSQA 3DEXA 2X99A 3S9FA 2YV7A 4EC0A 1WIKA 2ZNMA 2B6MA 3GHAA 5CRHA 5CNWA 3QFBC 1A8YA 4Z7XA 3ZRDA 3KMOA 3Q74A 2MMZA 2WCIA 4ZXGA 2JACA 1NW2A 3HY2A 3TB2A 1XWGA 2C4JA 4NV2A 1FAAA 2H70A 1ZOFA 1UN2A 4POBA 2CX4A 2P5RA 1Y6EA 1OAZA 3IPZA 4I6XA 4PURA 4YH2A 4HQZA 5B6MA 3DIEA 4EXJA 3APOA 4BWSA 4ISDA 4EDYA 1PL1A 3ZVJA 5DJLA 5C00A 3G7YA 5IMFA 1ILOA 2ALBA 2GDRA 4OFNA 2H01A 2PU9C 4ID0A 1OYJA 2LSTA 3M3MA 2IMFA 2AUVA 3EURA 5AN1A 5F05A 4IJIA 3CRUA 1F37A 1XVWA 3GUSA 5GSTA 3BBYA 1U87A 1Z9HA 2I81A 5ECKB 4HJMA 4KCAA 2GGTA 2WDUA 2LJAA 4MZWA 2HXKA 5IPHA 3HJPA 3DMLA 2B5XA 1KTEA 4IGJA 1JZDA 2WFCA 2DJJA 4WKWA 1M2AA 4JE1A 3VK9A 5ECRB 3O6TA 5J41A 3HD5A 3TJFA 3ME8A 3WD6A 3CTGA 2O8VB 4WBRD 1OC9A 4QQ7A 4X1UA 3RAZA 5CO3A 3FKFA 4YAPA 3IK9A 3LGCA 1TRVA 4EL1A 3NZNA 4ZILA 1ERTA 2F8FA 2IIYA 1SKSB 1LU4A 4RQXA 3F6FA 1U3AA 3VFIA 4F03A 2F51A 1PKWA 4H86A 4DSSB 1V98A 4XS4A 3FK8A 3WYWA 2HYXA 4TXVA 4IN0A 5F0GA 4ACSA 3P7XA 3V1WA 1MEKA 2K18A 2H75A 4V1Ap 2FWGA 4DSQA 4CHSA 2DC5A 1ZGNA 2NPBA 3CRTA 4GSSA 3GKNA 4WBJA 3UBLA 1AQVA 3GX0A 1EOHA 1A8LA 3FR3A 5D9TA 5G1KA 5FT3A 2P5QA 3KCMA 3QAGA 5IMDA 3I9V2 1TW9A 3UOMA 4DVCA 5D9VA 2HSHA 4QL7A 4F0CA 4ZBDA 2WB9A 1SK0A 1AQWA 1CQHA 2C8UA 2VCVA 3TOUA 3ED3A 1TK0B 4ULXA 3ERGA 2KP2A 3D6IA 4ML6A 1OC3A 3LJRA 4KSMA 1J08A 4OD7A 4TR1B 1GLQA 2NDOA 1U88A 4TXOB 1TJDA 3IHQA 1YKCA 3A3TA 1F2EA 2XBIA 1SK2A 2IPAA 3TJGA 3GH6A 4KE3A 2WZ9A 2OKAA 1HQOA 2PVOC 4KDXA 4YQVA 3C8EA 2JZTA 11GSA 3W8SA 4JRRA 4QL9A 6GSSA 2V41A 2E0QA 3J7Yk 6GSYA 1GTAA 1IYIA 3KGKA 2E2MA 4GCIA 4ZB9A 2V6OA 2DIYA 3RPNA 3LSZA 2X8GA 1E6BA 2C6AA 1XWCA 1W89A 1H75A 1OE7A 2V32A 3ME7A 4WEYA 2C0DA 2P0GA 2ZUPA 4J56E 4KH7A 2FHEA 3C1SA 1RK4A 2YP6A 5EY6A 5G1LA 1TDIA 2H6ZA 1PQNA 2VL9A 2RUFA 2OE1A 1TRWA 2F9SA 5IOXA 5CRWA 1FG4A 1EP7A 1WJKA 3HJOA 3ZLPA 3H1NA 2FWHA 6GSWA 1QGVA 5DQYA 4KNDA 1JLVA 2IN3A 3FRCA 5FWGA 3ZTLA 2BTOT 3TUEA 4F82A 1TU8A 2O89A 2VL2C 3KTBA 1GTBA 1FB0A 1OE8A 4ZBAA 5D9XA 5AISA 2LRTA 4FYUA 3B0AB 1EV9A 2YZHA 4K7OA 2AYTA 4K0NA 4FYBA 1G7OA 5LD0A 3GRXA 3CXGA 3FZ4A 3FHKA 3IDVA 3UAPA 4ZL9A 3I6AA 4RUVA 2V1MA 5G2ZA 3EMPA 4D73A 2PMTA 4IJ3A 5COHA 5C04A 3UIWA 5KN2A 4PNFA 1ZMAA 3F4SA 4GWRA 3M9JA 6GSUA 3KIJA 2C3TA 3GKXA 3KJYA 5DJMA 3LYKA 3LORA 17GSA 4EUYA 13GSA 2H74A 4I2UA 2IMKA 2M72A 3QMXA 1B9YC 3IE3A 4MF7A 4KCEA 1MDIA 5DVBA 1JLWA 1U6TA 4O5RA 3VPQA 2OA7A 2CV4A 4I5QA 4KDYA 3GV1A 2MBTA 3G9BA 2HSYA 5H5RA 2AV4A 1X5EA 2JSZA 1ZCPA 3P2AA 1TI1A 4BA7A 2IMIA 3H4KA 1O7UA 3RBTA 1O73A 4YAVA 2N5AA 1SENA 5IMAA 2BJXA 1FW1A 1ZYEA 4GF0A 3EINA 1XWKA 3E9JB 2V2GA 19GSA 12GSA 1GSQA 1PL2A 2IMEA 2GZPA 4N11A 3U5RE 2PWJA 2FWEA 5CAXA 5H5SA 3GFKA 3TKQA 3L9UA 1XW5A 4JU5A 3FR9A 3ZFBA 3WGXA 3E3EA 1PSQA 2LQQA 3ERFA 2CVKA 5J9CA 2GZYA 2YJ7A 4MABA 1ERWA 1JFUA 4XHMA 1TK5B 2OBIA 4MK3A 2B7JA 4OWYA 2KUCA 2JZSA 3LEFA 4POKA 1Q4JA 3GL5A 4F9ZA 1FOVA 2KP1A 5EL8A 4O32A 5HR1A 3HZ4A 1V9WA 3A2WA 2XHFA 1WRYA 4AGSA 1EGOA 1YEPA 1TOFA 1EP8A 1YF0A 5B6NA 4IVFA 3QCPA 2JZRA 4NHZA 3GSTA 4K7IA 2E7PA 2HT9A 3EU3A 4TVEA 1SL0B 2CZ2A 2HI7A 2I4AA 3O3TA 4PX1A 5ECQB 3F4RA 1IYHA 2YV9A 5E59A 4BWQA 1WP0A 2CVBA 4ZIJA 3UEMA 2L59A 3F0IA 3LFLA 3WT1A 5ECIB 5ECOB 5D93A 2GQLA 1V2AA 3A5WA 3GTUA 1TTZA 2FWFA 2RIIA 3FZ9A 4K9ZA 5H5QA 3KH7A 2OE0A 3TOTA 5E4WA 4XRAA 3PR8A 1GTIA 1PMTA 1I9DA 4ECJA 2H8LA 3Q6OA 3RPPA 5B7CA 3W8JA 1GRXA 1G0TA 1DE2A 2LTKA 3R2QA 2JADA 1GULA 2PVQA 6GSVA 1M7TA 1QUWA 4RI7A 3F3RA 4MJEA 5GAPD 3UVHA 4N30A 1ZL9A 2K9FA 2FY6A 2YPMA 5DAKB 4KX4A 2DMMA 4MA9A 3K8NA 5L71A 4KAEA 2TRCP 1YKAA 5IMVA 1YZXA 2B7KA 2VCZA 4DSSA 4MZCA 3QOUA 4L8EA 2WGRA 4MZBA 4ZB8A 1PN9A 1GSDA 2XPEA 5JCWA 3GYKA 2FNOA 2Z9SA 1TRUA 2FLSA 3TKSC 2DJ0A 5A4WA 2PPTA 4XCSA 5DALB 1GSFA 4TKYA 1VF1A 2DMLA 2VO4A 3VI5A 1USBA 4K2DA 3BCIA 4N10A 4PUFC 5F8BA 4IP6A 3DYRA 2GZZA 2MMNA 1GNWA 4EKZA 2FA4A 3HVXA 3RHCA 4JZQA 1R4WA 2HZEB 1EGRA 3D21A 4TRXA 4K0GA 3SWLA 4IKHA 4AJ8A 1K3YA 2IL3A 3LYPA 4OMVA 3F3QA 3QAVA 2E2GA 1A24A 3W6GA 1Y25A 4TR1A 4XIHA 2CAQA 3L9VA 2GSRA 2MYGA 3DGQA 20GSA 2PN8A 2EIOA 2H0HA 3Q19A 4CW9A 3KTLA 3TCOA 4HZ4A 1GTUA 3C1RA 4G10A 3WT2A 3IC4A 2R3XA 1VF4A 4L0WA 4MF5A 5JWOB 3ZL5A 3IOSA 3TRXA 7GSSA 5KN0A 2F8AA 5G30A 3N5OA 4EDZA 1XVQA 2LJRA 1WWJA 1A2JA 2X8HA 1O6JA 1HYUA 4FYCA 3ZFLA 4ZB6A 1M2BA 3DXBA 3CTFA 2VCQA 3UL3A 2H1BA 3DD3A 4BVXA 2YWIA 2N5FA 2VAFA 2XBQA 1K0AA 3KP9A 3HXSA 3VWUA 4L5LA 1JHBA 3HVVA 4MCUA 2L6CA 2H0GA 2I9HA 2YCDA 4PQHA 4IQAA 2IWTA 2A4VA 1K3LA 22GSA 2A2RA 2RUEA 5DBQA 2M46A 1G6WA 4GQCA 2FA8A 1OC9B 1QXHA 3IRAA 1A23A 2O87A 1WMJA 1O81A 4X43A 4MLYA 3I43A 2C80A 1RQMA 2PBJA 3QR6A 4ECBA 2OJLA 3BCKA 4NV5A 5HR2A 2I3YA 3TJJA 2VD0A 1XOAA 1J0FA 2HRNA 4JR4A 2RLIA 4PQIA 2ES7A 4X0XA 4WETA 2LUSA 3NOFA 4XS1A 2K6VA 3LXZA 4KA0A 6GSTA 3ZZXA 3TKRA 2VCXA 1A0RP 1X5DA 1SJZA 3LG6A 4N0VA 2VCTA 3IV4A 1X9SB 4G2EA 2J9UB 2GLRA 4IBPA 5IOWA 3FY7A 5ABRA 4JR6A 1VF2A 4XRDA 5F07A 1TXXA 4EVMA 2C1YA 4GXZA 2DJ3A 1B4QA 3ZMKA 3RHBA 2C0FA 3C7MA 1H4OA 3TGZA 1XFLA 2CQ9A 2H0IA 2MMAA 4I2TA 1HD2A 4YQUA 1ACVA 3KP8A 3UARA 5EPFA 4MH2A 3WGDA 1B48A 1ON4A 3U6VA 2L5OA 1O8XA 3I69A 4MMMA 4BPYA 2D2ZA 1S3CA 1Z6MA 1BG5A 3KM6A 4F2IA 4WR5A 5D9WA 3L9SA 4DEJA 2EIQA 3Q18A 4G9HA 4LLRA 3BJ5A 3FW2A 2DJ1A 4GTUA 2DSAA 5B8BA 1WOUA 1DUGA 1YQ1A 2C3QA 3D5JA 2O85A 5IM9A 2NVLA 1VF3A 2LJKA 3TJBA 3HA9A 1GUHA 4PQ1A 3F8UA 2IFQA 3OR5A 1ERVA 1V40A 4ML1A 3FR6A 1XBSA 1GNEA 4HUAA 3VLNA 4EE0A 4Q5RA 4RQRA 1GUMA 2C6BA 1T8EB 3IAS2 2YZUA 2JU5A 4GSNA 5ID2B 3PGTA 2WULA 4FO5A 2YJHA 4J57E 3HYPA 2H30A 1QMVA 5KEJA 4NWYA 5ENUA 5JWRB 2DIZA 4PNGA 1DE1A 1Z7RA 2F3MA 5HR3A 5DCGA 4HI7A 3PH9A 1N2AA 3M8NA 1YF1A 3LWAA 2HLSA 1T7PB 2YWMA 3M1GA 1PX7A 2QGVA 4TW5A 4V2NA 3BD2A 1DSBA 5DCHA 4POLA 4LL1B 3HZ8A 4HZ2A 2NTOA 4DSRA 5G5EA 4IELA 5IQYA 1FVKA 5GZZB 1TU7A 2VM2A 3D0ZA 16GSA 1SU9A 5HFIA 1SL1B 4AF2A 1OC8A 2VL2A 5AIVA 2WRTA 1G6YA 1T1VA 2TIRA 5J3RA 5IO2A 2YN1A 3GA4A 2HE3A 4JBBA 2GT5A 4OCFA 5J5NA 1Z5YE 5DDLA 4AJ6A 5D73A 3MNGA 3HCZA 2H1GA 1HNCA 4I97A 2LRNA 1AQXA 3VPTA 2DJ2A 2RM6A 3D22A 2ZCTA 3MWHA 2N5BA 5J4UA 4NAXA 2CVDA 3J7Yb 1Q98A 1YDKA 2VLUA 3RDWA 4ECIA 3IK7A 4KSOA 4ZBBA 4OFTA 1O85A 5CP1A 2R4VA 1JZRA 1WPIA 3MAKA 4TN8A 2K8VA 3H79A 1GSUA 5INYA 4MPGA 3NIVA 2B3SA 2X8CA 3ZYWA 4N0ZA 2OADA 1SL2B 3AY8A 5EVOA 2PGTA 1SYXA 2LEGA 1X5CA 5ECSA 2WS2A 1K0CA 3D4MA 2AJQB 5LNKe 3FZAA 4K1FA 5CYYA 3HKRA 2J9HA 1M99A 2JL4A 1BAYA 4KB3A 1TKDB 4KGIA 3APSA 5DALA 3KEBA 1LBKA 3US3A 1EV4A 3KZQA 1A0FA 1A2LA 1MD3A 3P90A 1AAZA 2FD3A 1JZWA 4V2MA 1ERUA 2L57A 3D4TA 1F6MC 1M0UA 3PINA 2H66A 4MJCA 4Q5FA 3ISOA 2HZEA 1FB6A 3GN3A 1U3IA 5GSSA 1XWAA 4MPFA 1LJRA 2H73A 3DWVA 1T4YA 2FUG2 2KHPA 3DRNA 2MBSA 1WE0A 1GUKA 4LMWA 2R37A 5JCUA 2VLVA 1OVNA 4MJAA 5ELGA 3ZIJA 1SJIA 3TJKA 3KH9A 1I5GA 2GTUA 2VD1A 1ZZYA 1GLPA 1GP1A 5ECHB 1ABAA 1N8JA 3IXRA 4IP1A 4K7NA 3BOAA 4NXIA 1T00A 4Q5NA 4IHUA 4MDCA 2FGXA 1Z7PA 1UVZA 3GURA 3GKMA 5A4VA 5J9BA 3DVXA 1SKRB 5IIZA 1SD8A 1GWCA 4OO5A 1G7EA 4OCEA 4RI6A 1ST9A 4MP4A 1HNAA 2QKEA 2VCWA 1X0RA 3JCML 5KN3A 2IMDA 4K6XA 2H1AA 1TP9A 2DBCA 2B5EA 3CBUA 1R5PA 2J23A 4HU9A 2I1UA 2DLXA 3GTUB 4F0BA 4PUAA 1GSEA 2VOCA 3UMAA 1YY7A 2H76A 3UJ1A 1NM3A 3KMNA 1M9AA 4P3YB 1XOBA 3ZVJD 4IS0A 2L4CA 2PUKC 3UBKA 4TXOA 4BL7A 2B1KA 4FIWA 2GT6A 1QK8A 2QSIA 3UVTA 4WR4A 3EE2A 5B8AA 9GSSA 1QFNA 1VRSD 1THXA 1W4VA 3ZMLA 1YEXA 3A2VA 1XWBA 1AIUA 5CRDA 4K8MA 2AB6A 1PRXA 1A2MA 2HFDA 2HNLA 18GSA 4G19A 5KN1A 1MD4A 1QQ2A 5D96A 3E0UA 2EC4A 2LRCA 2ON5A 4NHWA 1R7HA 1R5AA 3B08B 5GAND 5HFKA 3QFAC 4HU7A 4ZL8A 2CA8A 4WF5A 2OBKA 1XZOA 2KLXA 3EC3A 3KXOA 3TKSA 1K3OA 1NHOA 3HHVA 1M2DA 3G7JA 2XC2A 4GLTA 4GSTA 4YQMA 4POMA 5ECLB 5A5KA 3ZIVA 1V57A 3QPMA 4IW9A 3QAWA 4EF0A 2H1DA 2KOKA 5ELAA 1KBNA 5FHIA 3IR4A 6GSXA 3QD9A 3C71A 4CDOA 1PKZA 1K0BA 1X9MB 1GH2A 1B9XC 3CSJA 2TRXA 1VGLA 14GSA 4L0UA 2YANA 5JWQB 5IO0A 3CSIA 2GSTA 4XS4B 4TR3A 1EOGA 1PGTA 2GQKA 2AHEA 1KEBA 1E2YA 5JCGA 1PA3A 3EVIA 2FCHA 2HZFA 1PX6A 1HNBA 3VURA 3EU4A 2R5GA 2AAWA 1FVJA 1SK1A 2H19A 2L6DA 5DQSA 5HR0A 2C3NA 4O7HA 1RW1A 1XCCA 4WXTA 4HJ2A 4OO4A 2CT6A 3L78A 4J2FA 1T4ZA 3F9UA 2WJUA 4AJ7A 3VWWA 1DBYA 3IAM2 3SBCA 3M0FA 2O7KA 3EYTA 3O76A 2H71A 1S3AA 3ZREA 1PD21 3EMXA 5ID2A 1EWXA 4GRFA 2IJYA 3MSZA 2ON7A 3GH9A 3CMIA 4HS1A 4WF4A 2H72A 1UA5A 1R26A 1URMA 1KNGA 1V58A 3A2XA 1FHEA 1C72A 1Z6NA 1K0DA 3DKSA 4KDUA 2B5YA 2K8SA 1MDJA 2OE3A 2MMOA 4OFMA 3WGEA 3QDNA 4KUNA 1ML6A 1AC1A 2YWOA 3HVSA 4FH8A 3GL3A 2A2SA 1Z3EA 1AUCA 3F63A 3H8QA 3GKKA 3GX8A 4LA1A 5IMCA 4HEA2 2LKUA 4E8HA 3MDKA 4MH3A 1XIYA 1BQ7A 1SJ6A 3ZITA 1M9BA 4EO3A 5AGYA 5ECNB 4TOPA 1F3AA 2G2QA 2YOIA 1B8XA 1T3BA 2H6XA 3FYGA 2CZ3A 4NMUA 2YWNA 3HJMA 5HQPA 3G7IA 2GVPA 4Q5QA 2M80A 1TK8B 2LV3A 5G31A 3EWLA 1UC7A 2OACA 1BX9A 3F6DA 2CAIA 3GMFA 5AIXA 2LNSA 5IMZA 5ECPB 5F06A 2LNTA 5LCZA 4IQ1A 1K0OA 3IA1A 1NSWA 3CSHA 2PERA 1GSYA 2P31A 3APQA 1K0NA 1F3BA 3FEUA 4XTSA 3H93A 3KD0A 2CX3A 2VIMA 2C0EA 4NPBA 1BJXA 3TRPA 3GIXA 1TI3A 2REMA 2RM5A 4LL4B 1BEDA 1NHYA 5A4UA 1J9BA 2R2JA 4L5OA 2BMXA 3LQ7A 2LQOA 2HRFA 1X9WB 3VWVA 1FO5A 3FZ5A 2VUPA 4PXOA 1EEJA
chains in the Genus database with same CATH superfamily
4JEDA 3TRQA 2V0EA 3HOUL 3RYGA 5GAEc 3P8WA 10GSA 3F4TA 2GQMA 1MDKA 3VI7A 2H6YA 1OWBA 3TKPA 4D73B 5IPGA 2QC7A 5G5FA 3L4NA 3C73A 2GS3A 4ZL7A 3M9KA 2EIRA 3HOXL 2XPDA 5ECMB 1YJ6A 4V2LA 1S3DA 3PZAA 2VM1A 3ERWA 4ILFA 4A3EL 2GSSA 2L5LA 3GTKL 4TR4A 1PFYA 3GNJA 2R6KA 1MTCA 2IFQB 1EEMA 1OKDA 3VWXA 5CREA 4HDEA 1XW9A 3HJWB 1JZOA 2VL3A 5D8IA 3S2HL 1CQGA 4C3IL 4HOJA 2NBSA 3L0HA 4K5RA 2L4QA 5DAKA 1GL8A 4BBRL 3CYNA 4JAEA 1AXDA 2B1LA 1ZYQB 1BQ9A 3P8BA 4XXBB 4I8BA 1XW6A 4XS6A 2JA7L 5IY0A 1BYEA 4Y52L 1THOA 2X64A 4HQSA 2C0GA 2LS5A 1K0MA 2XJQA 4LMVA 5HFGA 2V6KA 2JSYA 3DVWA 2UZ8A 1PFWA 1XPVA 5CRGA 3TKSE 8GSSA 1OKTA 3IBHA 3N9JA 1FHMA 1F9MA 2G0FA 4KW6A 1GSSA 4MF6A 3PIO1 4O92A 4V1Ag 4PGTA 1YUXA 2VLTA 4TR0A 3TDGA 5EINC 1B4PA 2MZCA 2ZIXA 4E8EA 3LXTA 3HDCA 1SKWB 4B8CD 5BMUA 1TRSA 4MJBA 1AW9A 1EZKA 1SD9A 1O8WA 4ECCA 3GSSA 4GQFA 1BE7A 2DJKA 2YNXA 4BVYA 1SYRA 1XXUA 2GSQA 3DEXA 2M4VA 2X99A 2XJTA 1H7VA 3S9FA 2YV7A 4EC0A 1YK4A 1WIKA 2ZNMA 2B6MA 3GHAA 5CRHA 5CNWA 3QFBC 1PFUA 1A8YA 4Z7XA 3ZRDA 3KMOA 3Q74A 3QQCE 2MMZA 2WCIA 4ZXGA 2JACA 1NW2A 3HY2A 3TB2A 1T9OA 1XWGA 2C4JA 4NV2A 1FAAA 2H70A 1ZOFA 1UN2A 4POBA 2CX4A 2P5RA 1Y6EA 1OAZA 2A6HD 3IPZA 4I6XA 4AI2A 4PURA 4YH2A 4HQZA 5B6MA 3DIEA 4EXJA 2V0FA 3APOA 4O5QA 4BWSA 4ISDA 4EDYA 1PL1A 2CR8A 3ZVJA 5DJLA 5C00A 3G7YA 5IMFA 5C3EL 1ILOA 3LWPB 2ALBA 4POFA 2GDRA 4OFNA 4AHXA 2H01A 2PU9C 4ID0A 1OYJA 1R0GA 2LSTA 3K7AL 3M3MA 2IMFA 2AUVA 1E8JA 3EURA 5AN1A 5F05A 2PVEA 1LKPA 4X6AL 4IJIA 1OWCA 1S2ZA 3CRUA 4BXXL 1F37A 1XVWA 1ZRPA 3GUSA 3PKIA 5GSTA 3BBYA 2A68D 1U87A 1Z9HA 1T9PA 2I81A 2B5ID 5ECKB 4HJMA 4KCAA 2GGTA 2WDUA 2LJAA 1RB9A 4MZWA 3EPTA 2HXKA 5IPHA 3HJPA 3DMLA 2B5XA 1KTEA 4G0KA 4IGJA 1JZDA 2WFCA 3H9CA 2APOB 2CKCA 2DJJA 4WKWA 1M2AA 2DKIA 4JE1A 4AI0A 3VK9A 5ECRB 3O6TA 5J41A 3HD5A 5IYDL 3TJFA 3A44A 3ME8A 3WD6A 3CTGA 2O8VB 4WBRD 1OC9A 4QQ7A 1M3IA 4X1UA 3RAZA 5CO3A 4A5PA 5GAGc 3FKFA 4YAPA 5M3FL 3IK9A 3LGCA 2XJVA 1TRVA 4EL1A 3NZNA 4ZILA 1ERTA 2F8FA 2IIYA 1SKSB 1WCML 1LU4A 4RQXA 3F6FA 4AHZA 1U3AA 3VFIA 4F03A 2F51A 3S1ML 5MFZA 4BY1L 1PKWA 4H86A 4DSSB 3LPEB 1V98A 4XS4A 2R7ZL 3FK8A 3MQKB 3WYWA 1S3RA 2HYXA 4TXVA 4IN0A 5F0GA 4ACSA 3M4OL 3P7XA 3V1WA 1MEKA 2K18A 2H75A 4V1Ap 2FWGA 4DSQA 4CHSA 5MLC3 2DC5A 1ZGNA 2NPBA 3CRTA 4GSSA 3S1QL 3GKNA 4WBJA 3UBLA 2E2JL 1AQVA 3GX0A 1EOHA 3FKIL 1A8LA 3FR3A 5D9TA 2R0PA 5G1KA 5FT3A 2P5QA 3KCMA 3QAGA 5IMDA 3I9V2 1TW9A 4CY8A 3UOMA 4DVCA 5D9VA 6RXNA 2HSHA 4QL7A 4F0CA 4A3FL 4ZBDA 2WB9A 1SK0A 1AQWA 1CQHA 2C8UA 2VCVA 3TOUA 1B71A 3ED3A 1TK0B 4ULXA 3ZG6A 3ERGA 2KP2A 3LW9A 3D6IA 4ML6A 1TWAL 2XJSA 1OC3A 2XJRA 3LJRA 4KSMA 1J08A 4OD7A 4TR1B 1GLQA 2NDOA 4YWLA 1U88A 4TXOB 1TJDA 3IHQA 1YKCA 3A3TA 1F2EA 2XBIA 5C44L 1SK2A 2PMZP 2IPAA 4AHYA 3TJGA 3GH6A 4KE3A 5M5WL 2WZ9A 2OKAA 1HQOA 2PVOC 4KDXA 4YQVA 3C8EA 2JZTA 11GSA 3W8SA 4JRRA 4QL9A 6GSSA 2V41A 2E0QA 3J7Yk 1FOHA 6GSYA 2E2IL 1GTAA 3K35A 1IYIA 3KGKA 2E2MA 4GCIA 4ZB9A 2V6OA 3PL5A 2DIYA 3RPNA 3LSZA 2MS3A 2X8GA 4ZN3B 4ME3A 1E6BA 2C6AA 1XWCA 1W89A 1H75A 1OE7A 2V32A 3ME7A 4WEYA 5C4XL 2C0DA 2P0GA 4BVXB 2ZUPA 2JI2A 4J56E 4KH7A 2FHEA 3C1SA 1RK4A 2YP6A 5EY6A 5G1LA 1TDIA 2H6ZA 1PQNA 2VL9A 2RUFA 2OE1A 1TRWA 2F9SA 4LHNA 5IOXA 5CRWA 1FG4A 1EP7A 1WJKA 3HJOA 3ZLPA 3H1NA 2FWHA 6GSWA 1QGVA 4XGHA 5DQYA 4KNDA 1JLVA 2IN3A 3FRCA 5FWGA 5DM61 3ZTLA 2BTOT 3TUEA 4F82A 1TU8A 1B2OA 2O89A 2VL2C 3KTBA 1GTBA 2CKAA 1FB0A 1OE8A 4ZBAA 5D9XA 2JA6L 5AISA 2LRTA 4FYUA 3B0AB 1EV9A 1T9QA 2YZHA 4K7OA 2AYTA 4K0NA 4FYBA 1G7OA 5LD0A 3GRXA 3CXGA 3GTGL 3PPUA 3FZ4A 3FHKA 3IDVA 3UAPA 4ZL9A 3I6AA 4RUVA 2V1MA 5G2ZA 3EMPA 4D73A 2PMTA 4IJ3A 5COHA 5C04A 3UIWA 5KN2A 4PNFA 3GTPL 1ZMAA 3F4SA 3GTLL 4GWRA 3M9JA 5AI2A 4TPUA 1SMWA 6GSUA 3KIJA 2AUSB 2C3TA 3GKXA 3KJYA 5DJMA 3LYKA 3LORA 17GSA 2LCQA 4EIPA 4EUYA 13GSA 2L0ZA 2H74A 2DSXA 4I2UA 1TWGL 2IMKA 2M72A 3QMXA 1B9YC 3IE3A 4MF7A 4KCEA 4AHWA 1DX8A 1MDIA 5IP7L 3GTJL 5DVBA 1JLWA 1U6TA 4O5RA 3VPQA 1RDVA 2OA7A 4AYBP 2CV4A 4I5QA 1F4LA 4KDYA 3GV1A 2MBTA 4EIQA 3G9BA 2HSYA 3RZTA 5H5RA 2AV4A 1X5EA 2JSZA 2A6ED 1ZCPA 3P2AA 1TI1A 5BRTA 4BA7A 2IMIA 3H4KA 5KOXA 1O7UA 3RBTA 1O73A 4YAVA 1XG8A 1SENA 2N5AA 5IMAA 1NXGA 2QA1A 2BJXA 1FW1A 1ZYEA 4GF0A 3EINA 1XWKA 3E9JB 2V2GA 19GSA 4A3BL 1B2JA 12GSA 1GSQA 1PL2A 2IMEA 5EIOC 2VUML 2GZPA 4N11A 3U5RE 2PWJA 3VPBE 2FWEA 3KYUA 2HR5A 5CAXA 5H5SA 3GFKA 3TKQA 3L9UA 1XW5A 4JU5A 3FR9A 3ZFBA 3WGXA 3E3EA 4ZN1B 1PSQA 2LQQA 3ERFA 1C09A 7RXNA 2CVKA 5J9CA 2GZYA 2YJ7A 3CQZL 4MABA 1ERWA 1RDGA 1JFUA 4AR4A 4XHMA 2A69D 2OBIA 4MK3A 1TK5B 4K5SA 2B7JA 5MFPA 4OWYA 2KUCA 2JZSA 3LEFA 4POKA 1Q4JA 5JVG1 3GL5A 2KKDA 4F9ZA 1FOVA 2KP1A 5EL8A 4O32A 5HR1A 4C3JL 3HZ4A 1V9WA 3A2WA 5M5XL 2XHFA 1WRYA 4AGSA 1EGOA 1YEPA 1TOFA 1EP8A 1YF0A 5B6NA 4IVFA 1PFVA 1VZIA 3QCPA 2JZRA 4NHZA 3GSTA 4K7IA 2E7PA 2HT9A 3EU3A 4TVEA 4YKFA 1SL0B 3LWOB 2CZ2A 2HI7A 2I4AA 1SFOL 3O3TA 4PX1A 3HVNA 5ECQB 3F4RA 1IYHA 2YV9A 5E59A 4BWQA 2BE5D 1WP0A 2CVBA 4ZIJA 3UEMA 2L59A 2GMGA 3F0IA 3LFLA 4Z2UA 3WT1A 5ECIB 5ECOB 5D93A 2GQLA 1LKOA 1V2AA 3A5WA 3GTUA 1TTZA 2FWFA 2RIIA 3FZ9A 4K9ZA 5H5QA 3KH7A 2OE0A 3TOTA 5E4WA 4XRAA 3PR8A 1GTIA 1PMTA 1I9DA 4ECJA 3H3VM 2H8LA 4USSA 3Q6OA 3RPPA 5B7CA 3W8JA 1GRXA 1DVBA 1G0TA 1DE2A 4AR6A 4JAGA 3HOVL 3HAXC 1RWDA 2LTKA 2KN9A 2JADA 2PVQA 1GULA 2JI1A 2X4AA 3R2QA 3GTOL 1M7TA 1QUWA 6GSVA 3IC8A 4RI7A 3F3RA 4MJEA 5GAPD 3UVHA 4N30A 1ZL9A 2K9FA 2HRKA 2FY6A 2YPMA 5DAKB 4KX4A 2DMMA 2NVTL 4AI3A 1ZYNA 4MA9A 3K8NA 5L71A 3HKZP 4KAEA 2TRCP 1YKAA 5IMVA 1YZXA 2B7KA 2VCZA 4O5UA 4DSSA 4MZCA 3QOUA 4L8EA 2WGRA 4MZBA 4ZB8A 1PN9A 1GSDA 2XPEA 5JCWA 3GYKA 2FNOA 1TWCL 4AR3A 2Z9SA 1TRUA 2FLSA 1BRFA 3TKSC 2DJ0A 5A4WA 2PPTA 4XCSA 5DALB 1GSFA 4TKYA 1VF1A 2DMLA 2VO4A 1B13A 3VI5A 1USBA 4K2DA 3BCIA 4N10A 4PUFC 5F8BA 5GADc 4IP6A 1YV1A 1NXEA 4C2M1 4K9FA 3DYRA 3S14L 2GZZA 2MMNA 1GNWA 4EKZA 2FA4A 3HVXA 4TVMA 3RHCA 4JZQA 1R4WA 2HZEB 1EGRA 3KYYA 3D21A 4TRXA 4K0GA 4K2XA 4IKHA 3SWLA 4AJ8A 1K3YA 2IL3A 3LYPA 4OMVA 3KYWA 3FDJA 3F3QA 3QAVA 2E2GA 1A24A 3W6GA 1Y25A 3HOWL 4TR1A 1CAAA 4XIHA 2CAQA 3L9VA 2GSRA 2MYGA 3DGQA 20GSA 1I6HL 2PN8A 2Z3RB 2EIOA 2H0HA 3Q19A 3IU3I 2RFKB 4X4JA 4CW9A 4A93L 3KTLA 3TCOA 4HZ4A 3H9BA 1GTUA 2R93L 3C1RA 4G10A 3WT2A 3MPSA 3IC4A 2R3XA 1VF4A 4L0WA 4MF5A 5JWOB 3ZL5A 3IOSA 3TRXA 7GSSA 5KN0A 2F8AA 1QCVA 2Z3QB 5G30A 3N5OA 3LWQB 4EDZA 4Z2TA 1XVQA 2LJRA 1WWJA 2R0GA 1A2JA 2X8HA 2HVYC 1O6JA 1HYUA 4FYCA 3ZFLA 4ZB6A 2WB1P 1M2BA 3DXBA 4U671 4G0LA 3CTFA 2VCQA 3UL3A 3MIXA 2H1BA 3DD3A 5IYCL 4BVXA 2YWIA 2N5FA 2VAFA 2XBQA 1K0AA 3KP9A 3HXSA 3VWUA 2A2PA 4L5LA 2VL6A 2QA2A 1JHBA 3HVVA 4MCUA 2L6CA 2H0GA 2I9HA 2YCDA 2PYAA 3A5IA 4PQHA 4AI1A 3LNLA 4IQAA 2IWTA 2A4VA 4E6YA 1K3LA 22GSA 2A2RA 1WJVA 2RUEA 5DBQA 4BL7B 4KF9A 2M46A 1G6WA 4GQCA 2FA8A 1OC9B 1QXHA 3IRAA 5JVH1 1A23A 2O87A 1WMJA 1O81A 4X43A 4MLYA 3I43A 2C80A 1RQMA 1R0FA 2PBJA 3QR6A 4ECBA 1TWFL 2OJLA 3BCKA 4NV5A 5HR2A 2I3YA 5IYBL 1VZGA 3TJJA 2ERJA 2VD0A 1XOAA 5RXNA 1J0FA 1TWHL 2HRNA 4JR4A 2RLIA 4PQIA 2ES7A 4X0XA 4WETA 1ODHA 2LUSA 3NOFA 1IU6A 4XS1A 2K6VA 3LXZA 4KA0A 6GSTA 2R92L 3ZZXA 3TKRA 4A3CL 2VCXA 1A0RP 1X5DA 1SJZA 3LG6A 4N0VA 2VCTA 3IV4A 1X9SB 4G2EA 2J9UB 2GLRA 4IBPA 3MSUA 5IOWA 3FY7A 5ABRA 4JR6A 1VF2A 4XRDA 5F07A 4JADA 1TXXA 4EVMA 2C1YA 4GXZA 2DJ3A 1B4QA 3ZMKA 3RHBA 2C0FA 3C7MA 1H4OA 3TGZA 1XFLA 1RYTA 2CQ9A 2H0IA 4UY81 2MMAA 4I2TA 1HD2A 4YQUA 1ACVA 3KP8A 3UARA 5EPFA 4MH2A 1R9TL 3WGDA 1B48A 1ON4A 3U6VA 2L5OA 1O8XA 3I69A 4MMMA 4BPYA 2D2ZA 1S3CA 4A3LL 1BG5A 1Z6MA 3KM6A 4F2IA 4WR5A 2O5JD 5KOWA 5D9WA 3H99A 3L9SA 4DEJA 2EIQA 3Q18A 4G9HA 4LLRA 3BJ5A 3FW2A 2DJ1A 1PZXA 4GTUA 2DSAA 5B8BA 1WOUA 1DUGA 5C4JL 2HRAA 1YQ1A 2C3QA 1SMUA 3D5JA 2O85A 5IM9A 2NVLA 1VF3A 2LJKA 3TJBA 3HA9A 1GUHA 3CQFA 2ERSA 4PQ1A 3F8UA 2IFQA 3OR5A 1ERVA 1V40A 4ML1A 3FR6A 1XBSA 1GNEA 4HUAA 3VLNA 4EE0A 4Q5RA 4RQRA 1GUMA 2C6BA 1I50L 4G0IA 1T8EB 3IAS2 2YZUA 2JU5A 1S30A 4GSNA 2Y0SP 5ID2B 1VCXA 3PGTA 2WULA 4FO5A 2YJHA 4J57E 3HYPA 8RXNA 2H30A 1QMVA 5KEJA 4NWYA 5ENUA 2WAQP 4LHLA 5JWRB 2DIZA 4PNGA 1DE1A 2YU9L 1Z7RA 2F3MA 5HR3A 5DCGA 4HI7A 3PH9A 1N2AA 3M3YL 3M8NA 1YF1A 3LWAA 4C3HL 2HLSA 1T7PB 2YWMA 3M1GA 3KYXA 1PX7A 2QGVA 4TW5A 4V2NA 3BD2A 2NVXL 1DSBA 5DCHA 4POLA 4LL1B 3HZ8A 4HZ2A 2NTOA 4DSRA 5G5EA 4IELA 5IQYA 1FVKA 5GZZB 1TU7A 2VM2A 2H12A 3D0ZA 16GSA 1SU9A 5HFIA 1SL1B 3PIP1 4AF2A 1OC8A 2VL2A 5AIVA 2WRTA 1G6YA 1T1VA 4BBSL 2TIRA 1Z92B 5J3RA 5IO2A 2YN1A 3HOYL 3GA4A 2HE3A 4JBBA 2GT5A 4ICYA 4OCFA 5J5NA 1Z5YE 2AYJA 5DDLA 4AJ6A 3IHGA 1CADA 1LKMA 5D73A 3MNGA 5H1Sc 3HCZA 2H1GA 4G6BA 1HNCA 4I97A 2LRNA 2QL0A 1AQXA 3VPTA 2DJ2A 1IROA 2RM6A 5DM71 3D22A 2ZCTA 3MWHA 3HJYB 2N5BA 2M6OA 5J4UA 4NAXA 2V3BB 2CVDA 4RXNA 3J7Yb 1Q98A 1YDKA 2VLUA 3RDWA 4ECIA 3IK7A 4KSOA 4ZBBA 4WFN1 3WWLA 4OFTA 1O85A 5CP1A 2R4VA 1JZRA 4A3GL 1WPIA 3MAKA 4TN8A 2K8VA 3H79A 2XJUA 1GSUA 5INYA 1QQTA 4MPGA 3NIVA 2B3SA 2X8CA 2JA5L 3ZYWA 4N0ZA 2OADA 1SL2B 3AY8A 5EVOA 4PTSA 5MGNA 2PGTA 5GAHc 1SYXA 4V196 2LEGA 1X5CA 5ECSA 2WS2A 5K2ME 1K0CA 3D4MA 2AJQB 5LNKe 3FZAA 4K1FA 5CYYA 4A3KL 3HOZL 3HKRA 2J9HA 3MYDA 1M99A 2JL4A 1BAYA 4KB3A 1TKDB 4KGIA 3APSA 5DALA 3KEBA 1LBKA 3J7Y1 3US3A 1EV4A 3KZQA 1A0FA 1A2LA 1MD3A 3P90A 1AAZA 2FD3A 1JZWA 4V2MA 1ERUA 2L57A 3D4TA 1NNQA 3GTQL 1F6MC 1M0UA 3PINA 2H66A 4MJCA 4Q5FA 3ISOA 2HZEA 1FB6A 2A4HA 3GN3A 1U3IA 5GSSA 1R0HA 1XWAA 4MPFA 1LJRA 2H73A 3DWVA 2AQCA 5FJ8L 1QYBA 1T4YA 1YK5A 2FUG2 2KHPA 3DRNA 2MBSA 1WE0A 1GUKA 4LMWA 1ZYPA 2R37A 5JCUA 4POGA 2VLVA 1YUZA 1OVNA 4MJAA 5ELGA 4FQUA 3ZIJA 1SJIA 3TJKA 3KH9A 1I5GA 2GTUA 3RZOL 2VD1A 1ZZYA 1GLPA 1GP1A 5ECHB 1ABAA 1N8JA 1I3QL 3IXRA 4IP1A 4K7NA 3BOAA 1S24A 4NXIA 1T00A 1R0JA 4A3DL 4Q5NA 4IHUA 4MDCA 2FGXA 2PSMC 5MF6A 3H97A 1Z7PA 1UVZA 3GURA 3GKMA 5A4VA 5J9BA 3DVXA 1SKRB 5IIZA 1SD8A 1GWCA 1IRNA 4OO5A 1G7EA 4OCEA 4RI6A 1ST9A 2PVXA 4BVYB 4MP4A 1HNAA 2NVYL 2NYDA 2QKEA 2VCWA 1X0RA 3JCML 5KN3A 2IMDA 4K6XA 2H1AA 1TP9A 2DBCA 2B5EA 3CBUA 4BIKA 1R5PA 4MNNA 2J23A 3WWNB 4HU9A 2EY4E 2I1UA 2DLXA 3GTUB 4F0BA 2XJPA 4PUAA 1GSEA 2VOCA 5AN9H 3UMAA 1YY7A 3S15L 2JA8L 2H76A 3UJ1A 3RZ6A 1NM3A 3KMNA 1M9AA 3PWFA 3LWVB 1XOBA 4P3YB 3ZVJD 4IS0A 2L4CA 2PUKC 3UBKA 4TXOA 4BL7A 2B1KA 4A3JL 4FIWA 2GT6A 1PFOA 2E2HL 1QK8A 2QSIA 3UVTA 4WR4A 3EE2A 5B8AA 9GSSA 1QFNA 1VRSD 1THXA 1W4VA 3ZMLA 1YEXA 3A2VA 1XWBA 4CY6A 1AIUA 5CRDA 4K8MA 2AB6A 1PRXA 1A2MA 2HFDA 2HNLA 18GSA 3S1NL 3FMWA 4G19A 5KN1A 3PKJA 1MD4A 1QQ2A 5D96A 3E0UA 2EC4A 5AI3A 3PO3L 5M3ML 1PN0A 2LRCA 2ON5A 4NHWA 1R7HA 1R5AA 3B08B 5FLML 5GAND 4BY7L 3QFAC 5HFKA 4HU7A 4ZL8A 2CA8A 4WF5A 2OBKA 1XZOA 2KLXA 4A3ML 3EC3A 1IU5A 2M4YA 3KXOA 3JR7A 3KYVA 3TKSA 1K3OA 1NHOA 1Y1WL 3HHVA 1M2DA 3G7JA 2XC2A 4GLTA 4GSTA 4YQMA 4POMA 5ECLB 5A5KA 3ZIVA 1V57A 3QPMA 4IW9A 3QAWA 4EF0A 2H1DA 2KOKA 5ELAA 1KBNA 5FHIA 3IR4A 6GSXA 3QD9A 3C71A 3S17L 4CDOA 1PKZA 1K0BA 1X9MB 1GH2A 1B9XC 3CSJA 2TRXA 1LTLA 1VGLA 14GSA 4L0UA 2YANA 5JWQB 5IO0A 3CSIA 2GSTA 4XS4B 4TR3A 1EOGA 1PGTA 2GQKA 2AHEA 1KEBA 1E2YA 5JCGA 1PA3A 3EVIA 4Y7NL 1BFYA 2FCHA 2HZFA 1PX6A 4JAFA 1HNBA 3VURA 3EU4A 2R5GA 2AAWA 1FVJA 1SK1A 2H19A 2R0CA 3GTML 2L6DA 3I4ML 5DQSA 4HSCX 5HR0A 2C3NA 4O7HA 1RW1A 3QVDA 1XCCA 4WXTA 4GS7D 4HJ2A 4OO4A 1BQ8A 2CT6A 3L78A 1P7PA 4J2FA 1T4ZA 3F9UA 2WJUA 1IW7D 4AJ7A 3VWWA 1DBYA 3IAM2 3SBCA 3M0FA 3S16L 2O7KA 3EYTA 3O76A 2H71A 1S3AA 3ZREA 1PD21 3EMXA 5ID2A 1EWXA 4GRFA 2IJYA 3MSZA 2ON7A 3GH9A 3CMIA 4HS1A 3RZDL 4WF4A 2H72A 1UA5A 1R26A 1URMA 1KNGA 3R3EA 3S1RL 1V58A 3A2XA 3NFPI 1FHEA 1C72A 1Z6NA 1K0DA 3DKSA 4KDUA 2B5YA 2K8SA 1MDJA 2OE3A 2MMOA 4OFMA 2X49A 3WGEA 3I4NL 3QDNA 4KUNA 1ML6A 1AC1A 2YWOA 3J7Z1 2B63L 3HVSA 4FH8A 3GL3A 2A2SA 4QIWP 1Z3EA 1AUCA 3F63A 3H8QA 3GKKA 3GX8A 4LA1A 5IMCA 4HEA2 2LKUA 4E8HA 3MDKA 4MH3A 2M6PA 1XIYA 1BQ7A 1SJ6A 2HSMA 4YWMA 3ZITA 1M9BA 4EO3A 5AGYA 3SS2A 5ECNB 4TOPA 2RDVA 1F3AA 2G2QA 1R0IA 2YOIA 5IP9L 1B8XA 1T3BA 2H6XA 3FYGA 2CZ3A 4NMUA 2YWNA 3HJMA 5HQPA 3G7IA 2GVPA 1Y1VL 4Q5QA 2M80A 1TK8B 2LV3A 5G31A 1K83L 3EWLA 1UC7A 2OACA 1BX9A 3F6DA 2CAIA 3GMFA 5AIXA 2LNSA 5IMZA 2DKHA 5ECPB 5F06A 2LNTA 5LCZA 4IQ1A 1K0OA 1RYQA 3IA1A 1NSWA 3CSHA 2PERA 1VZHA 2JI3A 1GSYA 2P31A 3APQA 1K0NA 1F3BA 3FEUA 3H0GL 4XTSA 1M3JA 3H93A 3KD0A 1JYBA 2CX3A 3LWRB 2NVQL 4A3IL 2VIMA 3S2DL 4AR5A 2C0EA 4NPBA 1BJXA 3TRPA 5M5YL 2K2DA 3GIXA 1SMMA 1TI3A 2REMA 2RM5A 4LL4B 1BEDA 1NHYA 5A4UA 4Z2RA 3PO2L 1J9BA 2R2JA 4L5OA 2BMXA 3LQ7A 4YKGA 2LQOA 2HRFA 1X9WB 3VWVA 1FO5A 3FZ5A 2VUPA 4PXOA 1EEJA 1FHHA
chains in the Genus database with same CATH topology
4JEDA 3TRQA 2V0EA 3RYGA 5GAEc 3P8WA 10GSA 3F4TA 2GQMA 1MDKA 3VI7A 2H6YA 1OWBA 3TKPA 4D73B 5IPGA 2QC7A 5G5FA 3L4NA 3C73A 2GS3A 4ZL7A 3M9KA 2EIRA 2XPDA 5ECMB 1YJ6A 4V2LA 1S3DA 3PZAA 2VM1A 3ERWA 4ILFA 2GSSA 2L5LA 4TR4A 3GNJA 2R6KA 1MTCA 2IFQB 1EEMA 1OKDA 3VWXA 5CREA 4HDEA 1XW9A 1JZOA 2VL3A 5D8IA 1CQGA 4HOJA 2NBSA 3L0HA 4K5RA 2L4QA 5DAKA 1GL8A 3CYNA 4JAEA 1AXDA 2B1LA 1ZYQB 1BQ9A 3P8BA 4XXBB 4I8BA 1XW6A 4XS6A 5IY0A 1BYEA 1THOA 2X64A 4HQSA 2C0GA 2LS5A 1K0MA 2XJQA 4LMVA 5HFGA 2V6KA 2JSYA 3DVWA 2UZ8A 1XPVA 5CRGA 3TKSE 8GSSA 1OKTA 3IBHA 3N9JA 1FHMA 1F9MA 2G0FA 4KW6A 1GSSA 4MF6A 3PIO1 4O92A 4V1Ag 4PGTA 1YUXA 2VLTA 4TR0A 3TDGA 5EINC 1B4PA 2MZCA 2ZIXA 4E8EA 3LXTA 3HDCA 1SKWB 4B8CD 5BMUA 1TRSA 4MJBA 1AW9A 1EZKA 1SD9A 1O8WA 4ECCA 3GSSA 4GQFA 1BE7A 2DJKA 2YNXA 4BVYA 1SYRA 1XXUA 2GSQA 3DEXA 2M4VA 2X99A 2XJTA 1H7VA 3S9FA 2YV7A 4EC0A 1YK4A 1WIKA 2ZNMA 2B6MA 3GHAA 5CRHA 5CNWA 3QFBC 1A8YA 4Z7XA 3ZRDA 3KMOA 3Q74A 3QQCE 2MMZA 2WCIA 4ZXGA 2JACA 1NW2A 3HY2A 3TB2A 1T9OA 1XWGA 2C4JA 4NV2A 1FAAA 2H70A 1ZOFA 1UN2A 4POBA 2CX4A 2P5RA 1Y6EA 1OAZA 2A6HD 3IPZA 4I6XA 4AI2A 4PURA 4YH2A 4HQZA 5B6MA 3DIEA 4EXJA 2V0FA 3APOA 4O5QA 4BWSA 4ISDA 4EDYA 1PL1A 2CR8A 3ZVJA 5DJLA 5C00A 3G7YA 5IMFA 1ILOA 2ALBA 4POFA 2GDRA 4OFNA 4AHXA 2H01A 2PU9C 4ID0A 1OYJA 1R0GA 2LSTA 3M3MA 2IMFA 2AUVA 1E8JA 3EURA 5AN1A 5F05A 2PVEA 1LKPA 4IJIA 1OWCA 1S2ZA 3CRUA 1F37A 1XVWA 1ZRPA 3GUSA 3PKIA 5GSTA 3BBYA 2A68D 1U87A 1Z9HA 1T9PA 2I81A 2B5ID 5ECKB 4HJMA 4KCAA 2GGTA 2WDUA 2LJAA 1RB9A 4MZWA 3EPTA 2HXKA 5IPHA 3HJPA 3DMLA 2B5XA 1KTEA 4G0KA 4IGJA 1JZDA 2WFCA 2CKCA 2DJJA 4WKWA 1M2AA 2DKIA 4JE1A 4AI0A 3VK9A 5ECRB 3O6TA 5J41A 3HD5A 3TJFA 3A44A 3ME8A 3WD6A 3CTGA 2O8VB 4WBRD 1OC9A 4QQ7A 4X1UA 3RAZA 5CO3A 4A5PA 5GAGc 3FKFA 4YAPA 3IK9A 3LGCA 2XJVA 1TRVA 4EL1A 3NZNA 4ZILA 1ERTA 2F8FA 2IIYA 1SKSB 1LU4A 4RQXA 3F6FA 4AHZA 1U3AA 3VFIA 4F03A 2F51A 5MFZA 1PKWA 4H86A 4DSSB 3LPEB 1V98A 4XS4A 3FK8A 3WYWA 2HYXA 4TXVA 4IN0A 5F0GA 4ACSA 3P7XA 3V1WA 1MEKA 2K18A 2H75A 4V1Ap 2FWGA 4DSQA 4CHSA 5MLC3 2DC5A 1ZGNA 2NPBA 3CRTA 4GSSA 3GKNA 4WBJA 3UBLA 1AQVA 3GX0A 1EOHA 1A8LA 3FR3A 5D9TA 2R0PA 5G1KA 5FT3A 2P5QA 3KCMA 3QAGA 5IMDA 3I9V2 1TW9A 4CY8A 3UOMA 4DVCA 5D9VA 6RXNA 2HSHA 4QL7A 4F0CA 4ZBDA 2WB9A 1SK0A 1AQWA 1CQHA 2C8UA 2VCVA 3TOUA 1B71A 3ED3A 1TK0B 4ULXA 3ZG6A 3ERGA 2KP2A 3LW9A 3D6IA 4ML6A 2XJSA 1OC3A 2XJRA 3LJRA 4KSMA 1J08A 4OD7A 4TR1B 1GLQA 2NDOA 4YWLA 1U88A 4TXOB 1TJDA 3IHQA 1YKCA 3A3TA 1F2EA 2XBIA 1SK2A 2IPAA 4AHYA 3TJGA 3GH6A 4KE3A 2WZ9A 2OKAA 1HQOA 2PVOC 4KDXA 4YQVA 3C8EA 2JZTA 11GSA 3W8SA 4JRRA 4QL9A 6GSSA 2V41A 2E0QA 3J7Yk 1FOHA 6GSYA 1GTAA 3K35A 1IYIA 3KGKA 2E2MA 4GCIA 4ZB9A 2V6OA 2DIYA 3RPNA 3LSZA 2MS3A 2X8GA 4ZN3B 4ME3A 1E6BA 2C6AA 1XWCA 1W89A 1H75A 1OE7A 2V32A 3ME7A 4WEYA 2C0DA 2P0GA 4BVXB 2ZUPA 2JI2A 4J56E 4KH7A 2FHEA 3C1SA 1RK4A 2YP6A 5EY6A 5G1LA 1TDIA 2H6ZA 1PQNA 2VL9A 2RUFA 2OE1A 1TRWA 2F9SA 4LHNA 5IOXA 5CRWA 1FG4A 1EP7A 1WJKA 3HJOA 3ZLPA 3H1NA 2FWHA 6GSWA 1QGVA 4XGHA 5DQYA 4KNDA 1JLVA 2IN3A 3FRCA 5FWGA 5DM61 3ZTLA 2BTOT 3TUEA 4F82A 1TU8A 1B2OA 2O89A 2VL2C 3KTBA 1GTBA 2CKAA 1FB0A 1OE8A 4ZBAA 5D9XA 5AISA 2LRTA 4FYUA 3B0AB 1EV9A 1T9QA 2YZHA 4K7OA 2AYTA 4K0NA 4FYBA 1G7OA 5LD0A 3GRXA 3CXGA 3PPUA 3FZ4A 3FHKA 3IDVA 3UAPA 4ZL9A 3I6AA 4RUVA 2V1MA 5G2ZA 3EMPA 4D73A 2PMTA 4IJ3A 5COHA 5C04A 3UIWA 5KN2A 4PNFA 1ZMAA 3F4SA 4GWRA 3M9JA 5AI2A 4TPUA 1SMWA 6GSUA 3KIJA 2C3TA 3GKXA 3KJYA 5DJMA 3LYKA 3LORA 17GSA 2LCQA 4EIPA 4EUYA 13GSA 2L0ZA 2H74A 2DSXA 4I2UA 2IMKA 2M72A 3QMXA 1B9YC 3IE3A 4MF7A 4KCEA 4AHWA 1DX8A 1MDIA 5DVBA 1JLWA 1U6TA 4O5RA 3VPQA 1RDVA 2OA7A 2CV4A 4I5QA 4KDYA 3GV1A 2MBTA 4EIQA 3G9BA 2HSYA 3RZTA 5H5RA 2AV4A 1X5EA 2JSZA 2A6ED 1ZCPA 3P2AA 1TI1A 5BRTA 4BA7A 2IMIA 3H4KA 5KOXA 1O7UA 3RBTA 1O73A 4YAVA 2N5AA 1SENA 5IMAA 1NXGA 2QA1A 2BJXA 1FW1A 1ZYEA 4GF0A 3EINA 1XWKA 3E9JB 2V2GA 19GSA 1B2JA 12GSA 1GSQA 1PL2A 2IMEA 5EIOC 2GZPA 4N11A 3U5RE 2PWJA 3VPBE 2FWEA 3KYUA 2HR5A 5CAXA 5H5SA 3GFKA 3TKQA 3L9UA 1XW5A 4JU5A 3FR9A 3ZFBA 3WGXA 3E3EA 4ZN1B 1PSQA 2LQQA 3ERFA 1C09A 7RXNA 2CVKA 5J9CA 2GZYA 2YJ7A 4MABA 1ERWA 1RDGA 1JFUA 4AR4A 4XHMA 2A69D 2OBIA 4MK3A 1TK5B 4K5SA 2B7JA 5MFPA 4OWYA 2KUCA 2JZSA 3LEFA 4POKA 1Q4JA 5JVG1 3GL5A 2KKDA 4F9ZA 1FOVA 2KP1A 5EL8A 4O32A 5HR1A 3HZ4A 1V9WA 3A2WA 2XHFA 1WRYA 4AGSA 1EGOA 1YEPA 1TOFA 1EP8A 1YF0A 5B6NA 4IVFA 1VZIA 3QCPA 2JZRA 4NHZA 3GSTA 4K7IA 2E7PA 2HT9A 3EU3A 4TVEA 4YKFA 1SL0B 2CZ2A 2HI7A 2I4AA 3O3TA 4PX1A 5ECQB 3F4RA 1IYHA 2YV9A 5E59A 4BWQA 2BE5D 1WP0A 2CVBA 4ZIJA 3UEMA 2L59A 2GMGA 3F0IA 3LFLA 4Z2UA 3WT1A 5ECIB 5ECOB 5D93A 2GQLA 1LKOA 1V2AA 3A5WA 3GTUA 1TTZA 2FWFA 2RIIA 3FZ9A 4K9ZA 5H5QA 3KH7A 2OE0A 3TOTA 5E4WA 4XRAA 3PR8A 1GTIA 1PMTA 1I9DA 4ECJA 2H8LA 4USSA 3Q6OA 3RPPA 5B7CA 3W8JA 1GRXA 1DVBA 1G0TA 1DE2A 4AR6A 4JAGA 2LTKA 1RWDA 2KN9A 3R2QA 2JADA 1GULA 2JI1A 2PVQA 2X4AA 6GSVA 1M7TA 1QUWA 3IC8A 4RI7A 3F3RA 4MJEA 5GAPD 3UVHA 4N30A 1ZL9A 2K9FA 2HRKA 2FY6A 2YPMA 5DAKB 4KX4A 2DMMA 4AI3A 1ZYNA 4MA9A 3K8NA 5L71A 4KAEA 2TRCP 1YKAA 5IMVA 1YZXA 2B7KA 2VCZA 4O5UA 4DSSA 4MZCA 3QOUA 4L8EA 2WGRA 4MZBA 4ZB8A 1PN9A 1GSDA 2XPEA 5JCWA 3GYKA 2FNOA 4AR3A 2Z9SA 1TRUA 2FLSA 1BRFA 3TKSC 2DJ0A 5A4WA 2PPTA 4XCSA 5DALB 1GSFA 4TKYA 1VF1A 2DMLA 2VO4A 1B13A 3VI5A 1USBA 4K2DA 3BCIA 4N10A 4PUFC 5F8BA 5GADc 4IP6A 1YV1A 1NXEA 4K9FA 3DYRA 2GZZA 2MMNA 1GNWA 4EKZA 2FA4A 3HVXA 4TVMA 3RHCA 4JZQA 1R4WA 2HZEB 1EGRA 3KYYA 3D21A 4TRXA 4K0GA 4K2XA 4IKHA 3SWLA 4AJ8A 1K3YA 2IL3A 3LYPA 4OMVA 3KYWA 3F3QA 3QAVA 2E2GA 1A24A 3W6GA 1Y25A 4TR1A 1CAAA 4XIHA 2CAQA 3L9VA 2GSRA 2MYGA 3DGQA 20GSA 2PN8A 2Z3RB 2EIOA 2H0HA 3Q19A 3IU3I 4X4JA 4CW9A 3KTLA 3TCOA 4HZ4A 1GTUA 3C1RA 4G10A 3WT2A 3MPSA 3IC4A 2R3XA 1VF4A 4L0WA 4MF5A 5JWOB 3ZL5A 3IOSA 3TRXA 7GSSA 5KN0A 2F8AA 1QCVA 2Z3QB 5G30A 3N5OA 4EDZA 4Z2TA 1XVQA 2LJRA 1WWJA 2R0GA 1A2JA 2X8HA 1O6JA 1HYUA 4FYCA 3ZFLA 4ZB6A 1M2BA 3DXBA 4U671 4G0LA 3CTFA 2VCQA 3UL3A 3MIXA 2H1BA 3DD3A 4BVXA 2YWIA 2N5FA 2VAFA 2XBQA 1K0AA 3KP9A 3HXSA 3VWUA 2A2PA 4L5LA 2VL6A 2QA2A 1JHBA 3HVVA 4MCUA 2L6CA 2H0GA 2I9HA 2YCDA 2PYAA 3A5IA 4PQHA 4AI1A 3LNLA 4IQAA 2IWTA 2A4VA 4E6YA 1K3LA 22GSA 2A2RA 1WJVA 2RUEA 5DBQA 4BL7B 4KF9A 2M46A 1G6WA 4GQCA 2FA8A 1OC9B 1QXHA 3IRAA 5JVH1 1A23A 2O87A 1WMJA 1O81A 4X43A 4MLYA 3I43A 2C80A 1RQMA 1R0FA 2PBJA 3QR6A 4ECBA 2OJLA 3BCKA 4NV5A 5HR2A 2I3YA 1VZGA 3TJJA 2ERJA 2VD0A 1XOAA 5RXNA 1J0FA 2HRNA 4JR4A 2RLIA 4PQIA 2ES7A 4X0XA 4WETA 1ODHA 2LUSA 3NOFA 1IU6A 4XS1A 2K6VA 3LXZA 4KA0A 6GSTA 3ZZXA 3TKRA 2VCXA 1A0RP 1X5DA 1SJZA 3LG6A 4N0VA 2VCTA 3IV4A 1X9SB 4G2EA 2J9UB 2GLRA 4IBPA 3MSUA 5IOWA 3FY7A 5ABRA 4JR6A 1VF2A 4XRDA 5F07A 4JADA 1TXXA 4EVMA 2C1YA 4GXZA 2DJ3A 1B4QA 3ZMKA 3RHBA 2C0FA 3C7MA 1H4OA 3TGZA 1XFLA 1RYTA 2CQ9A 2H0IA 4UY81 2MMAA 4I2TA 1HD2A 4YQUA 1ACVA 3KP8A 3UARA 5EPFA 4MH2A 3WGDA 1B48A 1ON4A 3U6VA 2L5OA 1O8XA 3I69A 4MMMA 4BPYA 2D2ZA 1S3CA 1Z6MA 1BG5A 3KM6A 4F2IA 4WR5A 2O5JD 5KOWA 5D9WA 3L9SA 4DEJA 2EIQA 3Q18A 4G9HA 4LLRA 3BJ5A 3FW2A 2DJ1A 4GTUA 2DSAA 5B8BA 1WOUA 1DUGA 2HRAA 1YQ1A 2C3QA 1SMUA 3D5JA 2O85A 5IM9A 2NVLA 1VF3A 2LJKA 3TJBA 3HA9A 1GUHA 2ERSA 4PQ1A 3F8UA 2IFQA 3OR5A 1ERVA 1V40A 4ML1A 3FR6A 1XBSA 1GNEA 4HUAA 3VLNA 4EE0A 4Q5RA 4RQRA 1GUMA 2C6BA 4G0IA 1T8EB 3IAS2 2YZUA 2JU5A 1S30A 4GSNA 5ID2B 1VCXA 3PGTA 2WULA 4FO5A 2YJHA 4J57E 3HYPA 8RXNA 2H30A 1QMVA 5KEJA 4NWYA 5ENUA 4LHLA 5JWRB 2DIZA 4PNGA 1DE1A 1Z7RA 2F3MA 5HR3A 5DCGA 4HI7A 3PH9A 1N2AA 3M8NA 1YF1A 3LWAA 2HLSA 1T7PB 2YWMA 3M1GA 3KYXA 1PX7A 2QGVA 4TW5A 4V2NA 3BD2A 1DSBA 5DCHA 4POLA 4LL1B 3HZ8A 4HZ2A 2NTOA 4DSRA 5G5EA 4IELA 5IQYA 1FVKA 5GZZB 1TU7A 2VM2A 2H12A 3D0ZA 16GSA 1SU9A 5HFIA 1SL1B 3PIP1 4AF2A 1OC8A 2VL2A 5AIVA 2WRTA 1G6YA 1T1VA 2TIRA 1Z92B 5J3RA 5IO2A 2YN1A 3GA4A 2HE3A 4JBBA 2GT5A 4ICYA 4OCFA 5J5NA 1Z5YE 2AYJA 5DDLA 4AJ6A 3IHGA 1CADA 1LKMA 5D73A 3MNGA 5H1Sc 3HCZA 2H1GA 4G6BA 1HNCA 4I97A 2LRNA 2QL0A 1AQXA 3VPTA 2DJ2A 1IROA 2RM6A 5DM71 3D22A 2ZCTA 3MWHA 2N5BA 2M6OA 5J4UA 4NAXA 2V3BB 2CVDA 4RXNA 3J7Yb 1Q98A 1YDKA 2VLUA 3RDWA 4ECIA 3IK7A 4KSOA 4ZBBA 4WFN1 3WWLA 4OFTA 1O85A 5CP1A 2R4VA 1JZRA 1WPIA 3MAKA 4TN8A 2K8VA 3H79A 2XJUA 1GSUA 5INYA 4MPGA 3NIVA 2B3SA 2X8CA 3ZYWA 4N0ZA 2OADA 1SL2B 3AY8A 5EVOA 4PTSA 5MGNA 2PGTA 5GAHc 1SYXA 4V196 2LEGA 1X5CA 5ECSA 2WS2A 5K2ME 1K0CA 3D4MA 2AJQB 5LNKe 3FZAA 4K1FA 5CYYA 3MYDA 3HKRA 2J9HA 1M99A 2JL4A 1BAYA 4KB3A 1TKDB 4KGIA 3APSA 5DALA 3KEBA 1LBKA 3J7Y1 3US3A 1EV4A 3KZQA 1A0FA 1A2LA 1MD3A 3P90A 1AAZA 2FD3A 1JZWA 4V2MA 1ERUA 2L57A 3D4TA 1NNQA 1F6MC 1M0UA 3PINA 2H66A 4MJCA 4Q5FA 3ISOA 2HZEA 1FB6A 2A4HA 3GN3A 1U3IA 5GSSA 1R0HA 1XWAA 4MPFA 1LJRA 2H73A 3DWVA 1QYBA 1T4YA 1YK5A 2FUG2 2KHPA 3DRNA 2MBSA 1WE0A 1GUKA 4LMWA 1ZYPA 2R37A 5JCUA 4POGA 2VLVA 1YUZA 1OVNA 4MJAA 5ELGA 4FQUA 3ZIJA 1SJIA 3TJKA 3KH9A 1I5GA 2GTUA 2VD1A 1ZZYA 1GLPA 1GP1A 5ECHB 1ABAA 1N8JA 3IXRA 4IP1A 4K7NA 3BOAA 1S24A 4NXIA 1T00A 1R0JA 4Q5NA 4IHUA 4MDCA 2FGXA 2PSMC 5MF6A 1Z7PA 1UVZA 3GURA 3GKMA 5A4VA 5J9BA 3DVXA 1SKRB 5IIZA 1SD8A 1GWCA 1IRNA 4OO5A 1G7EA 4OCEA 4RI6A 1ST9A 2PVXA 4BVYB 4MP4A 1HNAA 2QKEA 2NYDA 2VCWA 1X0RA 3JCML 5KN3A 2IMDA 4K6XA 2H1AA 1TP9A 2DBCA 2B5EA 3CBUA 1R5PA 4MNNA 2J23A 3WWNB 4HU9A 2I1UA 2DLXA 3GTUB 4F0BA 2XJPA 4PUAA 1GSEA 2VOCA 5AN9H 3UMAA 1YY7A 2H76A 3UJ1A 3RZ6A 1NM3A 3KMNA 1M9AA 3PWFA 4P3YB 1XOBA 3ZVJD 4IS0A 2L4CA 2PUKC 3UBKA 4TXOA 4BL7A 2B1KA 4FIWA 2GT6A 1QK8A 2QSIA 3UVTA 4WR4A 3EE2A 5B8AA 9GSSA 1QFNA 1VRSD 1THXA 1W4VA 3ZMLA 1YEXA 3A2VA 1XWBA 4CY6A 1AIUA 5CRDA 4K8MA 2AB6A 1PRXA 1A2MA 2HFDA 2HNLA 18GSA 3FMWA 4G19A 5KN1A 3PKJA 1MD4A 1QQ2A 5D96A 3E0UA 2EC4A 5AI3A 1PN0A 2LRCA 2ON5A 4NHWA 1R7HA 1R5AA 3B08B 5GAND 5HFKA 3QFAC 4HU7A 4ZL8A 2CA8A 4WF5A 2OBKA 1XZOA 2KLXA 3EC3A 1IU5A 2M4YA 3KXOA 3KYVA 3TKSA 1K3OA 1NHOA 3HHVA 1M2DA 3G7JA 2XC2A 4GLTA 4GSTA 4YQMA 4POMA 5ECLB 5A5KA 3ZIVA 1V57A 3QPMA 4IW9A 3QAWA 4EF0A 2H1DA 2KOKA 5ELAA 1KBNA 5FHIA 3IR4A 6GSXA 3QD9A 3C71A 4CDOA 1PKZA 1K0BA 1X9MB 1GH2A 1B9XC 3CSJA 2TRXA 1LTLA 1VGLA 14GSA 4L0UA 2YANA 5JWQB 5IO0A 3CSIA 2GSTA 4XS4B 4TR3A 1EOGA 1PGTA 2GQKA 2AHEA 1KEBA 1E2YA 5JCGA 1PA3A 3EVIA 1BFYA 2FCHA 2HZFA 1PX6A 4JAFA 1HNBA 3VURA 3EU4A 2R5GA 2AAWA 1FVJA 1SK1A 2H19A 2R0CA 2L6DA 5DQSA 5HR0A 2C3NA 4O7HA 1RW1A 3QVDA 1XCCA 4WXTA 4GS7D 4HJ2A 4OO4A 1BQ8A 2CT6A 3L78A 4J2FA 1T4ZA 3F9UA 2WJUA 1IW7D 4AJ7A 3VWWA 1DBYA 3IAM2 3SBCA 3M0FA 2O7KA 3EYTA 3O76A 2H71A 1S3AA 3ZREA 1PD21 3EMXA 5ID2A 1EWXA 4GRFA 2IJYA 3MSZA 2ON7A 3GH9A 3CMIA 4HS1A 4WF4A 2H72A 1UA5A 1R26A 1URMA 1KNGA 3R3EA 1V58A 3A2XA 3NFPI 1FHEA 1C72A 1Z6NA 1K0DA 3DKSA 4KDUA 2B5YA 2K8SA 1MDJA 2OE3A 2MMOA 4OFMA 2X49A 3WGEA 3QDNA 4KUNA 1ML6A 1AC1A 2YWOA 3J7Z1 3HVSA 4FH8A 3GL3A 2A2SA 1Z3EA 1AUCA 3F63A 3H8QA 3GKKA 3GX8A 4LA1A 5IMCA 4HEA2 2LKUA 4E8HA 3MDKA 4MH3A 2M6PA 1XIYA 1BQ7A 1SJ6A 2HSMA 4YWMA 3ZITA 1M9BA 4EO3A 5AGYA 3SS2A 5ECNB 4TOPA 2RDVA 1F3AA 2G2QA 1R0IA 2YOIA 1B8XA 1T3BA 2H6XA 3FYGA 2CZ3A 4NMUA 2YWNA 3HJMA 5HQPA 3G7IA 2GVPA 4Q5QA 2M80A 1TK8B 2LV3A 5G31A 3EWLA 1UC7A 2OACA 1BX9A 3F6DA 2CAIA 3GMFA 5AIXA 2LNSA 5IMZA 2DKHA 5ECPB 5F06A 2LNTA 5LCZA 4IQ1A 1K0OA 1RYQA 3IA1A 1NSWA 3CSHA 2PERA 1VZHA 2JI3A 1GSYA 2P31A 3APQA 1K0NA 1F3BA 3FEUA 4XTSA 3H93A 3KD0A 1JYBA 2CX3A 2VIMA 4AR5A 2C0EA 4NPBA 1BJXA 3TRPA 2K2DA 3GIXA 1SMMA 1TI3A 2REMA 2RM5A 4LL4B 1BEDA 1NHYA 5A4UA 4Z2RA 1J9BA 2R2JA 4L5OA 2BMXA 3LQ7A 4YKGA 2LQOA 2HRFA 1X9WB 3VWVA 1FO5A 3FZ5A 2VUPA 4PXOA 1EEJA 1FHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JED A;  3TRQ A;  3P8W A;  10GS A;  3F4T A;  2GQM A;  1MDK A;  3VI7 A;  2H6Y A;  4D73 B;  3TKP A;  5IPG A;  2QC7 A;  5G5F A;  3L4N A;  3C73 A;  2GS3 A;  4ZL7 A;  3M9K A;  2EIR A;  2XPD A;  5ECM B;  1YJ6 A;  4V2L A;  1S3D A;  2VM1 A;  3ERW A;  4ILF A;  2GSS A;  2L5L A;  4TR4 A;  3GNJ A;  2R6K A;  1MTC A;  2IFQ B;  1EEM A;  1OKD A;  3VWX A;  5CRE A;  4HDE A;  1XW9 A;  1JZO A;  2VL3 A;  5D8I A;  1CQG A;  4HOJ A;  2NBS A;  3L0H A;  2L4Q A;  5DAK A;  1GL8 A;  3CYN A;  1AXD A;  2B1L A;  1ZYQ B;  4XXB B;  4I8B A;  4XS6 A;  1XW6 A;  1BYE A;  1THO A;  2X64 A;  4HQS A;  2C0G A;  2LS5 A;  1K0M A;  4LMV A;  5HFG A;  2V6K A;  2JSY A;  3DVW A;  1XPV A;  5CRG A;  3TKS E;  8GSS A;  1OKT A;  3IBH A;  3N9J A;  1F9M A;  2G0F A;  4KW6 A;  1GSS A;  4MF6 A;  4O92 A;  4V1A g;  4PGT A;  2VLT A;  4TR0 A;  3TDG A;  1B4P A;  2MZC A;  4E8E A;  3LXT A;  3HDC A;  1SKW B;  1TRS A;  4MJB A;  1AW9 A;  1EZK A;  1SD9 A;  1O8W A;  4ECC A;  3GSS A;  4GQF A;  2DJK A;  2YNX A;  4BVY A;  1SYR A;  1XXU A;  2GSQ A;  3DEX A;  2X99 A;  3S9F A;  2YV7 A;  4EC0 A;  1WIK A;  2ZNM A;  2B6M A;  3GHA A;  5CRH A;  5CNW A;  3QFB C;  1A8Y A;  4Z7X A;  3ZRD A;  3KMO A;  3Q74 A;  2MMZ A;  2WCI A;  4ZXG A;  2JAC A;  1NW2 A;  3HY2 A;  3TB2 A;  1XWG A;  2C4J A;  4NV2 A;  1FAA A;  2H70 A;  1ZOF A;  1UN2 A;  4POB A;  2CX4 A;  2P5R A;  1Y6E A;  1OAZ A;  3IPZ A;  4I6X A;  4PUR A;  4YH2 A;  4HQZ A;  5B6M A;  3DIE A;  4EXJ A;  3APO A;  4BWS A;  4ISD A;  4EDY A;  1PL1 A;  3ZVJ A;  5DJL A;  5C00 A;  3G7Y A;  5IMF A;  1ILO A;  2ALB A;  2GDR A;  4OFN A;  2H01 A;  2PU9 C;  4ID0 A;  1OYJ A;  2LST A;  3M3M A;  2IMF A;  2AUV A;  3EUR A;  5AN1 A;  5F05 A;  4IJI A;  3CRU A;  1F37 A;  1XVW A;  3GUS A;  5GST A;  3BBY A;  1U87 A;  1Z9H A;  2I81 A;  5ECK B;  4HJM A;  4KCA A;  2GGT A;  2WDU A;  2LJA A;  4MZW A;  2HXK A;  5IPH A;  3HJP A;  3DML A;  2B5X A;  1KTE A;  4IGJ A;  1JZD A;  2WFC A;  2DJJ A;  4WKW A;  1M2A A;  4JE1 A;  3VK9 A;  5ECR B;  3O6T A;  5J41 A;  3HD5 A;  3TJF A;  3ME8 A;  3WD6 A;  3CTG A;  2O8V B;  4WBR D;  1OC9 A;  4QQ7 A;  4X1U A;  3RAZ A;  5CO3 A;  3FKF A;  4YAP A;  3IK9 A;  3LGC A;  1TRV A;  4EL1 A;  3NZN A;  4ZIL A;  1ERT A;  2F8F A;  2IIY A;  1SKS B;  1LU4 A;  4RQX A;  3F6F A;  1U3A A;  3VFI A;  4F03 A;  2F51 A;  1PKW A;  4H86 A;  4DSS B;  1V98 A;  4XS4 A;  3FK8 A;  3WYW A;  2HYX A;  4TXV A;  4IN0 A;  5F0G A;  4ACS A;  3P7X A;  3V1W A;  1MEK A;  2K18 A;  2H75 A;  4V1A p;  2FWG A;  4DSQ A;  4CHS A;  2DC5 A;  1ZGN A;  2NPB A;  3CRT A;  4GSS A;  3GKN A;  4WBJ A;  3UBL A;  1AQV A;  3GX0 A;  1EOH A;  1A8L A;  3FR3 A;  5D9T A;  5G1K A;  5FT3 A;  2P5Q A;  3KCM A;  3QAG A;  5IMD A;  3I9V 2;  1TW9 A;  3UOM A;  4DVC A;  5D9V A;  2HSH A;  4QL7 A;  4F0C A;  4ZBD A;  2WB9 A;  1SK0 A;  1AQW A;  1CQH A;  2C8U A;  2VCV A;  3TOU A;  3ED3 A;  1TK0 B;  4ULX A;  3ERG A;  2KP2 A;  3D6I A;  4ML6 A;  1OC3 A;  3LJR A;  4KSM A;  1J08 A;  4OD7 A;  4TR1 B;  1GLQ A;  2NDO A;  1U88 A;  4TXO B;  1TJD A;  3IHQ A;  1YKC A;  3A3T A;  1F2E A;  2XBI A;  1SK2 A;  2IPA A;  3TJG A;  3GH6 A;  4KE3 A;  2WZ9 A;  2OKA A;  1HQO A;  2PVO C;  4KDX A;  4YQV A;  3C8E A;  2JZT A;  11GS A;  3W8S A;  4JRR A;  4QL9 A;  6GSS A;  2V41 A;  2E0Q A;  3J7Y k;  6GSY A;  1GTA A;  1IYI A;  3KGK A;  2E2M A;  4GCI A;  4ZB9 A;  2V6O A;  2DIY A;  3RPN A;  3LSZ A;  2X8G A;  1E6B A;  2C6A A;  1XWC A;  1W89 A;  1H75 A;  1OE7 A;  2V32 A;  3ME7 A;  4WEY A;  2C0D A;  2P0G A;  2ZUP A;  4J56 E;  4KH7 A;  2FHE A;  3C1S A;  1RK4 A;  2YP6 A;  5EY6 A;  5G1L A;  1TDI A;  2H6Z A;  1PQN A;  2VL9 A;  2RUF A;  2OE1 A;  1TRW A;  2F9S A;  5IOX A;  5CRW A;  1FG4 A;  1EP7 A;  1WJK A;  3HJO A;  3ZLP A;  3H1N A;  2FWH A;  6GSW A;  1QGV A;  5DQY A;  4KND A;  1JLV A;  2IN3 A;  3FRC A;  5FWG A;  3ZTL A;  2BTO T;  3TUE A;  4F82 A;  1TU8 A;  2O89 A;  2VL2 C;  3KTB A;  1GTB A;  1FB0 A;  1OE8 A;  4ZBA A;  5D9X A;  5AIS A;  2LRT A;  4FYU A;  3B0A B;  1EV9 A;  2YZH A;  4K7O A;  2AYT A;  4K0N A;  4FYB A;  1G7O A;  5LD0 A;  3GRX A;  3CXG A;  3FZ4 A;  3FHK A;  3IDV A;  3UAP A;  4ZL9 A;  3I6A A;  4RUV A;  2V1M A;  5G2Z A;  3EMP A;  4D73 A;  2PMT A;  4IJ3 A;  5COH A;  5C04 A;  3UIW A;  5KN2 A;  4PNF A;  1ZMA A;  3F4S A;  4GWR A;  3M9J A;  6GSU A;  3KIJ A;  2C3T A;  3GKX A;  3KJY A;  5DJM A;  3LYK A;  3LOR A;  17GS A;  4EUY A;  13GS A;  2H74 A;  4I2U A;  2IMK A;  2M72 A;  3QMX A;  1B9Y C;  3IE3 A;  4MF7 A;  4KCE A;  1MDI A;  5DVB A;  1JLW A;  1U6T A;  4O5R A;  3VPQ A;  2OA7 A;  2CV4 A;  4I5Q A;  4KDY A;  3GV1 A;  2MBT A;  3G9B A;  2HSY A;  5H5R A;  2AV4 A;  1X5E A;  2JSZ A;  1ZCP A;  3P2A A;  1TI1 A;  4BA7 A;  2IMI A;  3H4K A;  1O7U A;  3RBT A;  1O73 A;  4YAV A;  2N5A A;  1SEN A;  5IMA A;  2BJX A;  1FW1 A;  1ZYE A;  4GF0 A;  3EIN A;  1XWK A;  3E9J B;  2V2G A;  19GS A;  12GS A;  1GSQ A;  1PL2 A;  2IME A;  2GZP A;  4N11 A;  3U5R E;  2PWJ A;  2FWE A;  5CAX A;  5H5S A;  3GFK A;  3TKQ A;  3L9U A;  1XW5 A;  4JU5 A;  3FR9 A;  3ZFB A;  3WGX A;  3E3E A;  1PSQ A;  2LQQ A;  3ERF A;  2CVK A;  5J9C A;  2GZY A;  2YJ7 A;  4MAB A;  1ERW A;  1JFU A;  4XHM A;  1TK5 B;  2OBI A;  4MK3 A;  2B7J A;  4OWY A;  2KUC A;  2JZS A;  3LEF A;  4POK A;  1Q4J A;  3GL5 A;  4F9Z A;  1FOV A;  2KP1 A;  5EL8 A;  4O32 A;  5HR1 A;  3HZ4 A;  1V9W A;  3A2W A;  2XHF A;  1WRY A;  4AGS A;  1EGO A;  1YEP A;  1TOF A;  1EP8 A;  1YF0 A;  5B6N A;  4IVF A;  3QCP A;  2JZR A;  4NHZ A;  3GST A;  4K7I A;  2E7P A;  2HT9 A;  3EU3 A;  4TVE A;  1SL0 B;  2CZ2 A;  2HI7 A;  2I4A A;  3O3T A;  4PX1 A;  5ECQ B;  3F4R A;  1IYH A;  2YV9 A;  5E59 A;  4BWQ A;  1WP0 A;  2CVB A;  4ZIJ A;  3UEM A;  2L59 A;  3F0I A;  3LFL A;  3WT1 A;  5ECI B;  5ECO B;  5D93 A;  2GQL A;  1V2A A;  3A5W A;  3GTU A;  1TTZ A;  2FWF A;  2RII A;  3FZ9 A;  4K9Z A;  5H5Q A;  3KH7 A;  2OE0 A;  3TOT A;  5E4W A;  4XRA A;  3PR8 A;  1GTI A;  1PMT A;  1I9D A;  4ECJ A;  2H8L A;  3Q6O A;  3RPP A;  5B7C A;  3W8J A;  1GRX A;  1G0T A;  1DE2 A;  2LTK A;  3R2Q A;  2JAD A;  1GUL A;  2PVQ A;  6GSV A;  1M7T A;  1QUW A;  4RI7 A;  3F3R A;  4MJE A;  5GAP D;  3UVH A;  4N30 A;  1ZL9 A;  2K9F A;  2FY6 A;  2YPM A;  5DAK B;  4KX4 A;  2DMM A;  4MA9 A;  3K8N A;  5L71 A;  4KAE A;  2TRC P;  1YKA A;  5IMV A;  1YZX A;  2B7K A;  2VCZ A;  4DSS A;  4MZC A;  3QOU A;  4L8E A;  2WGR A;  4MZB A;  4ZB8 A;  1PN9 A;  1GSD A;  2XPE A;  5JCW A;  3GYK A;  2FNO A;  2Z9S A;  1TRU A;  2FLS A;  3TKS C;  2DJ0 A;  5A4W A;  2PPT A;  4XCS A;  5DAL B;  1GSF A;  4TKY A;  1VF1 A;  2DML A;  2VO4 A;  3VI5 A;  1USB A;  4K2D A;  3BCI A;  4N10 A;  4PUF C;  5F8B A;  4IP6 A;  3DYR A;  2GZZ A;  2MMN A;  1GNW A;  4EKZ A;  2FA4 A;  3HVX A;  3RHC A;  4JZQ A;  1R4W A;  2HZE B;  1EGR A;  3D21 A;  4TRX A;  4K0G A;  3SWL A;  4IKH A;  4AJ8 A;  1K3Y A;  2IL3 A;  3LYP A;  4OMV A;  3F3Q A;  3QAV A;  2E2G A;  1A24 A;  3W6G A;  1Y25 A;  4TR1 A;  4XIH A;  2CAQ A;  3L9V A;  2GSR A;  2MYG A;  3DGQ A;  20GS A;  2PN8 A;  2EIO A;  2H0H A;  3Q19 A;  4CW9 A;  3KTL A;  3TCO A;  4HZ4 A;  1GTU A;  3C1R A;  4G10 A;  3WT2 A;  3IC4 A;  2R3X A;  1VF4 A;  4L0W A;  4MF5 A;  5JWO B;  3ZL5 A;  3IOS A;  3TRX A;  7GSS A;  5KN0 A;  2F8A A;  5G30 A;  3N5O A;  4EDZ A;  1XVQ A;  2LJR A;  1WWJ A;  1A2J A;  2X8H A;  1O6J A;  1HYU A;  4FYC A;  3ZFL A;  4ZB6 A;  1M2B A;  3DXB A;  3CTF A;  2VCQ A;  3UL3 A;  2H1B A;  3DD3 A;  4BVX A;  2YWI A;  2N5F A;  2VAF A;  2XBQ A;  1K0A A;  3KP9 A;  3HXS A;  3VWU A;  4L5L A;  1JHB A;  3HVV A;  4MCU A;  2L6C A;  2H0G A;  2I9H A;  2YCD A;  4PQH A;  4IQA A;  2IWT A;  2A4V A;  1K3L A;  22GS A;  2A2R A;  2RUE A;  5DBQ A;  2M46 A;  1G6W A;  4GQC A;  2FA8 A;  1OC9 B;  1QXH A;  3IRA A;  1A23 A;  2O87 A;  1WMJ A;  1O81 A;  4X43 A;  4MLY A;  3I43 A;  2C80 A;  1RQM A;  2PBJ A;  3QR6 A;  4ECB A;  2OJL A;  3BCK A;  4NV5 A;  5HR2 A;  2I3Y A;  3TJJ A;  2VD0 A;  1XOA A;  1J0F A;  2HRN A;  4JR4 A;  2RLI A;  4PQI A;  2ES7 A;  4X0X A;  4WET A;  2LUS A;  3NOF A;  4XS1 A;  2K6V A;  3LXZ A;  4KA0 A;  6GST A;  3ZZX A;  3TKR A;  2VCX A;  1A0R P;  1X5D A;  1SJZ A;  3LG6 A;  4N0V A;  2VCT A;  3IV4 A;  1X9S B;  4G2E A;  2J9U B;  2GLR A;  4IBP A;  5IOW A;  3FY7 A;  5ABR A;  4JR6 A;  1VF2 A;  4XRD A;  5F07 A;  1TXX A;  4EVM A;  2C1Y A;  4GXZ A;  2DJ3 A;  1B4Q A;  3ZMK A;  3RHB A;  2C0F A;  3C7M A;  1H4O A;  3TGZ A;  1XFL A;  2CQ9 A;  2H0I A;  2MMA A;  4I2T A;  1HD2 A;  4YQU A;  1ACV A;  3KP8 A;  3UAR A;  5EPF A;  4MH2 A;  3WGD A;  1B48 A;  1ON4 A;  3U6V A;  2L5O A;  1O8X A;  3I69 A;  4MMM A;  4BPY A;  2D2Z A;  1S3C A;  1Z6M A;  1BG5 A;  3KM6 A;  4F2I A;  4WR5 A;  5D9W A;  3L9S A;  4DEJ A;  2EIQ A;  3Q18 A;  4G9H A;  4LLR A;  3BJ5 A;  3FW2 A;  2DJ1 A;  4GTU A;  2DSA A;  5B8B A;  1WOU A;  1DUG A;  1YQ1 A;  2C3Q A;  3D5J A;  2O85 A;  5IM9 A;  2NVL A;  1VF3 A;  2LJK A;  3TJB A;  3HA9 A;  1GUH A;  4PQ1 A;  3F8U A;  2IFQ A;  3OR5 A;  1ERV A;  1V40 A;  4ML1 A;  3FR6 A;  1XBS A;  1GNE A;  4HUA A;  3VLN A;  4EE0 A;  4Q5R A;  4RQR A;  1GUM A;  2C6B A;  1T8E B;  3IAS 2;  2YZU A;  2JU5 A;  4GSN A;  5ID2 B;  3PGT A;  2WUL A;  4FO5 A;  2YJH A;  4J57 E;  3HYP A;  2H30 A;  1QMV A;  5KEJ A;  4NWY A;  5ENU A;  5JWR B;  2DIZ A;  4PNG A;  1DE1 A;  1Z7R A;  2F3M A;  5HR3 A;  5DCG A;  4HI7 A;  3PH9 A;  1N2A A;  3M8N A;  1YF1 A;  3LWA A;  2HLS A;  1T7P B;  2YWM A;  3M1G A;  1PX7 A;  2QGV A;  4TW5 A;  4V2N A;  3BD2 A;  1DSB A;  5DCH A;  4POL A;  4LL1 B;  3HZ8 A;  4HZ2 A;  2NTO A;  4DSR A;  5G5E A;  4IEL A;  5IQY A;  1FVK A;  5GZZ B;  1TU7 A;  2VM2 A;  3D0Z A;  16GS A;  1SU9 A;  5HFI A;  1SL1 B;  4AF2 A;  1OC8 A;  2VL2 A;  5AIV A;  2WRT A;  1G6Y A;  1T1V A;  2TIR A;  5J3R A;  5IO2 A;  2YN1 A;  3GA4 A;  2HE3 A;  4JBB A;  2GT5 A;  4OCF A;  5J5N A;  1Z5Y E;  5DDL A;  4AJ6 A;  5D73 A;  3MNG A;  3HCZ A;  2H1G A;  1HNC A;  4I97 A;  2LRN A;  1AQX A;  3VPT A;  2DJ2 A;  2RM6 A;  3D22 A;  2ZCT A;  3MWH A;  2N5B A;  5J4U A;  4NAX A;  2CVD A;  3J7Y b;  1Q98 A;  1YDK A;  2VLU A;  3RDW A;  4ECI A;  3IK7 A;  4KSO A;  4ZBB A;  4OFT A;  1O85 A;  5CP1 A;  2R4V A;  1JZR A;  1WPI A;  3MAK A;  4TN8 A;  2K8V A;  3H79 A;  1GSU A;  5INY A;  4MPG A;  3NIV A;  2B3S A;  2X8C A;  3ZYW A;  4N0Z A;  2OAD A;  1SL2 B;  3AY8 A;  5EVO A;  2PGT A;  1SYX A;  2LEG A;  1X5C A;  5ECS A;  2WS2 A;  1K0C A;  3D4M A;  2AJQ B;  5LNK e;  3FZA A;  4K1F A;  5CYY A;  3HKR A;  2J9H A;  1M99 A;  2JL4 A;  1BAY A;  4KB3 A;  1TKD B;  4KGI A;  3APS A;  5DAL A;  3KEB A;  1LBK A;  3US3 A;  1EV4 A;  3KZQ A;  1A0F A;  1A2L A;  1MD3 A;  3P90 A;  1AAZ A;  2FD3 A;  1JZW A;  4V2M A;  1ERU A;  2L57 A;  3D4T A;  1F6M C;  1M0U A;  3PIN A;  2H66 A;  4MJC A;  4Q5F A;  3ISO A;  2HZE A;  1FB6 A;  3GN3 A;  1U3I A;  5GSS A;  1XWA A;  4MPF A;  1LJR A;  2H73 A;  3DWV A;  1T4Y A;  2FUG 2;  2KHP A;  3DRN A;  2MBS A;  1WE0 A;  1GUK A;  4LMW A;  2R37 A;  5JCU A;  2VLV A;  1OVN A;  4MJA A;  5ELG A;  3ZIJ A;  1SJI A;  3TJK A;  3KH9 A;  1I5G A;  2GTU A;  2VD1 A;  1ZZY A;  1GLP A;  1GP1 A;  5ECH B;  1ABA A;  1N8J A;  3IXR A;  4IP1 A;  4K7N A;  3BOA A;  4NXI A;  1T00 A;  4Q5N A;  4IHU A;  4MDC A;  2FGX A;  1Z7P A;  1UVZ A;  3GUR A;  3GKM A;  5A4V A;  5J9B A;  3DVX A;  1SKR B;  5IIZ A;  1SD8 A;  1GWC A;  4OO5 A;  1G7E A;  4OCE A;  4RI6 A;  1ST9 A;  4MP4 A;  1HNA A;  2QKE A;  2VCW A;  1X0R A;  3JCM L;  5KN3 A;  2IMD A;  4K6X A;  2H1A A;  1TP9 A;  2DBC A;  2B5E A;  3CBU A;  1R5P A;  2J23 A;  4HU9 A;  2I1U A;  2DLX A;  3GTU B;  4F0B A;  4PUA A;  1GSE A;  2VOC A;  3UMA A;  1YY7 A;  2H76 A;  3UJ1 A;  1NM3 A;  3KMN A;  1M9A A;  4P3Y B;  1XOB A;  3ZVJ D;  4IS0 A;  2L4C A;  2PUK C;  3UBK A;  4TXO A;  4BL7 A;  2B1K A;  4FIW A;  2GT6 A;  1QK8 A;  2QSI A;  3UVT A;  4WR4 A;  3EE2 A;  5B8A A;  9GSS A;  1QFN A;  1VRS D;  1THX A;  1W4V A;  3ZML A;  1YEX A;  3A2V A;  1XWB A;  1AIU A;  5CRD A;  4K8M A;  2AB6 A;  1PRX A;  1A2M A;  2HFD A;  2HNL A;  18GS A;  4G19 A;  5KN1 A;  1MD4 A;  1QQ2 A;  5D96 A;  3E0U A;  2EC4 A;  2LRC A;  2ON5 A;  4NHW A;  1R7H A;  1R5A A;  3B08 B;  5GAN D;  5HFK A;  3QFA C;  4HU7 A;  4ZL8 A;  2CA8 A;  4WF5 A;  2OBK A;  1XZO A;  2KLX A;  3EC3 A;  3KXO A;  3TKS A;  1K3O A;  1NHO A;  3HHV A;  1M2D A;  3G7J A;  2XC2 A;  4GLT A;  4GST A;  4YQM A;  4POM A;  5ECL B;  5A5K A;  3ZIV A;  1V57 A;  3QPM A;  4IW9 A;  3QAW A;  4EF0 A;  2H1D A;  2KOK A;  5ELA A;  1KBN A;  5FHI A;  3IR4 A;  6GSX A;  3QD9 A;  3C71 A;  4CDO A;  1PKZ A;  1K0B A;  1X9M B;  1GH2 A;  1B9X C;  3CSJ A;  2TRX A;  1VGL A;  14GS A;  4L0U A;  2YAN A;  5JWQ B;  5IO0 A;  3CSI A;  2GST A;  4XS4 B;  4TR3 A;  1EOG A;  1PGT A;  2GQK A;  2AHE A;  1KEB A;  1E2Y A;  5JCG A;  1PA3 A;  3EVI A;  2FCH A;  2HZF A;  1PX6 A;  1HNB A;  3VUR A;  3EU4 A;  2R5G A;  2AAW A;  1FVJ A;  1SK1 A;  2H19 A;  2L6D A;  5DQS A;  5HR0 A;  2C3N A;  4O7H A;  1RW1 A;  1XCC A;  4WXT A;  4HJ2 A;  4OO4 A;  2CT6 A;  3L78 A;  4J2F A;  1T4Z A;  3F9U A;  2WJU A;  4AJ7 A;  3VWW A;  1DBY A;  3IAM 2;  3SBC A;  3M0F A;  2O7K A;  3EYT A;  3O76 A;  2H71 A;  1S3A A;  3ZRE A;  1PD2 1;  3EMX A;  5ID2 A;  1EWX A;  4GRF A;  2IJY A;  3MSZ A;  2ON7 A;  3GH9 A;  3CMI A;  4HS1 A;  4WF4 A;  2H72 A;  1UA5 A;  1R26 A;  1URM A;  1KNG A;  1V58 A;  3A2X A;  1FHE A;  1C72 A;  1Z6N A;  1K0D A;  3DKS A;  4KDU A;  2B5Y A;  2K8S A;  1MDJ A;  2OE3 A;  2MMO A;  4OFM A;  3WGE A;  3QDN A;  4KUN A;  1ML6 A;  1AC1 A;  2YWO A;  3HVS A;  4FH8 A;  3GL3 A;  2A2S A;  1Z3E A;  1AUC A;  3F63 A;  3H8Q A;  3GKK A;  3GX8 A;  4LA1 A;  5IMC A;  4HEA 2;  2LKU A;  4E8H A;  3MDK A;  4MH3 A;  1XIY A;  1BQ7 A;  1SJ6 A;  3ZIT A;  1M9B A;  4EO3 A;  5AGY A;  5ECN B;  4TOP A;  1F3A A;  2G2Q A;  2YOI A;  1B8X A;  1T3B A;  2H6X A;  3FYG A;  2CZ3 A;  4NMU A;  2YWN A;  3HJM A;  5HQP A;  3G7I A;  2GVP A;  4Q5Q A;  2M80 A;  1TK8 B;  2LV3 A;  5G31 A;  3EWL A;  1UC7 A;  2OAC A;  1BX9 A;  3F6D A;  2CAI A;  3GMF A;  5AIX A;  2LNS A;  5IMZ A;  5ECP B;  5F06 A;  2LNT A;  5LCZ A;  4IQ1 A;  1K0O A;  3IA1 A;  1NSW A;  3CSH A;  2PER A;  1GSY A;  2P31 A;  3APQ A;  1K0N A;  1F3B A;  3FEU A;  4XTS A;  3H93 A;  3KD0 A;  2CX3 A;  2VIM A;  2C0E A;  4NPB A;  1BJX A;  3TRP A;  3GIX A;  1TI3 A;  2REM A;  2RM5 A;  4LL4 B;  1BED A;  1NHY A;  5A4U A;  1J9B A;  2R2J A;  4L5O A;  2BMX A;  3LQ7 A;  2LQO A;  2HRF A;  1X9W B;  3VWV A;  1FO5 A;  3FZ5 A;  2VUP A;  4PXO A;  1EEJ A; 
#chains in the Genus database with same CATH topology
 4JED A;  3TRQ A;  2V0E A;  3HOU L;  3RYG A;  5GAE c;  3P8W A;  10GS A;  3F4T A;  2GQM A;  1MDK A;  3VI7 A;  2H6Y A;  1OWB A;  3TKP A;  4D73 B;  5IPG A;  2QC7 A;  5G5F A;  3L4N A;  3C73 A;  2GS3 A;  4ZL7 A;  3M9K A;  2EIR A;  3HOX L;  2XPD A;  5ECM B;  1YJ6 A;  4V2L A;  1S3D A;  3PZA A;  2VM1 A;  3ERW A;  4ILF A;  4A3E L;  2GSS A;  2L5L A;  3GTK L;  4TR4 A;  1PFY A;  3GNJ A;  2R6K A;  1MTC A;  2IFQ B;  1EEM A;  1OKD A;  3VWX A;  5CRE A;  4HDE A;  1XW9 A;  3HJW B;  1JZO A;  2VL3 A;  5D8I A;  3S2H L;  1CQG A;  4C3I L;  4HOJ A;  2NBS A;  3L0H A;  4K5R A;  2L4Q A;  5DAK A;  1GL8 A;  4BBR L;  3CYN A;  4JAE A;  1AXD A;  2B1L A;  1ZYQ B;  1BQ9 A;  3P8B A;  4XXB B;  4I8B A;  1XW6 A;  4XS6 A;  2JA7 L;  5IY0 A;  1BYE A;  4Y52 L;  1THO A;  2X64 A;  4HQS A;  2C0G A;  2LS5 A;  1K0M A;  2XJQ A;  4LMV A;  5HFG A;  2V6K A;  2JSY A;  3DVW A;  2UZ8 A;  1PFW A;  1XPV A;  5CRG A;  3TKS E;  8GSS A;  1OKT A;  3IBH A;  3N9J A;  1FHM A;  1F9M A;  2G0F A;  4KW6 A;  1GSS A;  4MF6 A;  3PIO 1;  4O92 A;  4V1A g;  4PGT A;  1YUX A;  2VLT A;  4TR0 A;  3TDG A;  5EIN C;  1B4P A;  2MZC A;  2ZIX A;  4E8E A;  3LXT A;  3HDC A;  1SKW B;  4B8C D;  5BMU A;  1TRS A;  4MJB A;  1AW9 A;  1EZK A;  1SD9 A;  1O8W A;  4ECC A;  3GSS A;  4GQF A;  1BE7 A;  2DJK A;  2YNX A;  4BVY A;  1SYR A;  1XXU A;  2GSQ A;  3DEX A;  2M4V A;  2X99 A;  2XJT A;  1H7V A;  3S9F A;  2YV7 A;  4EC0 A;  1YK4 A;  1WIK A;  2ZNM A;  2B6M A;  3GHA A;  5CRH A;  5CNW A;  3QFB C;  1PFU A;  1A8Y A;  4Z7X A;  3ZRD A;  3KMO A;  3Q74 A;  3QQC E;  2MMZ A;  2WCI A;  4ZXG A;  2JAC A;  1NW2 A;  3HY2 A;  3TB2 A;  1T9O A;  1XWG A;  2C4J A;  4NV2 A;  1FAA A;  2H70 A;  1ZOF A;  1UN2 A;  4POB A;  2CX4 A;  2P5R A;  1Y6E A;  1OAZ A;  2A6H D;  3IPZ A;  4I6X A;  4AI2 A;  4PUR A;  4YH2 A;  4HQZ A;  5B6M A;  3DIE A;  4EXJ A;  2V0F A;  3APO A;  4O5Q A;  4BWS A;  4ISD A;  4EDY A;  1PL1 A;  2CR8 A;  3ZVJ A;  5DJL A;  5C00 A;  3G7Y A;  5IMF A;  5C3E L;  1ILO A;  3LWP B;  2ALB A;  4POF A;  2GDR A;  4OFN A;  4AHX A;  2H01 A;  2PU9 C;  4ID0 A;  1OYJ A;  1R0G A;  2LST A;  3K7A L;  3M3M A;  2IMF A;  2AUV A;  1E8J A;  3EUR A;  5AN1 A;  5F05 A;  2PVE A;  1LKP A;  4X6A L;  4IJI A;  1OWC A;  1S2Z A;  3CRU A;  4BXX L;  1F37 A;  1XVW A;  1ZRP A;  3GUS A;  3PKI A;  5GST A;  3BBY A;  2A68 D;  1U87 A;  1Z9H A;  1T9P A;  2I81 A;  2B5I D;  5ECK B;  4HJM A;  4KCA A;  2GGT A;  2WDU A;  2LJA A;  1RB9 A;  4MZW A;  3EPT A;  2HXK A;  5IPH A;  3HJP A;  3DML A;  2B5X A;  1KTE A;  4G0K A;  4IGJ A;  1JZD A;  2WFC A;  3H9C A;  2APO B;  2CKC A;  2DJJ A;  4WKW A;  1M2A A;  2DKI A;  4JE1 A;  4AI0 A;  3VK9 A;  5ECR B;  3O6T A;  5J41 A;  3HD5 A;  5IYD L;  3TJF A;  3A44 A;  3ME8 A;  3WD6 A;  3CTG A;  2O8V B;  4WBR D;  1OC9 A;  4QQ7 A;  1M3I A;  4X1U A;  3RAZ A;  5CO3 A;  4A5P A;  5GAG c;  3FKF A;  4YAP A;  5M3F L;  3IK9 A;  3LGC A;  2XJV A;  1TRV A;  4EL1 A;  3NZN A;  4ZIL A;  1ERT A;  2F8F A;  2IIY A;  1SKS B;  1WCM L;  1LU4 A;  4RQX A;  3F6F A;  4AHZ A;  1U3A A;  3VFI A;  4F03 A;  2F51 A;  3S1M L;  5MFZ A;  4BY1 L;  1PKW A;  4H86 A;  4DSS B;  3LPE B;  1V98 A;  4XS4 A;  2R7Z L;  3FK8 A;  3MQK B;  3WYW A;  1S3R A;  2HYX A;  4TXV A;  4IN0 A;  5F0G A;  4ACS A;  3M4O L;  3P7X A;  3V1W A;  1MEK A;  2K18 A;  2H75 A;  4V1A p;  2FWG A;  4DSQ A;  4CHS A;  5MLC 3;  2DC5 A;  1ZGN A;  2NPB A;  3CRT A;  4GSS A;  3S1Q L;  3GKN A;  4WBJ A;  3UBL A;  2E2J L;  1AQV A;  3GX0 A;  1EOH A;  3FKI L;  1A8L A;  3FR3 A;  5D9T A;  2R0P A;  5G1K A;  5FT3 A;  2P5Q A;  3KCM A;  3QAG A;  5IMD A;  3I9V 2;  1TW9 A;  4CY8 A;  3UOM A;  4DVC A;  5D9V A;  6RXN A;  2HSH A;  4QL7 A;  4F0C A;  4A3F L;  4ZBD A;  2WB9 A;  1SK0 A;  1AQW A;  1CQH A;  2C8U A;  2VCV A;  3TOU A;  1B71 A;  3ED3 A;  1TK0 B;  4ULX A;  3ZG6 A;  3ERG A;  2KP2 A;  3LW9 A;  3D6I A;  4ML6 A;  1TWA L;  2XJS A;  1OC3 A;  2XJR A;  3LJR A;  4KSM A;  1J08 A;  4OD7 A;  4TR1 B;  1GLQ A;  2NDO A;  4YWL A;  1U88 A;  4TXO B;  1TJD A;  3IHQ A;  1YKC A;  3A3T A;  1F2E A;  2XBI A;  5C44 L;  1SK2 A;  2PMZ P;  2IPA A;  4AHY A;  3TJG A;  3GH6 A;  4KE3 A;  5M5W L;  2WZ9 A;  2OKA A;  1HQO A;  2PVO C;  4KDX A;  4YQV A;  3C8E A;  2JZT A;  11GS A;  3W8S A;  4JRR A;  4QL9 A;  6GSS A;  2V41 A;  2E0Q A;  3J7Y k;  1FOH A;  6GSY A;  2E2I L;  1GTA A;  3K35 A;  1IYI A;  3KGK A;  2E2M A;  4GCI A;  4ZB9 A;  2V6O A;  3PL5 A;  2DIY A;  3RPN A;  3LSZ A;  2MS3 A;  2X8G A;  4ZN3 B;  4ME3 A;  1E6B A;  2C6A A;  1XWC A;  1W89 A;  1H75 A;  1OE7 A;  2V32 A;  3ME7 A;  4WEY A;  5C4X L;  2C0D A;  2P0G A;  4BVX B;  2ZUP A;  2JI2 A;  4J56 E;  4KH7 A;  2FHE A;  3C1S A;  1RK4 A;  2YP6 A;  5EY6 A;  5G1L A;  1TDI A;  2H6Z A;  1PQN A;  2VL9 A;  2RUF A;  2OE1 A;  1TRW A;  2F9S A;  4LHN A;  5IOX A;  5CRW A;  1FG4 A;  1EP7 A;  1WJK A;  3HJO A;  3ZLP A;  3H1N A;  2FWH A;  6GSW A;  1QGV A;  4XGH A;  5DQY A;  4KND A;  1JLV A;  2IN3 A;  3FRC A;  5FWG A;  5DM6 1;  3ZTL A;  2BTO T;  3TUE A;  4F82 A;  1TU8 A;  1B2O A;  2O89 A;  2VL2 C;  3KTB A;  1GTB A;  2CKA A;  1FB0 A;  1OE8 A;  4ZBA A;  5D9X A;  2JA6 L;  5AIS A;  2LRT A;  4FYU A;  3B0A B;  1EV9 A;  1T9Q A;  2YZH A;  4K7O A;  2AYT A;  4K0N A;  4FYB A;  1G7O A;  5LD0 A;  3GRX A;  3CXG A;  3GTG L;  3PPU A;  3FZ4 A;  3FHK A;  3IDV A;  3UAP A;  4ZL9 A;  3I6A A;  4RUV A;  2V1M A;  5G2Z A;  3EMP A;  4D73 A;  2PMT A;  4IJ3 A;  5COH A;  5C04 A;  3UIW A;  5KN2 A;  4PNF A;  3GTP L;  1ZMA A;  3F4S A;  3GTL L;  4GWR A;  3M9J A;  5AI2 A;  4TPU A;  1SMW A;  6GSU A;  3KIJ A;  2AUS B;  2C3T A;  3GKX A;  3KJY A;  5DJM A;  3LYK A;  3LOR A;  17GS A;  2LCQ A;  4EIP A;  4EUY A;  13GS A;  2L0Z A;  2H74 A;  2DSX A;  4I2U A;  1TWG L;  2IMK A;  2M72 A;  3QMX A;  1B9Y C;  3IE3 A;  4MF7 A;  4KCE A;  4AHW A;  1DX8 A;  1MDI A;  5IP7 L;  3GTJ L;  5DVB A;  1JLW A;  1U6T A;  4O5R A;  3VPQ A;  1RDV A;  2OA7 A;  4AYB P;  2CV4 A;  4I5Q A;  1F4L A;  4KDY A;  3GV1 A;  2MBT A;  4EIQ A;  3G9B A;  2HSY A;  3RZT A;  5H5R A;  2AV4 A;  1X5E A;  2JSZ A;  2A6E D;  1ZCP A;  3P2A A;  1TI1 A;  5BRT A;  4BA7 A;  2IMI A;  3H4K A;  5KOX A;  1O7U A;  3RBT A;  1O73 A;  4YAV A;  1XG8 A;  1SEN A;  2N5A A;  5IMA A;  1NXG A;  2QA1 A;  2BJX A;  1FW1 A;  1ZYE A;  4GF0 A;  3EIN A;  1XWK A;  3E9J B;  2V2G A;  19GS A;  4A3B L;  1B2J A;  12GS A;  1GSQ A;  1PL2 A;  2IME A;  5EIO C;  2VUM L;  2GZP A;  4N11 A;  3U5R E;  2PWJ A;  3VPB E;  2FWE A;  3KYU A;  2HR5 A;  5CAX A;  5H5S A;  3GFK A;  3TKQ A;  3L9U A;  1XW5 A;  4JU5 A;  3FR9 A;  3ZFB A;  3WGX A;  3E3E A;  4ZN1 B;  1PSQ A;  2LQQ A;  3ERF A;  1C09 A;  7RXN A;  2CVK A;  5J9C A;  2GZY A;  2YJ7 A;  3CQZ L;  4MAB A;  1ERW A;  1RDG A;  1JFU A;  4AR4 A;  4XHM A;  2A69 D;  2OBI A;  4MK3 A;  1TK5 B;  4K5S A;  2B7J A;  5MFP A;  4OWY A;  2KUC A;  2JZS A;  3LEF A;  4POK A;  1Q4J A;  5JVG 1;  3GL5 A;  2KKD A;  4F9Z A;  1FOV A;  2KP1 A;  5EL8 A;  4O32 A;  5HR1 A;  4C3J L;  3HZ4 A;  1V9W A;  3A2W A;  5M5X L;  2XHF A;  1WRY A;  4AGS A;  1EGO A;  1YEP A;  1TOF A;  1EP8 A;  1YF0 A;  5B6N A;  4IVF A;  1PFV A;  1VZI A;  3QCP A;  2JZR A;  4NHZ A;  3GST A;  4K7I A;  2E7P A;  2HT9 A;  3EU3 A;  4TVE A;  4YKF A;  1SL0 B;  3LWO B;  2CZ2 A;  2HI7 A;  2I4A A;  1SFO L;  3O3T A;  4PX1 A;  3HVN A;  5ECQ B;  3F4R A;  1IYH A;  2YV9 A;  5E59 A;  4BWQ A;  2BE5 D;  1WP0 A;  2CVB A;  4ZIJ A;  3UEM A;  2L59 A;  2GMG A;  3F0I A;  3LFL A;  4Z2U A;  3WT1 A;  5ECI B;  5ECO B;  5D93 A;  2GQL A;  1LKO A;  1V2A A;  3A5W A;  3GTU A;  1TTZ A;  2FWF A;  2RII A;  3FZ9 A;  4K9Z A;  5H5Q A;  3KH7 A;  2OE0 A;  3TOT A;  5E4W A;  4XRA A;  3PR8 A;  1GTI A;  1PMT A;  1I9D A;  4ECJ A;  3H3V M;  2H8L A;  4USS A;  3Q6O A;  3RPP A;  5B7C A;  3W8J A;  1GRX A;  1DVB A;  1G0T A;  1DE2 A;  4AR6 A;  4JAG A;  3HOV L;  3HAX C;  1RWD A;  2LTK A;  2KN9 A;  2JAD A;  2PVQ A;  1GUL A;  2JI1 A;  2X4A A;  3R2Q A;  3GTO L;  1M7T A;  1QUW A;  6GSV A;  3IC8 A;  4RI7 A;  3F3R A;  4MJE A;  5GAP D;  3UVH A;  4N30 A;  1ZL9 A;  2K9F A;  2HRK A;  2FY6 A;  2YPM A;  5DAK B;  4KX4 A;  2DMM A;  2NVT L;  4AI3 A;  1ZYN A;  4MA9 A;  3K8N A;  5L71 A;  3HKZ P;  4KAE A;  2TRC P;  1YKA A;  5IMV A;  1YZX A;  2B7K A;  2VCZ A;  4O5U A;  4DSS A;  4MZC A;  3QOU A;  4L8E A;  2WGR A;  4MZB A;  4ZB8 A;  1PN9 A;  1GSD A;  2XPE A;  5JCW A;  3GYK A;  2FNO A;  1TWC L;  4AR3 A;  2Z9S A;  1TRU A;  2FLS A;  1BRF A;  3TKS C;  2DJ0 A;  5A4W A;  2PPT A;  4XCS A;  5DAL B;  1GSF A;  4TKY A;  1VF1 A;  2DML A;  2VO4 A;  1B13 A;  3VI5 A;  1USB A;  4K2D A;  3BCI A;  4N10 A;  4PUF C;  5F8B A;  5GAD c;  4IP6 A;  1YV1 A;  1NXE A;  4C2M 1;  4K9F A;  3DYR A;  3S14 L;  2GZZ A;  2MMN A;  1GNW A;  4EKZ A;  2FA4 A;  3HVX A;  4TVM A;  3RHC A;  4JZQ A;  1R4W A;  2HZE B;  1EGR A;  3KYY A;  3D21 A;  4TRX A;  4K0G A;  4K2X A;  4IKH A;  3SWL A;  4AJ8 A;  1K3Y A;  2IL3 A;  3LYP A;  4OMV A;  3KYW A;  3FDJ A;  3F3Q A;  3QAV A;  2E2G A;  1A24 A;  3W6G A;  1Y25 A;  3HOW L;  4TR1 A;  1CAA A;  4XIH A;  2CAQ A;  3L9V A;  2GSR A;  2MYG A;  3DGQ A;  20GS A;  1I6H L;  2PN8 A;  2Z3R B;  2EIO A;  2H0H A;  3Q19 A;  3IU3 I;  2RFK B;  4X4J A;  4CW9 A;  4A93 L;  3KTL A;  3TCO A;  4HZ4 A;  3H9B A;  1GTU A;  2R93 L;  3C1R A;  4G10 A;  3WT2 A;  3MPS A;  3IC4 A;  2R3X A;  1VF4 A;  4L0W A;  4MF5 A;  5JWO B;  3ZL5 A;  3IOS A;  3TRX A;  7GSS A;  5KN0 A;  2F8A A;  1QCV A;  2Z3Q B;  5G30 A;  3N5O A;  3LWQ B;  4EDZ A;  4Z2T A;  1XVQ A;  2LJR A;  1WWJ A;  2R0G A;  1A2J A;  2X8H A;  2HVY C;  1O6J A;  1HYU A;  4FYC A;  3ZFL A;  4ZB6 A;  2WB1 P;  1M2B A;  3DXB A;  4U67 1;  4G0L A;  3CTF A;  2VCQ A;  3UL3 A;  3MIX A;  2H1B A;  3DD3 A;  5IYC L;  4BVX A;  2YWI A;  2N5F A;  2VAF A;  2XBQ A;  1K0A A;  3KP9 A;  3HXS A;  3VWU A;  2A2P A;  4L5L A;  2VL6 A;  2QA2 A;  1JHB A;  3HVV A;  4MCU A;  2L6C A;  2H0G A;  2I9H A;  2YCD A;  2PYA A;  3A5I A;  4PQH A;  4AI1 A;  3LNL A;  4IQA A;  2IWT A;  2A4V A;  4E6Y A;  1K3L A;  22GS A;  2A2R A;  1WJV A;  2RUE A;  5DBQ A;  4BL7 B;  4KF9 A;  2M46 A;  1G6W A;  4GQC A;  2FA8 A;  1OC9 B;  1QXH A;  3IRA A;  5JVH 1;  1A23 A;  2O87 A;  1WMJ A;  1O81 A;  4X43 A;  4MLY A;  3I43 A;  2C80 A;  1RQM A;  1R0F A;  2PBJ A;  3QR6 A;  4ECB A;  1TWF L;  2OJL A;  3BCK A;  4NV5 A;  5HR2 A;  2I3Y A;  5IYB L;  1VZG A;  3TJJ A;  2ERJ A;  2VD0 A;  1XOA A;  5RXN A;  1J0F A;  1TWH L;  2HRN A;  4JR4 A;  2RLI A;  4PQI A;  2ES7 A;  4X0X A;  4WET A;  1ODH A;  2LUS A;  3NOF A;  1IU6 A;  4XS1 A;  2K6V A;  3LXZ A;  4KA0 A;  6GST A;  2R92 L;  3ZZX A;  3TKR A;  4A3C L;  2VCX A;  1A0R P;  1X5D A;  1SJZ A;  3LG6 A;  4N0V A;  2VCT A;  3IV4 A;  1X9S B;  4G2E A;  2J9U B;  2GLR A;  4IBP A;  3MSU A;  5IOW A;  3FY7 A;  5ABR A;  4JR6 A;  1VF2 A;  4XRD A;  5F07 A;  4JAD A;  1TXX A;  4EVM A;  2C1Y A;  4GXZ A;  2DJ3 A;  1B4Q A;  3ZMK A;  3RHB A;  2C0F A;  3C7M A;  1H4O A;  3TGZ A;  1XFL A;  1RYT A;  2CQ9 A;  2H0I A;  4UY8 1;  2MMA A;  4I2T A;  1HD2 A;  4YQU A;  1ACV A;  3KP8 A;  3UAR A;  5EPF A;  4MH2 A;  1R9T L;  3WGD A;  1B48 A;  1ON4 A;  3U6V A;  2L5O A;  1O8X A;  3I69 A;  4MMM A;  4BPY A;  2D2Z A;  1S3C A;  4A3L L;  1BG5 A;  1Z6M A;  3KM6 A;  4F2I A;  4WR5 A;  2O5J D;  5KOW A;  5D9W A;  3H99 A;  3L9S A;  4DEJ A;  2EIQ A;  3Q18 A;  4G9H A;  4LLR A;  3BJ5 A;  3FW2 A;  2DJ1 A;  1PZX A;  4GTU A;  2DSA A;  5B8B A;  1WOU A;  1DUG A;  5C4J L;  2HRA A;  1YQ1 A;  2C3Q A;  1SMU A;  3D5J A;  2O85 A;  5IM9 A;  2NVL A;  1VF3 A;  2LJK A;  3TJB A;  3HA9 A;  1GUH A;  3CQF A;  2ERS A;  4PQ1 A;  3F8U A;  2IFQ A;  3OR5 A;  1ERV A;  1V40 A;  4ML1 A;  3FR6 A;  1XBS A;  1GNE A;  4HUA A;  3VLN A;  4EE0 A;  4Q5R A;  4RQR A;  1GUM A;  2C6B A;  1I50 L;  4G0I A;  1T8E B;  3IAS 2;  2YZU A;  2JU5 A;  1S30 A;  4GSN A;  2Y0S P;  5ID2 B;  1VCX A;  3PGT A;  2WUL A;  4FO5 A;  2YJH A;  4J57 E;  3HYP A;  8RXN A;  2H30 A;  1QMV A;  5KEJ A;  4NWY A;  5ENU A;  2WAQ P;  4LHL A;  5JWR B;  2DIZ A;  4PNG A;  1DE1 A;  2YU9 L;  1Z7R A;  2F3M A;  5HR3 A;  5DCG A;  4HI7 A;  3PH9 A;  1N2A A;  3M3Y L;  3M8N A;  1YF1 A;  3LWA A;  4C3H L;  2HLS A;  1T7P B;  2YWM A;  3M1G A;  3KYX A;  1PX7 A;  2QGV A;  4TW5 A;  4V2N A;  3BD2 A;  2NVX L;  1DSB A;  5DCH A;  4POL A;  4LL1 B;  3HZ8 A;  4HZ2 A;  2NTO A;  4DSR A;  5G5E A;  4IEL A;  5IQY A;  1FVK A;  5GZZ B;  1TU7 A;  2VM2 A;  2H12 A;  3D0Z A;  16GS A;  1SU9 A;  5HFI A;  1SL1 B;  3PIP 1;  4AF2 A;  1OC8 A;  2VL2 A;  5AIV A;  2WRT A;  1G6Y A;  1T1V A;  4BBS L;  2TIR A;  1Z92 B;  5J3R A;  5IO2 A;  2YN1 A;  3HOY L;  3GA4 A;  2HE3 A;  4JBB A;  2GT5 A;  4ICY A;  4OCF A;  5J5N A;  1Z5Y E;  2AYJ A;  5DDL A;  4AJ6 A;  3IHG A;  1CAD A;  1LKM A;  5D73 A;  3MNG A;  5H1S c;  3HCZ A;  2H1G A;  4G6B A;  1HNC A;  4I97 A;  2LRN A;  2QL0 A;  1AQX A;  3VPT A;  2DJ2 A;  1IRO A;  2RM6 A;  5DM7 1;  3D22 A;  2ZCT A;  3MWH A;  3HJY B;  2N5B A;  2M6O A;  5J4U A;  4NAX A;  2V3B B;  2CVD A;  4RXN A;  3J7Y b;  1Q98 A;  1YDK A;  2VLU A;  3RDW A;  4ECI A;  3IK7 A;  4KSO A;  4ZBB A;  4WFN 1;  3WWL A;  4OFT A;  1O85 A;  5CP1 A;  2R4V A;  1JZR A;  4A3G L;  1WPI A;  3MAK A;  4TN8 A;  2K8V A;  3H79 A;  2XJU A;  1GSU A;  5INY A;  1QQT A;  4MPG A;  3NIV A;  2B3S A;  2X8C A;  2JA5 L;  3ZYW A;  4N0Z A;  2OAD A;  1SL2 B;  3AY8 A;  5EVO A;  4PTS A;  5MGN A;  2PGT A;  5GAH c;  1SYX A;  4V19 6;  2LEG A;  1X5C A;  5ECS A;  2WS2 A;  5K2M E;  1K0C A;  3D4M A;  2AJQ B;  5LNK e;  3FZA A;  4K1F A;  5CYY A;  4A3K L;  3HOZ L;  3HKR A;  2J9H A;  3MYD A;  1M99 A;  2JL4 A;  1BAY A;  4KB3 A;  1TKD B;  4KGI A;  3APS A;  5DAL A;  3KEB A;  1LBK A;  3J7Y 1;  3US3 A;  1EV4 A;  3KZQ A;  1A0F A;  1A2L A;  1MD3 A;  3P90 A;  1AAZ A;  2FD3 A;  1JZW A;  4V2M A;  1ERU A;  2L57 A;  3D4T A;  1NNQ A;  3GTQ L;  1F6M C;  1M0U A;  3PIN A;  2H66 A;  4MJC A;  4Q5F A;  3ISO A;  2HZE A;  1FB6 A;  2A4H A;  3GN3 A;  1U3I A;  5GSS A;  1R0H A;  1XWA A;  4MPF A;  1LJR A;  2H73 A;  3DWV A;  2AQC A;  5FJ8 L;  1QYB A;  1T4Y A;  1YK5 A;  2FUG 2;  2KHP A;  3DRN A;  2MBS A;  1WE0 A;  1GUK A;  4LMW A;  1ZYP A;  2R37 A;  5JCU A;  4POG A;  2VLV A;  1YUZ A;  1OVN A;  4MJA A;  5ELG A;  4FQU A;  3ZIJ A;  1SJI A;  3TJK A;  3KH9 A;  1I5G A;  2GTU A;  3RZO L;  2VD1 A;  1ZZY A;  1GLP A;  1GP1 A;  5ECH B;  1ABA A;  1N8J A;  1I3Q L;  3IXR A;  4IP1 A;  4K7N A;  3BOA A;  1S24 A;  4NXI A;  1T00 A;  1R0J A;  4A3D L;  4Q5N A;  4IHU A;  4MDC A;  2FGX A;  2PSM C;  5MF6 A;  3H97 A;  1Z7P A;  1UVZ A;  3GUR A;  3GKM A;  5A4V A;  5J9B A;  3DVX A;  1SKR B;  5IIZ A;  1SD8 A;  1GWC A;  1IRN A;  4OO5 A;  1G7E A;  4OCE A;  4RI6 A;  1ST9 A;  2PVX A;  4BVY B;  4MP4 A;  1HNA A;  2NVY L;  2NYD A;  2QKE A;  2VCW A;  1X0R A;  3JCM L;  5KN3 A;  2IMD A;  4K6X A;  2H1A A;  1TP9 A;  2DBC A;  2B5E A;  3CBU A;  4BIK A;  1R5P A;  4MNN A;  2J23 A;  3WWN B;  4HU9 A;  2EY4 E;  2I1U A;  2DLX A;  3GTU B;  4F0B A;  2XJP A;  4PUA A;  1GSE A;  2VOC A;  5AN9 H;  3UMA A;  1YY7 A;  3S15 L;  2JA8 L;  2H76 A;  3UJ1 A;  3RZ6 A;  1NM3 A;  3KMN A;  1M9A A;  3PWF A;  3LWV B;  1XOB A;  4P3Y B;  3ZVJ D;  4IS0 A;  2L4C A;  2PUK C;  3UBK A;  4TXO A;  4BL7 A;  2B1K A;  4A3J L;  4FIW A;  2GT6 A;  1PFO A;  2E2H L;  1QK8 A;  2QSI A;  3UVT A;  4WR4 A;  3EE2 A;  5B8A A;  9GSS A;  1QFN A;  1VRS D;  1THX A;  1W4V A;  3ZML A;  1YEX A;  3A2V A;  1XWB A;  4CY6 A;  1AIU A;  5CRD A;  4K8M A;  2AB6 A;  1PRX A;  1A2M A;  2HFD A;  2HNL A;  18GS A;  3S1N L;  3FMW A;  4G19 A;  5KN1 A;  3PKJ A;  1MD4 A;  1QQ2 A;  5D96 A;  3E0U A;  2EC4 A;  5AI3 A;  3PO3 L;  5M3M L;  1PN0 A;  2LRC A;  2ON5 A;  4NHW A;  1R7H A;  1R5A A;  3B08 B;  5FLM L;  5GAN D;  4BY7 L;  3QFA C;  5HFK A;  4HU7 A;  4ZL8 A;  2CA8 A;  4WF5 A;  2OBK A;  1XZO A;  2KLX A;  4A3M L;  3EC3 A;  1IU5 A;  2M4Y A;  3KXO A;  3JR7 A;  3KYV A;  3TKS A;  1K3O A;  1NHO A;  1Y1W L;  3HHV A;  1M2D A;  3G7J A;  2XC2 A;  4GLT A;  4GST A;  4YQM A;  4POM A;  5ECL B;  5A5K A;  3ZIV A;  1V57 A;  3QPM A;  4IW9 A;  3QAW A;  4EF0 A;  2H1D A;  2KOK A;  5ELA A;  1KBN A;  5FHI A;  3IR4 A;  6GSX A;  3QD9 A;  3C71 A;  3S17 L;  4CDO A;  1PKZ A;  1K0B A;  1X9M B;  1GH2 A;  1B9X C;  3CSJ A;  2TRX A;  1LTL A;  1VGL A;  14GS A;  4L0U A;  2YAN A;  5JWQ B;  5IO0 A;  3CSI A;  2GST A;  4XS4 B;  4TR3 A;  1EOG A;  1PGT A;  2GQK A;  2AHE A;  1KEB A;  1E2Y A;  5JCG A;  1PA3 A;  3EVI A;  4Y7N L;  1BFY A;  2FCH A;  2HZF A;  1PX6 A;  4JAF A;  1HNB A;  3VUR A;  3EU4 A;  2R5G A;  2AAW A;  1FVJ A;  1SK1 A;  2H19 A;  2R0C A;  3GTM L;  2L6D A;  3I4M L;  5DQS A;  4HSC X;  5HR0 A;  2C3N A;  4O7H A;  1RW1 A;  3QVD A;  1XCC A;  4WXT A;  4GS7 D;  4HJ2 A;  4OO4 A;  1BQ8 A;  2CT6 A;  3L78 A;  1P7P A;  4J2F A;  1T4Z A;  3F9U A;  2WJU A;  1IW7 D;  4AJ7 A;  3VWW A;  1DBY A;  3IAM 2;  3SBC A;  3M0F A;  3S16 L;  2O7K A;  3EYT A;  3O76 A;  2H71 A;  1S3A A;  3ZRE A;  1PD2 1;  3EMX A;  5ID2 A;  1EWX A;  4GRF A;  2IJY A;  3MSZ A;  2ON7 A;  3GH9 A;  3CMI A;  4HS1 A;  3RZD L;  4WF4 A;  2H72 A;  1UA5 A;  1R26 A;  1URM A;  1KNG A;  3R3E A;  3S1R L;  1V58 A;  3A2X A;  3NFP I;  1FHE A;  1C72 A;  1Z6N A;  1K0D A;  3DKS A;  4KDU A;  2B5Y A;  2K8S A;  1MDJ A;  2OE3 A;  2MMO A;  4OFM A;  2X49 A;  3WGE A;  3I4N L;  3QDN A;  4KUN A;  1ML6 A;  1AC1 A;  2YWO A;  3J7Z 1;  2B63 L;  3HVS A;  4FH8 A;  3GL3 A;  2A2S A;  4QIW P;  1Z3E A;  1AUC A;  3F63 A;  3H8Q A;  3GKK A;  3GX8 A;  4LA1 A;  5IMC A;  4HEA 2;  2LKU A;  4E8H A;  3MDK A;  4MH3 A;  2M6P A;  1XIY A;  1BQ7 A;  1SJ6 A;  2HSM A;  4YWM A;  3ZIT A;  1M9B A;  4EO3 A;  5AGY A;  3SS2 A;  5ECN B;  4TOP A;  2RDV A;  1F3A A;  2G2Q A;  1R0I A;  2YOI A;  5IP9 L;  1B8X A;  1T3B A;  2H6X A;  3FYG A;  2CZ3 A;  4NMU A;  2YWN A;  3HJM A;  5HQP A;  3G7I A;  2GVP A;  1Y1V L;  4Q5Q A;  2M80 A;  1TK8 B;  2LV3 A;  5G31 A;  1K83 L;  3EWL A;  1UC7 A;  2OAC A;  1BX9 A;  3F6D A;  2CAI A;  3GMF A;  5AIX A;  2LNS A;  5IMZ A;  2DKH A;  5ECP B;  5F06 A;  2LNT A;  5LCZ A;  4IQ1 A;  1K0O A;  1RYQ A;  3IA1 A;  1NSW A;  3CSH A;  2PER A;  1VZH A;  2JI3 A;  1GSY A;  2P31 A;  3APQ A;  1K0N A;  1F3B A;  3FEU A;  3H0G L;  4XTS A;  1M3J A;  3H93 A;  3KD0 A;  1JYB A;  2CX3 A;  3LWR B;  2NVQ L;  4A3I L;  2VIM A;  3S2D L;  4AR5 A;  2C0E A;  4NPB A;  1BJX A;  3TRP A;  5M5Y L;  2K2D A;  3GIX A;  1SMM A;  1TI3 A;  2REM A;  2RM5 A;  4LL4 B;  1BED A;  1NHY A;  5A4U A;  4Z2R A;  3PO2 L;  1J9B A;  2R2J A;  4L5O A;  2BMX A;  3LQ7 A;  4YKG A;  2LQO A;  2HRF A;  1X9W B;  3VWV A;  1FO5 A;  3FZ5 A;  2VUP A;  4PXO A;  1EEJ A;  1FHH A; 
#chains in the Genus database with same CATH homology
 4JED A;  3TRQ A;  2V0E A;  3RYG A;  5GAE c;  3P8W A;  10GS A;  3F4T A;  2GQM A;  1MDK A;  3VI7 A;  2H6Y A;  1OWB A;  3TKP A;  4D73 B;  5IPG A;  2QC7 A;  5G5F A;  3L4N A;  3C73 A;  2GS3 A;  4ZL7 A;  3M9K A;  2EIR A;  2XPD A;  5ECM B;  1YJ6 A;  4V2L A;  1S3D A;  3PZA A;  2VM1 A;  3ERW A;  4ILF A;  2GSS A;  2L5L A;  4TR4 A;  3GNJ A;  2R6K A;  1MTC A;  2IFQ B;  1EEM A;  1OKD A;  3VWX A;  5CRE A;  4HDE A;  1XW9 A;  1JZO A;  2VL3 A;  5D8I A;  1CQG A;  4HOJ A;  2NBS A;  3L0H A;  4K5R A;  2L4Q A;  5DAK A;  1GL8 A;  3CYN A;  4JAE A;  1AXD A;  2B1L A;  1ZYQ B;  1BQ9 A;  3P8B A;  4XXB B;  4I8B A;  1XW6 A;  4XS6 A;  5IY0 A;  1BYE A;  1THO A;  2X64 A;  4HQS A;  2C0G A;  2LS5 A;  1K0M A;  2XJQ A;  4LMV A;  5HFG A;  2V6K A;  2JSY A;  3DVW A;  2UZ8 A;  1XPV A;  5CRG A;  3TKS E;  8GSS A;  1OKT A;  3IBH A;  3N9J A;  1FHM A;  1F9M A;  2G0F A;  4KW6 A;  1GSS A;  4MF6 A;  3PIO 1;  4O92 A;  4V1A g;  4PGT A;  1YUX A;  2VLT A;  4TR0 A;  3TDG A;  5EIN C;  1B4P A;  2MZC A;  2ZIX A;  4E8E A;  3LXT A;  3HDC A;  1SKW B;  4B8C D;  5BMU A;  1TRS A;  4MJB A;  1AW9 A;  1EZK A;  1SD9 A;  1O8W A;  4ECC A;  3GSS A;  4GQF A;  1BE7 A;  2DJK A;  2YNX A;  4BVY A;  1SYR A;  1XXU A;  2GSQ A;  3DEX A;  2M4V A;  2X99 A;  2XJT A;  1H7V A;  3S9F A;  2YV7 A;  4EC0 A;  1YK4 A;  1WIK A;  2ZNM A;  2B6M A;  3GHA A;  5CRH A;  5CNW A;  3QFB C;  1A8Y A;  4Z7X A;  3ZRD A;  3KMO A;  3Q74 A;  3QQC E;  2MMZ A;  2WCI A;  4ZXG A;  2JAC A;  1NW2 A;  3HY2 A;  3TB2 A;  1T9O A;  1XWG A;  2C4J A;  4NV2 A;  1FAA A;  2H70 A;  1ZOF A;  1UN2 A;  4POB A;  2CX4 A;  2P5R A;  1Y6E A;  1OAZ A;  2A6H D;  3IPZ A;  4I6X A;  4AI2 A;  4PUR A;  4YH2 A;  4HQZ A;  5B6M A;  3DIE A;  4EXJ A;  2V0F A;  3APO A;  4O5Q A;  4BWS A;  4ISD A;  4EDY A;  1PL1 A;  2CR8 A;  3ZVJ A;  5DJL A;  5C00 A;  3G7Y A;  5IMF A;  1ILO A;  2ALB A;  4POF A;  2GDR A;  4OFN A;  4AHX A;  2H01 A;  2PU9 C;  4ID0 A;  1OYJ A;  1R0G A;  2LST A;  3M3M A;  2IMF A;  2AUV A;  1E8J A;  3EUR A;  5AN1 A;  5F05 A;  2PVE A;  1LKP A;  4IJI A;  1OWC A;  1S2Z A;  3CRU A;  1F37 A;  1XVW A;  1ZRP A;  3GUS A;  3PKI A;  5GST A;  3BBY A;  2A68 D;  1U87 A;  1Z9H A;  1T9P A;  2I81 A;  2B5I D;  5ECK B;  4HJM A;  4KCA A;  2GGT A;  2WDU A;  2LJA A;  1RB9 A;  4MZW A;  3EPT A;  2HXK A;  5IPH A;  3HJP A;  3DML A;  2B5X A;  1KTE A;  4G0K A;  4IGJ A;  1JZD A;  2WFC A;  2CKC A;  2DJJ A;  4WKW A;  1M2A A;  2DKI A;  4JE1 A;  4AI0 A;  3VK9 A;  5ECR B;  3O6T A;  5J41 A;  3HD5 A;  3TJF A;  3A44 A;  3ME8 A;  3WD6 A;  3CTG A;  2O8V B;  4WBR D;  1OC9 A;  4QQ7 A;  4X1U A;  3RAZ A;  5CO3 A;  4A5P A;  5GAG c;  3FKF A;  4YAP A;  3IK9 A;  3LGC A;  2XJV A;  1TRV A;  4EL1 A;  3NZN A;  4ZIL A;  1ERT A;  2F8F A;  2IIY A;  1SKS B;  1LU4 A;  4RQX A;  3F6F A;  4AHZ A;  1U3A A;  3VFI A;  4F03 A;  2F51 A;  5MFZ A;  1PKW A;  4H86 A;  4DSS B;  3LPE B;  1V98 A;  4XS4 A;  3FK8 A;  3WYW A;  2HYX A;  4TXV A;  4IN0 A;  5F0G A;  4ACS A;  3P7X A;  3V1W A;  1MEK A;  2K18 A;  2H75 A;  4V1A p;  2FWG A;  4DSQ A;  4CHS A;  5MLC 3;  2DC5 A;  1ZGN A;  2NPB A;  3CRT A;  4GSS A;  3GKN A;  4WBJ A;  3UBL A;  1AQV A;  3GX0 A;  1EOH A;  1A8L A;  3FR3 A;  5D9T A;  2R0P A;  5G1K A;  5FT3 A;  2P5Q A;  3KCM A;  3QAG A;  5IMD A;  3I9V 2;  1TW9 A;  4CY8 A;  3UOM A;  4DVC A;  5D9V A;  6RXN A;  2HSH A;  4QL7 A;  4F0C A;  4ZBD A;  2WB9 A;  1SK0 A;  1AQW A;  1CQH A;  2C8U A;  2VCV A;  3TOU A;  1B71 A;  3ED3 A;  1TK0 B;  4ULX A;  3ZG6 A;  3ERG A;  2KP2 A;  3LW9 A;  3D6I A;  4ML6 A;  2XJS A;  1OC3 A;  2XJR A;  3LJR A;  4KSM A;  1J08 A;  4OD7 A;  4TR1 B;  1GLQ A;  2NDO A;  4YWL A;  1U88 A;  4TXO B;  1TJD A;  3IHQ A;  1YKC A;  3A3T A;  1F2E A;  2XBI A;  1SK2 A;  2IPA A;  4AHY A;  3TJG A;  3GH6 A;  4KE3 A;  2WZ9 A;  2OKA A;  1HQO A;  2PVO C;  4KDX A;  4YQV A;  3C8E A;  2JZT A;  11GS A;  3W8S A;  4JRR A;  4QL9 A;  6GSS A;  2V41 A;  2E0Q A;  3J7Y k;  1FOH A;  6GSY A;  1GTA A;  3K35 A;  1IYI A;  3KGK A;  2E2M A;  4GCI A;  4ZB9 A;  2V6O A;  2DIY A;  3RPN A;  3LSZ A;  2MS3 A;  2X8G A;  4ZN3 B;  4ME3 A;  1E6B A;  2C6A A;  1XWC A;  1W89 A;  1H75 A;  1OE7 A;  2V32 A;  3ME7 A;  4WEY A;  2C0D A;  2P0G A;  4BVX B;  2ZUP A;  2JI2 A;  4J56 E;  4KH7 A;  2FHE A;  3C1S A;  1RK4 A;  2YP6 A;  5EY6 A;  5G1L A;  1TDI A;  2H6Z A;  1PQN A;  2VL9 A;  2RUF A;  2OE1 A;  1TRW A;  2F9S A;  4LHN A;  5IOX A;  5CRW A;  1FG4 A;  1EP7 A;  1WJK A;  3HJO A;  3ZLP A;  3H1N A;  2FWH A;  6GSW A;  1QGV A;  4XGH A;  5DQY A;  4KND A;  1JLV A;  2IN3 A;  3FRC A;  5FWG A;  5DM6 1;  3ZTL A;  2BTO T;  3TUE A;  4F82 A;  1TU8 A;  1B2O A;  2O89 A;  2VL2 C;  3KTB A;  1GTB A;  2CKA A;  1FB0 A;  1OE8 A;  4ZBA A;  5D9X A;  5AIS A;  2LRT A;  4FYU A;  3B0A B;  1EV9 A;  1T9Q A;  2YZH A;  4K7O A;  2AYT A;  4K0N A;  4FYB A;  1G7O A;  5LD0 A;  3GRX A;  3CXG A;  3PPU A;  3FZ4 A;  3FHK A;  3IDV A;  3UAP A;  4ZL9 A;  3I6A A;  4RUV A;  2V1M A;  5G2Z A;  3EMP A;  4D73 A;  2PMT A;  4IJ3 A;  5COH A;  5C04 A;  3UIW A;  5KN2 A;  4PNF A;  1ZMA A;  3F4S A;  4GWR A;  3M9J A;  5AI2 A;  4TPU A;  1SMW A;  6GSU A;  3KIJ A;  2C3T A;  3GKX A;  3KJY A;  5DJM A;  3LYK A;  3LOR A;  17GS A;  2LCQ A;  4EIP A;  4EUY A;  13GS A;  2L0Z A;  2H74 A;  2DSX A;  4I2U A;  2IMK A;  2M72 A;  3QMX A;  1B9Y C;  3IE3 A;  4MF7 A;  4KCE A;  4AHW A;  1DX8 A;  1MDI A;  5DVB A;  1JLW A;  1U6T A;  4O5R A;  3VPQ A;  1RDV A;  2OA7 A;  2CV4 A;  4I5Q A;  4KDY A;  3GV1 A;  2MBT A;  4EIQ A;  3G9B A;  2HSY A;  3RZT A;  5H5R A;  2AV4 A;  1X5E A;  2JSZ A;  2A6E D;  1ZCP A;  3P2A A;  1TI1 A;  5BRT A;  4BA7 A;  2IMI A;  3H4K A;  5KOX A;  1O7U A;  3RBT A;  1O73 A;  4YAV A;  2N5A A;  1SEN A;  5IMA A;  1NXG A;  2QA1 A;  2BJX A;  1FW1 A;  1ZYE A;  4GF0 A;  3EIN A;  1XWK A;  3E9J B;  2V2G A;  19GS A;  1B2J A;  12GS A;  1GSQ A;  1PL2 A;  2IME A;  5EIO C;  2GZP A;  4N11 A;  3U5R E;  2PWJ A;  3VPB E;  2FWE A;  3KYU A;  2HR5 A;  5CAX A;  5H5S A;  3GFK A;  3TKQ A;  3L9U A;  1XW5 A;  4JU5 A;  3FR9 A;  3ZFB A;  3WGX A;  3E3E A;  4ZN1 B;  1PSQ A;  2LQQ A;  3ERF A;  1C09 A;  7RXN A;  2CVK A;  5J9C A;  2GZY A;  2YJ7 A;  4MAB A;  1ERW A;  1RDG A;  1JFU A;  4AR4 A;  4XHM A;  2A69 D;  2OBI A;  4MK3 A;  1TK5 B;  4K5S A;  2B7J A;  5MFP A;  4OWY A;  2KUC A;  2JZS A;  3LEF A;  4POK A;  1Q4J A;  5JVG 1;  3GL5 A;  2KKD A;  4F9Z A;  1FOV A;  2KP1 A;  5EL8 A;  4O32 A;  5HR1 A;  3HZ4 A;  1V9W A;  3A2W A;  2XHF A;  1WRY A;  4AGS A;  1EGO A;  1YEP A;  1TOF A;  1EP8 A;  1YF0 A;  5B6N A;  4IVF A;  1VZI A;  3QCP A;  2JZR A;  4NHZ A;  3GST A;  4K7I A;  2E7P A;  2HT9 A;  3EU3 A;  4TVE A;  4YKF A;  1SL0 B;  2CZ2 A;  2HI7 A;  2I4A A;  3O3T A;  4PX1 A;  5ECQ B;  3F4R A;  1IYH A;  2YV9 A;  5E59 A;  4BWQ A;  2BE5 D;  1WP0 A;  2CVB A;  4ZIJ A;  3UEM A;  2L59 A;  2GMG A;  3F0I A;  3LFL A;  4Z2U A;  3WT1 A;  5ECI B;  5ECO B;  5D93 A;  2GQL A;  1LKO A;  1V2A A;  3A5W A;  3GTU A;  1TTZ A;  2FWF A;  2RII A;  3FZ9 A;  4K9Z A;  5H5Q A;  3KH7 A;  2OE0 A;  3TOT A;  5E4W A;  4XRA A;  3PR8 A;  1GTI A;  1PMT A;  1I9D A;  4ECJ A;  2H8L A;  4USS A;  3Q6O A;  3RPP A;  5B7C A;  3W8J A;  1GRX A;  1DVB A;  1G0T A;  1DE2 A;  4AR6 A;  4JAG A;  2LTK A;  1RWD A;  2KN9 A;  3R2Q A;  2JAD A;  1GUL A;  2JI1 A;  2PVQ A;  2X4A A;  6GSV A;  1M7T A;  1QUW A;  3IC8 A;  4RI7 A;  3F3R A;  4MJE A;  5GAP D;  3UVH A;  4N30 A;  1ZL9 A;  2K9F A;  2HRK A;  2FY6 A;  2YPM A;  5DAK B;  4KX4 A;  2DMM A;  4AI3 A;  1ZYN A;  4MA9 A;  3K8N A;  5L71 A;  4KAE A;  2TRC P;  1YKA A;  5IMV A;  1YZX A;  2B7K A;  2VCZ A;  4O5U A;  4DSS A;  4MZC A;  3QOU A;  4L8E A;  2WGR A;  4MZB A;  4ZB8 A;  1PN9 A;  1GSD A;  2XPE A;  5JCW A;  3GYK A;  2FNO A;  4AR3 A;  2Z9S A;  1TRU A;  2FLS A;  1BRF A;  3TKS C;  2DJ0 A;  5A4W A;  2PPT A;  4XCS A;  5DAL B;  1GSF A;  4TKY A;  1VF1 A;  2DML A;  2VO4 A;  1B13 A;  3VI5 A;  1USB A;  4K2D A;  3BCI A;  4N10 A;  4PUF C;  5F8B A;  5GAD c;  4IP6 A;  1YV1 A;  1NXE A;  4K9F A;  3DYR A;  2GZZ A;  2MMN A;  1GNW A;  4EKZ A;  2FA4 A;  3HVX A;  4TVM A;  3RHC A;  4JZQ A;  1R4W A;  2HZE B;  1EGR A;  3KYY A;  3D21 A;  4TRX A;  4K0G A;  4K2X A;  4IKH A;  3SWL A;  4AJ8 A;  1K3Y A;  2IL3 A;  3LYP A;  4OMV A;  3KYW A;  3F3Q A;  3QAV A;  2E2G A;  1A24 A;  3W6G A;  1Y25 A;  4TR1 A;  1CAA A;  4XIH A;  2CAQ A;  3L9V A;  2GSR A;  2MYG A;  3DGQ A;  20GS A;  2PN8 A;  2Z3R B;  2EIO A;  2H0H A;  3Q19 A;  3IU3 I;  4X4J A;  4CW9 A;  3KTL A;  3TCO A;  4HZ4 A;  1GTU A;  3C1R A;  4G10 A;  3WT2 A;  3MPS A;  3IC4 A;  2R3X A;  1VF4 A;  4L0W A;  4MF5 A;  5JWO B;  3ZL5 A;  3IOS A;  3TRX A;  7GSS A;  5KN0 A;  2F8A A;  1QCV A;  2Z3Q B;  5G30 A;  3N5O A;  4EDZ A;  4Z2T A;  1XVQ A;  2LJR A;  1WWJ A;  2R0G A;  1A2J A;  2X8H A;  1O6J A;  1HYU A;  4FYC A;  3ZFL A;  4ZB6 A;  1M2B A;  3DXB A;  4U67 1;  4G0L A;  3CTF A;  2VCQ A;  3UL3 A;  3MIX A;  2H1B A;  3DD3 A;  4BVX A;  2YWI A;  2N5F A;  2VAF A;  2XBQ A;  1K0A A;  3KP9 A;  3HXS A;  3VWU A;  2A2P A;  4L5L A;  2VL6 A;  2QA2 A;  1JHB A;  3HVV A;  4MCU A;  2L6C A;  2H0G A;  2I9H A;  2YCD A;  2PYA A;  3A5I A;  4PQH A;  4AI1 A;  3LNL A;  4IQA A;  2IWT A;  2A4V A;  4E6Y A;  1K3L A;  22GS A;  2A2R A;  1WJV A;  2RUE A;  5DBQ A;  4BL7 B;  4KF9 A;  2M46 A;  1G6W A;  4GQC A;  2FA8 A;  1OC9 B;  1QXH A;  3IRA A;  5JVH 1;  1A23 A;  2O87 A;  1WMJ A;  1O81 A;  4X43 A;  4MLY A;  3I43 A;  2C80 A;  1RQM A;  1R0F A;  2PBJ A;  3QR6 A;  4ECB A;  2OJL A;  3BCK A;  4NV5 A;  5HR2 A;  2I3Y A;  1VZG A;  3TJJ A;  2ERJ A;  2VD0 A;  1XOA A;  5RXN A;  1J0F A;  2HRN A;  4JR4 A;  2RLI A;  4PQI A;  2ES7 A;  4X0X A;  4WET A;  1ODH A;  2LUS A;  3NOF A;  1IU6 A;  4XS1 A;  2K6V A;  3LXZ A;  4KA0 A;  6GST A;  3ZZX A;  3TKR A;  2VCX A;  1A0R P;  1X5D A;  1SJZ A;  3LG6 A;  4N0V A;  2VCT A;  3IV4 A;  1X9S B;  4G2E A;  2J9U B;  2GLR A;  4IBP A;  3MSU A;  5IOW A;  3FY7 A;  5ABR A;  4JR6 A;  1VF2 A;  4XRD A;  5F07 A;  4JAD A;  1TXX A;  4EVM A;  2C1Y A;  4GXZ A;  2DJ3 A;  1B4Q A;  3ZMK A;  3RHB A;  2C0F A;  3C7M A;  1H4O A;  3TGZ A;  1XFL A;  1RYT A;  2CQ9 A;  2H0I A;  4UY8 1;  2MMA A;  4I2T A;  1HD2 A;  4YQU A;  1ACV A;  3KP8 A;  3UAR A;  5EPF A;  4MH2 A;  3WGD A;  1B48 A;  1ON4 A;  3U6V A;  2L5O A;  1O8X A;  3I69 A;  4MMM A;  4BPY A;  2D2Z A;  1S3C A;  1Z6M A;  1BG5 A;  3KM6 A;  4F2I A;  4WR5 A;  2O5J D;  5KOW A;  5D9W A;  3L9S A;  4DEJ A;  2EIQ A;  3Q18 A;  4G9H A;  4LLR A;  3BJ5 A;  3FW2 A;  2DJ1 A;  4GTU A;  2DSA A;  5B8B A;  1WOU A;  1DUG A;  2HRA A;  1YQ1 A;  2C3Q A;  1SMU A;  3D5J A;  2O85 A;  5IM9 A;  2NVL A;  1VF3 A;  2LJK A;  3TJB A;  3HA9 A;  1GUH A;  2ERS A;  4PQ1 A;  3F8U A;  2IFQ A;  3OR5 A;  1ERV A;  1V40 A;  4ML1 A;  3FR6 A;  1XBS A;  1GNE A;  4HUA A;  3VLN A;  4EE0 A;  4Q5R A;  4RQR A;  1GUM A;  2C6B A;  4G0I A;  1T8E B;  3IAS 2;  2YZU A;  2JU5 A;  1S30 A;  4GSN A;  5ID2 B;  1VCX A;  3PGT A;  2WUL A;  4FO5 A;  2YJH A;  4J57 E;  3HYP A;  8RXN A;  2H30 A;  1QMV A;  5KEJ A;  4NWY A;  5ENU A;  4LHL A;  5JWR B;  2DIZ A;  4PNG A;  1DE1 A;  1Z7R A;  2F3M A;  5HR3 A;  5DCG A;  4HI7 A;  3PH9 A;  1N2A A;  3M8N A;  1YF1 A;  3LWA A;  2HLS A;  1T7P B;  2YWM A;  3M1G A;  3KYX A;  1PX7 A;  2QGV A;  4TW5 A;  4V2N A;  3BD2 A;  1DSB A;  5DCH A;  4POL A;  4LL1 B;  3HZ8 A;  4HZ2 A;  2NTO A;  4DSR A;  5G5E A;  4IEL A;  5IQY A;  1FVK A;  5GZZ B;  1TU7 A;  2VM2 A;  2H12 A;  3D0Z A;  16GS A;  1SU9 A;  5HFI A;  1SL1 B;  3PIP 1;  4AF2 A;  1OC8 A;  2VL2 A;  5AIV A;  2WRT A;  1G6Y A;  1T1V A;  2TIR A;  1Z92 B;  5J3R A;  5IO2 A;  2YN1 A;  3GA4 A;  2HE3 A;  4JBB A;  2GT5 A;  4ICY A;  4OCF A;  5J5N A;  1Z5Y E;  2AYJ A;  5DDL A;  4AJ6 A;  3IHG A;  1CAD A;  1LKM A;  5D73 A;  3MNG A;  5H1S c;  3HCZ A;  2H1G A;  4G6B A;  1HNC A;  4I97 A;  2LRN A;  2QL0 A;  1AQX A;  3VPT A;  2DJ2 A;  1IRO A;  2RM6 A;  5DM7 1;  3D22 A;  2ZCT A;  3MWH A;  2N5B A;  2M6O A;  5J4U A;  4NAX A;  2V3B B;  2CVD A;  4RXN A;  3J7Y b;  1Q98 A;  1YDK A;  2VLU A;  3RDW A;  4ECI A;  3IK7 A;  4KSO A;  4ZBB A;  4WFN 1;  3WWL A;  4OFT A;  1O85 A;  5CP1 A;  2R4V A;  1JZR A;  1WPI A;  3MAK A;  4TN8 A;  2K8V A;  3H79 A;  2XJU A;  1GSU A;  5INY A;  4MPG A;  3NIV A;  2B3S A;  2X8C A;  3ZYW A;  4N0Z A;  2OAD A;  1SL2 B;  3AY8 A;  5EVO A;  4PTS A;  5MGN A;  2PGT A;  5GAH c;  1SYX A;  4V19 6;  2LEG A;  1X5C A;  5ECS A;  2WS2 A;  5K2M E;  1K0C A;  3D4M A;  2AJQ B;  5LNK e;  3FZA A;  4K1F A;  5CYY A;  3MYD A;  3HKR A;  2J9H A;  1M99 A;  2JL4 A;  1BAY A;  4KB3 A;  1TKD B;  4KGI A;  3APS A;  5DAL A;  3KEB A;  1LBK A;  3J7Y 1;  3US3 A;  1EV4 A;  3KZQ A;  1A0F A;  1A2L A;  1MD3 A;  3P90 A;  1AAZ A;  2FD3 A;  1JZW A;  4V2M A;  1ERU A;  2L57 A;  3D4T A;  1NNQ A;  1F6M C;  1M0U A;  3PIN A;  2H66 A;  4MJC A;  4Q5F A;  3ISO A;  2HZE A;  1FB6 A;  2A4H A;  3GN3 A;  1U3I A;  5GSS A;  1R0H A;  1XWA A;  4MPF A;  1LJR A;  2H73 A;  3DWV A;  1QYB A;  1T4Y A;  1YK5 A;  2FUG 2;  2KHP A;  3DRN A;  2MBS A;  1WE0 A;  1GUK A;  4LMW A;  1ZYP A;  2R37 A;  5JCU A;  4POG A;  2VLV A;  1YUZ A;  1OVN A;  4MJA A;  5ELG A;  4FQU A;  3ZIJ A;  1SJI A;  3TJK A;  3KH9 A;  1I5G A;  2GTU A;  2VD1 A;  1ZZY A;  1GLP A;  1GP1 A;  5ECH B;  1ABA A;  1N8J A;  3IXR A;  4IP1 A;  4K7N A;  3BOA A;  1S24 A;  4NXI A;  1T00 A;  1R0J A;  4Q5N A;  4IHU A;  4MDC A;  2FGX A;  2PSM C;  5MF6 A;  1Z7P A;  1UVZ A;  3GUR A;  3GKM A;  5A4V A;  5J9B A;  3DVX A;  1SKR B;  5IIZ A;  1SD8 A;  1GWC A;  1IRN A;  4OO5 A;  1G7E A;  4OCE A;  4RI6 A;  1ST9 A;  2PVX A;  4BVY B;  4MP4 A;  1HNA A;  2QKE A;  2NYD A;  2VCW A;  1X0R A;  3JCM L;  5KN3 A;  2IMD A;  4K6X A;  2H1A A;  1TP9 A;  2DBC A;  2B5E A;  3CBU A;  1R5P A;  4MNN A;  2J23 A;  3WWN B;  4HU9 A;  2I1U A;  2DLX A;  3GTU B;  4F0B A;  2XJP A;  4PUA A;  1GSE A;  2VOC A;  5AN9 H;  3UMA A;  1YY7 A;  2H76 A;  3UJ1 A;  3RZ6 A;  1NM3 A;  3KMN A;  1M9A A;  3PWF A;  4P3Y B;  1XOB A;  3ZVJ D;  4IS0 A;  2L4C A;  2PUK C;  3UBK A;  4TXO A;  4BL7 A;  2B1K A;  4FIW A;  2GT6 A;  1QK8 A;  2QSI A;  3UVT A;  4WR4 A;  3EE2 A;  5B8A A;  9GSS A;  1QFN A;  1VRS D;  1THX A;  1W4V A;  3ZML A;  1YEX A;  3A2V A;  1XWB A;  4CY6 A;  1AIU A;  5CRD A;  4K8M A;  2AB6 A;  1PRX A;  1A2M A;  2HFD A;  2HNL A;  18GS A;  3FMW A;  4G19 A;  5KN1 A;  3PKJ A;  1MD4 A;  1QQ2 A;  5D96 A;  3E0U A;  2EC4 A;  5AI3 A;  1PN0 A;  2LRC A;  2ON5 A;  4NHW A;  1R7H A;  1R5A A;  3B08 B;  5GAN D;  5HFK A;  3QFA C;  4HU7 A;  4ZL8 A;  2CA8 A;  4WF5 A;  2OBK A;  1XZO A;  2KLX A;  3EC3 A;  1IU5 A;  2M4Y A;  3KXO A;  3KYV A;  3TKS A;  1K3O A;  1NHO A;  3HHV A;  1M2D A;  3G7J A;  2XC2 A;  4GLT A;  4GST A;  4YQM A;  4POM A;  5ECL B;  5A5K A;  3ZIV A;  1V57 A;  3QPM A;  4IW9 A;  3QAW A;  4EF0 A;  2H1D A;  2KOK A;  5ELA A;  1KBN A;  5FHI A;  3IR4 A;  6GSX A;  3QD9 A;  3C71 A;  4CDO A;  1PKZ A;  1K0B A;  1X9M B;  1GH2 A;  1B9X C;  3CSJ A;  2TRX A;  1LTL A;  1VGL A;  14GS A;  4L0U A;  2YAN A;  5JWQ B;  5IO0 A;  3CSI A;  2GST A;  4XS4 B;  4TR3 A;  1EOG A;  1PGT A;  2GQK A;  2AHE A;  1KEB A;  1E2Y A;  5JCG A;  1PA3 A;  3EVI A;  1BFY A;  2FCH A;  2HZF A;  1PX6 A;  4JAF A;  1HNB A;  3VUR A;  3EU4 A;  2R5G A;  2AAW A;  1FVJ A;  1SK1 A;  2H19 A;  2R0C A;  2L6D A;  5DQS A;  5HR0 A;  2C3N A;  4O7H A;  1RW1 A;  3QVD A;  1XCC A;  4WXT A;  4GS7 D;  4HJ2 A;  4OO4 A;  1BQ8 A;  2CT6 A;  3L78 A;  4J2F A;  1T4Z A;  3F9U A;  2WJU A;  1IW7 D;  4AJ7 A;  3VWW A;  1DBY A;  3IAM 2;  3SBC A;  3M0F A;  2O7K A;  3EYT A;  3O76 A;  2H71 A;  1S3A A;  3ZRE A;  1PD2 1;  3EMX A;  5ID2 A;  1EWX A;  4GRF A;  2IJY A;  3MSZ A;  2ON7 A;  3GH9 A;  3CMI A;  4HS1 A;  4WF4 A;  2H72 A;  1UA5 A;  1R26 A;  1URM A;  1KNG A;  3R3E A;  1V58 A;  3A2X A;  3NFP I;  1FHE A;  1C72 A;  1Z6N A;  1K0D A;  3DKS A;  4KDU A;  2B5Y A;  2K8S A;  1MDJ A;  2OE3 A;  2MMO A;  4OFM A;  2X49 A;  3WGE A;  3QDN A;  4KUN A;  1ML6 A;  1AC1 A;  2YWO A;  3J7Z 1;  3HVS A;  4FH8 A;  3GL3 A;  2A2S A;  1Z3E A;  1AUC A;  3F63 A;  3H8Q A;  3GKK A;  3GX8 A;  4LA1 A;  5IMC A;  4HEA 2;  2LKU A;  4E8H A;  3MDK A;  4MH3 A;  2M6P A;  1XIY A;  1BQ7 A;  1SJ6 A;  2HSM A;  4YWM A;  3ZIT A;  1M9B A;  4EO3 A;  5AGY A;  3SS2 A;  5ECN B;  4TOP A;  2RDV A;  1F3A A;  2G2Q A;  1R0I A;  2YOI A;  1B8X A;  1T3B A;  2H6X A;  3FYG A;  2CZ3 A;  4NMU A;  2YWN A;  3HJM A;  5HQP A;  3G7I A;  2GVP A;  4Q5Q A;  2M80 A;  1TK8 B;  2LV3 A;  5G31 A;  3EWL A;  1UC7 A;  2OAC A;  1BX9 A;  3F6D A;  2CAI A;  3GMF A;  5AIX A;  2LNS A;  5IMZ A;  2DKH A;  5ECP B;  5F06 A;  2LNT A;  5LCZ A;  4IQ1 A;  1K0O A;  1RYQ A;  3IA1 A;  1NSW A;  3CSH A;  2PER A;  1VZH A;  2JI3 A;  1GSY A;  2P31 A;  3APQ A;  1K0N A;  1F3B A;  3FEU A;  4XTS A;  3H93 A;  3KD0 A;  1JYB A;  2CX3 A;  2VIM A;  4AR5 A;  2C0E A;  4NPB A;  1BJX A;  3TRP A;  2K2D A;  3GIX A;  1SMM A;  1TI3 A;  2REM A;  2RM5 A;  4LL4 B;  1BED A;  1NHY A;  5A4U A;  4Z2R A;  1J9B A;  2R2J A;  4L5O A;  2BMX A;  3LQ7 A;  4YKG A;  2LQO A;  2HRF A;  1X9W B;  3VWV A;  1FO5 A;  3FZ5 A;  2VUP A;  4PXO A;  1EEJ A;  1FHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...