4U671

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
53
structure length
53
Chain Sequence
AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 3
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00471 Ribosomal_L33 Ribosomal protein L33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.120 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4u67100
5DM71 5GAHc 4U671 5GADc 4WFN1 4UY81 3PIP1 5DM61 4V196 3J7Y1 5GAEc 3J7Z1 5GAGc 5H1Sc 5MLC3 3PIO1 5JVG1 5JVH1
chains in the Genus database with same CATH superfamily
1R0HA 1I50L 1OWBA 3PO3L 1S2ZA 3B08B 1R0JA 1I3QL 2E2IL 3H0GL 4RXNA 1NXEA 3S15L 2GMGA 3IU3I 4C3HL 3QQCE 6RXNA 4AYBP 4JADA 5JVG1 4AR6A 4Y7NL 1BFYA 5M5WL 1LTLA 3M4OL 2JA5L 3P8BA 3GTJL 4C2M1 1IU5A 1LKMA 2CKCA 2XJSA 5IYDL 2B5ID 1TWAL 3B0AB 5IYCL 1T9OA 4A3JL 4K9FA 4AHZA 2B63L 5GAGc 1BQ8A 1QCVA 1S24A 2V0EA 5MGNA 2AYJA 3HOUL 5H1Sc 1R0IA 3ZG6A 1R0GA 1PFUA 3PL5A 1RWDA 1Z92B 2PVXA 1RYTA 4YWLA 3MPSA 2WAQP 3RZDL 1YUXA 3K7AL 2R92L 2AUSB 2NVXL 1SMWA 1F4LA 1YUZA 2V0FA 5C4JL 4BXXL 5IP9L 5JVH1 2M4VA 3PZAA 2LCQA 4JAEA 1VCXA 3GTQL 3S2HL 3H99A 3KYVA 5MLC3 1YV1A 1S30A 1FHMA 5M5YL 2WB1P 4B8CD 3KYWA 5C4XL 1PFWA 3PKJA 4AR3A 3I4NL 4ZN1B 4POFA 2JI2A 3LWVB 1Y1VL 5FJ8L 2A6ED 3HKZP 3LPEB 4Y52L 4UY81 2YU9L 2APOB 1RDVA 2C6BA 3RZOL 3S1QL 3HOXL 1TWFL 4XGHA 3H3VM 2JA6L 4YWMA 1E8JA 3LWPB 4AI3A 1IU6A 3H97A 2QL0A 5MFPA 5C3EL 4A93L 1Y1WL 3LNLA 3S1ML 4X6AL 5C44L 5GADc 3S14L 3VPBE 1R0FA 2KN9A 4AI0A 2PSMC 1R9TL 2EY4E 2AQCA 2A69D 1OWCA 1B13A 7RXNA 5GAEc 1B2OA 4BBRL 3JR7A 1PFVA 2PYAA 3HAXC 3PIO1 1NXGA 1WCML 2CKAA 5MF6A 4POGA 3FKIL 3H9CA 3J7Z1 2XJQA 3HJWB 1BQ9A 4BY1L 3CQZL 4U671 4AHWA 2A68D 4E6YA 5DM71 2M6OA 1I6HL 1T9QA 2HR5A 2NVQL 3HJYB 2VL6A 4GS7D 2XJRA 3HOVL 2Z3QB 3PWFA 2NYDA 2RDVA 2ERJA 2RFKB 4A3BL 4AR5A 3S16L 1LKPA 3A44A 2BE5D 3SS2A 1IRNA 3K35A 3PO2L 3S2DL 2JI3A 3HOWL 1QQTA 4A3IL 2CR8A 1H7VA 1IROA 1RB9A 5DM61 1PZXA 3KYUA 2MS3A 1VZIA 2NVTL 2H12A 5MFZA 2JA8L 5M3ML 3HOZL 1B71A 2XJTA 5M3FL 5AI3A 5K2ME 3P2AA 8RXNA 5FLML 4LHLA 1SFOL 4A3DL 4AI1A 5IY0A 5RXNA 2KKDA 3LWRB 1IW7D 2E2HL 3S17L 2HVYC 1TWCL 4AI2A 3NFPI 2E2JL 3GTLL 3KYXA 4BY7L 4ZN3B 2C6AA 2PPTA 4LHNA 1DX8A 4AR4A 3GTOL 1B2JA 1CAAA 4A3KL 1SMMA 3QVDA 4WFN1 1CADA 5AI2A 3RZTA 3RZ6A 2Z3RB 1PFYA 3H9BA 1SMUA 4JAFA 1C09A 1FHHA 4A3ML 1ODHA 3PKIA 3LWOB 3GTML 2XJPA 2VUML 5AN9H 2M6PA 2JI1A 1DVBA 5GAHc 4A3FL 2PMZP 5M5XL 1TWHL 1RDGA 1T9PA 4V196 2DSXA 2JA7L 2XJVA 4C3JL 4TVMA 4AHXA 3PIP1 2K2DA 2NVYL 4C3IL 1LKOA 1K83L 2J9UB 2ERSA 4XXBB 1BE7A 4AHYA 1BRFA 2R7ZL 2M4YA 1YK4A 2A6HD 3M3YL 4A3LL 4BBSL 3GTGL 1JYBA 3KYYA 3RYGA 4G6BA 4A3GL 1VZGA 2ZIXA 5IP7L 1WJVA 4A3EL 3S1RL 1YK5A 3WWNB 2Y0SP 2O5JD 1NNQA 5EIOC 1P7PA 3MQKB 3J7Y1 5EINC 4JAGA 3HOYL 2XJUA 2L0ZA 2PVEA 4ME3A 1VZHA 3LWQB 1ZRPA 3WWLA 4TPUA 3GTPL 1TWGL 3FDJA 3I4ML 1QYBA 1RYQA 5IYBL 3S1NL 2V3BB 4QIWP 2R93L 3MSUA 3GTKL 4A3CL
chains in the Genus database with same CATH topology
2XJRA 1FHMA 1R0HA 1SMUA 4B8CD 3KYWA 4JAFA 1C09A 1FHHA 2Z3QB 3PKIA 3PKJA 3PWFA 2NYDA 4AR3A 1OWBA 2RDVA 1ODHA 2XJPA 2ERJA 1S2ZA 3B08B 4ZN1B 4POFA 5AN9H 2M6PA 4AR5A 2JI2A 1R0JA 2JI1A 1DVBA 1LKPA 2A6ED 3A44A 2BE5D 4RXNA 3LPEB 1NXEA 3SS2A 5GAHc 1IRNA 4UY81 3K35A 2GMGA 3IU3I 1RDGA 1T9PA 1RDVA 2C6BA 2JI3A 3QQCE 6RXNA 4XGHA 4V196 4YWMA 2DSXA 1E8JA 4JADA 5JVG1 2CR8A 4AI3A 4AR6A 1H7VA 2XJVA 1IROA 1RB9A 1IU6A 1BFYA 5DM61 1LTLA 4TVMA 4AHXA 3PIP1 2K2DA 2QL0A 3P8BA 1LKOA 3KYUA 5MFPA 2J9UB 2ERSA 1IU5A 2MS3A 1BE7A 1LKMA 1BRFA 1VZIA 2CKCA 2XJSA 3LNLA 4XXBB 4AHYA 2H12A 5GADc 5MFZA 2B5ID 1B71A 2M4YA 2XJTA 1YK4A 3B0AB 2A6HD 1T9OA 4K9FA 5AI3A 4AHZA 5K2ME 3VPBE 1JYBA 3KYYA 3P2AA 3RYGA 5GAGc 1R0FA 8RXNA 4G6BA 1BQ8A 1QCVA 4LHLA 1VZGA 2KN9A 2ZIXA 4AI0A 2PSMC 1WJVA 4AI1A 1S24A 5IY0A 1YK5A 2A69D 2V0EA 3WWNB 1OWCA 2O5JD 5RXNA 5MGNA 1B13A 1NNQA 2AYJA 7RXNA 5GAEc 2KKDA 5H1Sc 1B2OA 1R0IA 1IW7D 3ZG6A 5EIOC 4AI2A 1R0GA 3NFPI 5MLC3 3J7Y1 2PYAA 1RWDA 3KYXA 5EINC 3PIO1 1Z92B 1NXGA 2PVXA 4JAGA 4ZN3B 2XJUA 2C6AA 1RYTA 2CKAA 2L0ZA 2PPTA 4LHNA 5MF6A 4YWLA 2PVEA 4ME3A 3MPSA 1VZHA 4POGA 1DX8A 3J7Z1 2XJQA 1BQ9A 1YUXA 4AR4A 4U671 1ZRPA 1B2JA 3WWLA 2A68D 4TPUA 4AHWA 1CAAA 1SMMA 4E6YA 5DM71 1SMWA 1YUZA 2V0FA 2M6OA 3QVDA 1QYBA 1RYQA 5JVH1 2M4VA 4WFN1 3PZAA 2LCQA 1CADA 4JAEA 1VCXA 1T9QA 2V3BB 3MSUA 2HR5A 5AI2A 3RZTA 3KYVA 2VL6A 4GS7D 1YV1A 3RZ6A 2Z3RB 1S30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 1;  5GAH c;  4U67 1;  5GAD c;  4WFN 1;  4UY8 1;  3PIP 1;  5DM6 1;  4V19 6;  3J7Y 1;  5GAE c;  3J7Z 1;  5GAG c;  5H1S c;  5MLC 3;  3PIO 1;  5JVG 1;  5JVH 1; 
#chains in the Genus database with same CATH topology
 1R0H A;  1I50 L;  1OWB A;  3PO3 L;  1S2Z A;  3B08 B;  1R0J A;  1I3Q L;  2E2I L;  3H0G L;  4RXN A;  1NXE A;  3S15 L;  2GMG A;  3IU3 I;  4C3H L;  3QQC E;  6RXN A;  4AYB P;  4JAD A;  5JVG 1;  4AR6 A;  4Y7N L;  1BFY A;  5M5W L;  1LTL A;  3M4O L;  2JA5 L;  3P8B A;  3GTJ L;  4C2M 1;  1IU5 A;  1LKM A;  2CKC A;  2XJS A;  5IYD L;  2B5I D;  1TWA L;  3B0A B;  5IYC L;  1T9O A;  4A3J L;  4K9F A;  4AHZ A;  2B63 L;  5GAG c;  1BQ8 A;  1QCV A;  1S24 A;  2V0E A;  5MGN A;  2AYJ A;  3HOU L;  5H1S c;  1R0I A;  3ZG6 A;  1R0G A;  1PFU A;  3PL5 A;  1RWD A;  1Z92 B;  2PVX A;  1RYT A;  4YWL A;  3MPS A;  2WAQ P;  3RZD L;  1YUX A;  3K7A L;  2R92 L;  2AUS B;  2NVX L;  1SMW A;  1F4L A;  1YUZ A;  2V0F A;  5C4J L;  4BXX L;  5IP9 L;  5JVH 1;  2M4V A;  3PZA A;  2LCQ A;  4JAE A;  1VCX A;  3GTQ L;  3S2H L;  3H99 A;  3KYV A;  5MLC 3;  1YV1 A;  1S30 A;  1FHM A;  5M5Y L;  2WB1 P;  4B8C D;  3KYW A;  5C4X L;  1PFW A;  3PKJ A;  4AR3 A;  3I4N L;  4ZN1 B;  4POF A;  2JI2 A;  3LWV B;  1Y1V L;  5FJ8 L;  2A6E D;  3HKZ P;  3LPE B;  4Y52 L;  4UY8 1;  2YU9 L;  2APO B;  1RDV A;  2C6B A;  3RZO L;  3S1Q L;  3HOX L;  1TWF L;  4XGH A;  3H3V M;  2JA6 L;  4YWM A;  1E8J A;  3LWP B;  4AI3 A;  1IU6 A;  3H97 A;  2QL0 A;  5MFP A;  5C3E L;  4A93 L;  1Y1W L;  3LNL A;  3S1M L;  4X6A L;  5C44 L;  5GAD c;  3S14 L;  3VPB E;  1R0F A;  2KN9 A;  4AI0 A;  2PSM C;  1R9T L;  2EY4 E;  2AQC A;  2A69 D;  1OWC A;  1B13 A;  7RXN A;  5GAE c;  1B2O A;  4BBR L;  3JR7 A;  1PFV A;  2PYA A;  3HAX C;  3PIO 1;  1NXG A;  1WCM L;  2CKA A;  5MF6 A;  4POG A;  3FKI L;  3H9C A;  3J7Z 1;  2XJQ A;  3HJW B;  1BQ9 A;  4BY1 L;  3CQZ L;  4U67 1;  4AHW A;  2A68 D;  4E6Y A;  5DM7 1;  2M6O A;  1I6H L;  1T9Q A;  2HR5 A;  2NVQ L;  3HJY B;  2VL6 A;  4GS7 D;  2XJR A;  3HOV L;  2Z3Q B;  3PWF A;  2NYD A;  2RDV A;  2ERJ A;  2RFK B;  4A3B L;  4AR5 A;  3S16 L;  1LKP A;  3A44 A;  2BE5 D;  3SS2 A;  1IRN A;  3K35 A;  3PO2 L;  3S2D L;  2JI3 A;  3HOW L;  1QQT A;  4A3I L;  2CR8 A;  1H7V A;  1IRO A;  1RB9 A;  5DM6 1;  1PZX A;  3KYU A;  2MS3 A;  1VZI A;  2NVT L;  2H12 A;  5MFZ A;  2JA8 L;  5M3M L;  3HOZ L;  1B71 A;  2XJT A;  5M3F L;  5AI3 A;  5K2M E;  3P2A A;  8RXN A;  5FLM L;  4LHL A;  1SFO L;  4A3D L;  4AI1 A;  5IY0 A;  5RXN A;  2KKD A;  3LWR B;  1IW7 D;  2E2H L;  3S17 L;  2HVY C;  1TWC L;  4AI2 A;  3NFP I;  2E2J L;  3GTL L;  3KYX A;  4BY7 L;  4ZN3 B;  2C6A A;  2PPT A;  4LHN A;  1DX8 A;  4AR4 A;  3GTO L;  1B2J A;  1CAA A;  4A3K L;  1SMM A;  3QVD A;  4WFN 1;  1CAD A;  5AI2 A;  3RZT A;  3RZ6 A;  2Z3R B;  1PFY A;  3H9B A;  1SMU A;  4JAF A;  1C09 A;  1FHH A;  4A3M L;  1ODH A;  3PKI A;  3LWO B;  3GTM L;  2XJP A;  2VUM L;  5AN9 H;  2M6P A;  2JI1 A;  1DVB A;  5GAH c;  4A3F L;  2PMZ P;  5M5X L;  1TWH L;  1RDG A;  1T9P A;  4V19 6;  2DSX A;  2JA7 L;  2XJV A;  4C3J L;  4TVM A;  4AHX A;  3PIP 1;  2K2D A;  2NVY L;  4C3I L;  1LKO A;  1K83 L;  2J9U B;  2ERS A;  4XXB B;  1BE7 A;  4AHY A;  1BRF A;  2R7Z L;  2M4Y A;  1YK4 A;  2A6H D;  3M3Y L;  4A3L L;  4BBS L;  3GTG L;  1JYB A;  3KYY A;  3RYG A;  4G6B A;  4A3G L;  1VZG A;  2ZIX A;  5IP7 L;  1WJV A;  4A3E L;  3S1R L;  1YK5 A;  3WWN B;  2Y0S P;  2O5J D;  1NNQ A;  5EIO C;  1P7P A;  3MQK B;  3J7Y 1;  5EIN C;  4JAG A;  3HOY L;  2XJU A;  2L0Z A;  2PVE A;  4ME3 A;  1VZH A;  3LWQ B;  1ZRP A;  3WWL A;  4TPU A;  3GTP L;  1TWG L;  3FDJ A;  3I4M L;  1QYB A;  1RYQ A;  5IYB L;  3S1N L;  2V3B B;  4QIW P;  2R93 L;  3MSU A;  3GTK L;  4A3C L; 
#chains in the Genus database with same CATH homology
 2XJR A;  1FHM A;  1R0H A;  1SMU A;  4B8C D;  3KYW A;  4JAF A;  1C09 A;  1FHH A;  2Z3Q B;  3PKI A;  3PKJ A;  3PWF A;  2NYD A;  4AR3 A;  1OWB A;  2RDV A;  1ODH A;  2XJP A;  2ERJ A;  1S2Z A;  3B08 B;  4ZN1 B;  4POF A;  5AN9 H;  2M6P A;  4AR5 A;  2JI2 A;  1R0J A;  2JI1 A;  1DVB A;  1LKP A;  2A6E D;  3A44 A;  2BE5 D;  4RXN A;  3LPE B;  1NXE A;  3SS2 A;  5GAH c;  1IRN A;  4UY8 1;  3K35 A;  2GMG A;  3IU3 I;  1RDG A;  1T9P A;  1RDV A;  2C6B A;  2JI3 A;  3QQC E;  6RXN A;  4XGH A;  4V19 6;  4YWM A;  2DSX A;  1E8J A;  4JAD A;  5JVG 1;  2CR8 A;  4AI3 A;  4AR6 A;  1H7V A;  2XJV A;  1IRO A;  1RB9 A;  1IU6 A;  1BFY A;  5DM6 1;  1LTL A;  4TVM A;  4AHX A;  3PIP 1;  2K2D A;  2QL0 A;  3P8B A;  1LKO A;  3KYU A;  5MFP A;  2J9U B;  2ERS A;  1IU5 A;  2MS3 A;  1BE7 A;  1LKM A;  1BRF A;  1VZI A;  2CKC A;  2XJS A;  3LNL A;  4XXB B;  4AHY A;  2H12 A;  5GAD c;  5MFZ A;  2B5I D;  1B71 A;  2M4Y A;  2XJT A;  1YK4 A;  3B0A B;  2A6H D;  1T9O A;  4K9F A;  5AI3 A;  4AHZ A;  5K2M E;  3VPB E;  1JYB A;  3KYY A;  3P2A A;  3RYG A;  5GAG c;  1R0F A;  8RXN A;  4G6B A;  1BQ8 A;  1QCV A;  4LHL A;  1VZG A;  2KN9 A;  2ZIX A;  4AI0 A;  2PSM C;  1WJV A;  4AI1 A;  1S24 A;  5IY0 A;  1YK5 A;  2A69 D;  2V0E A;  3WWN B;  1OWC A;  2O5J D;  5RXN A;  5MGN A;  1B13 A;  1NNQ A;  2AYJ A;  7RXN A;  5GAE c;  2KKD A;  5H1S c;  1B2O A;  1R0I A;  1IW7 D;  3ZG6 A;  5EIO C;  4AI2 A;  1R0G A;  3NFP I;  5MLC 3;  3J7Y 1;  2PYA A;  1RWD A;  3KYX A;  5EIN C;  3PIO 1;  1Z92 B;  1NXG A;  2PVX A;  4JAG A;  4ZN3 B;  2XJU A;  2C6A A;  1RYT A;  2CKA A;  2L0Z A;  2PPT A;  4LHN A;  5MF6 A;  4YWL A;  2PVE A;  4ME3 A;  3MPS A;  1VZH A;  4POG A;  1DX8 A;  3J7Z 1;  2XJQ A;  1BQ9 A;  1YUX A;  4AR4 A;  4U67 1;  1ZRP A;  1B2J A;  3WWL A;  2A68 D;  4TPU A;  4AHW A;  1CAA A;  1SMM A;  4E6Y A;  5DM7 1;  1SMW A;  1YUZ A;  2V0F A;  2M6O A;  3QVD A;  1QYB A;  1RYQ A;  5JVH 1;  2M4V A;  4WFN 1;  3PZA A;  2LCQ A;  1CAD A;  4JAE A;  1VCX A;  1T9Q A;  2V3B B;  3MSU A;  2HR5 A;  5AI2 A;  3RZT A;  3KYV A;  2VL6 A;  4GS7 D;  1YV1 A;  3RZ6 A;  2Z3R B;  1S30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...