2VL6A

Structural analysis of the sulfolobus solfataricus mcm protein n- terminal domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
259
structure length
259
Chain Sequence
b'QIDYRDVFIEFLTTFKGNNNQNKYIERINELVAYRKKSLIIEFSDVLSFNENLAYEIINNTKIILPILEGALYDHILQLDPTYQRDIEKVHVRIVGIPRVIELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVLEMPTICPKCGKPGQFRLIPEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPGDRVKVTGILDIKQDSPVKRGSRAVFDIYMKVSSIEVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MINICHROMOSOME MAINTENANCE PROTEIN MCM
publication title Structural Analysis of the Sulfolobus Solfataricus Mcm Protein N-Terminal Domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 66
structure length 259
sequence length 259
chains with identical sequence B, C
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2vl6A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vl6A02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 2vl6A01
4RMFA 3CPFA 3K80C 1Q82C 2D0OA 4DUZQ 5LMNL 4A3MH 1VQLA 2F4VQ 4YWMA 2QGQA 2A1AA 1Q46A 3CCMA 2Z6KA 1K8GA 4LF7Q 3KF8B 3U50C 4IPGA 1C09A 1N9WA 4POFA 1TWAH 1SMMA 4R4QA 3J7A5 1Y1WG 4IOAA 1RL2A 1NMGA 3D31A 3KDFA 1GD7A 3MEFA 4C3JH 1PYBA 1LM0A 4R4CA 1VQAA 1E22A 2MO0A 3H3VI 1PH7A 1SLJA 1IBKQ 4JI3Q 1AE2A 1S2ZA 1IBML 4AIMA 4GOPA 4QGUA 1IBLQ 3HOWG 3KDFB 4HJAA 2UU9L 3S15H 3K0XA 3W1GA 1VQGA 4UY8C 3HOYG 2YV5A 2D0PA 4HIOA 3ULLA 3RN2A 4JI6Q 1J5EQ 4LFAQ 1LKOA 4GOPB 3U4VA 1CKOA 1JJCB 3I7FA 5IT9c 3KOJA 1DGSA 2Q2UA 1RDVA 3AFQA 1N33L 2Q2IA 4A3EH 5C4JH 4AQYL 4C3IH 1BQ8A 3BU2A 2WAQE 3STBC 1EQRA 4NPSA 1PH2A 4A75A 1NJIC 2D62A 3I56A 4DV5Q 1UE1A 2K5VA 1VQHA 4DV7L 2KBNA 1VQ7A 2B63H 4JI1Q 3M7NA 3RZOH 2R93H 3H0GG 5AI3A 4A3JG 4BXXG 2PNHA 1B2JA 3CMAA 2UXDL 1BBUA 1VQCA 4KHZA 3W5OA 4LUOA 5C3EG 1K83H 1HNXL 1K8AC 4X65Q 1VQDA 3CCLA 4JI2L 2VW9A 3KYXA 1UE5A 4OWXB 3KJPA 4GLVB 4AR4A 4LUZA 3I4NH 3LGJA 2DGYA 2EXDA 2L15A 3MXNB 4YHHL 3VDYA 1EFWA 3J80c 1HR0L 1YEZA 2KHIA 1I94Q 1EWIA 2VUMH 2MQHA 3OTOL 3RLNA 1X3GA 1PV4A 1O7IA 2HHHQ 4LFCL 5EAYA 4P73A 2JA8G 1JMCA 3Q8DA 4R4OA 2UU9Q 1OXSC 2PMZE 4DR2L 2JQOA 1AH9A 4BY7H 4BBSG 3TS0A 4QJFA 2VQEL 5GADC 3PWFA 2R92G 2IHFA 1FHMA 1TWCH 2K50A 1Q8KA 2EQSA 1EOVA 2HIXA 4GOPC 1LTLA 1YUZA 3KYYA 1WYDA 2A19A 2JEBI 4DV6L 4JCVE 2C35B 1WI5A 1VQIA 2OCEA 2QEXA 2I5HA 1LKMA 4AH6A 2ZM6Q 3J7ZC 4NXML 1N33Q 1HJPA 4JI5L 2I0QA 3U58A 4DR4L 4AQYQ 7RXNA 2YTYA 3JC66 2XTIA 2OQKA 1X55A 4JYAL 2AWOA 3F2CA 4B3MQ 3HOZH 4DR6L 1IROA 3G4SA 2EIFA 2PYAA 4JBKA 3PCOB 3FKIH 3S1RH 4NB3A 3GO5A 3EBEA 2R7DA 1JJ2A 1WFQA 1R0JA 1QYBA 4DR5Q 3T1YQ 1VQ4A 3EN2A 3NENA 1RYTA 1B70B 4DAMA 1Y1VG 3J81c 5DLQE 2JJQA 3E9HA 1HNXQ 4DV2Q 4LF9Q 4JV5L 3FP9A 4GNXA 1A63A 1BFYA 1KRSA 3NELA 1XNRL 5C4XH 3KYUA 1WCMG 4OX9L 4BBRG 2RDVA 3HOWH 3RZDH 1J6QA 1Q86C 4A3GG 4DUZL 4QQBX 4BA1I 4DUYQ 1KIXA 2F4VL 2VNUD 1BKBA 4PZ8A 4LF7L 1N34L 1RDGA 4AR3A 1PFSA 1OXUA 1QVCA 5RXNA 5GAHC 3J81j 3OTOQ 2E2HH 4LFBL 2UUCQ 4JBJA 4JBMA 4P72A 1B13A 3CP0A 4KLKA 3E0EA 4YWKA 2CFMA 5HGQA 4DR2Q 2R6GA 5ELNA 1KAWA 1UEBA 1D7QA 2VQEQ 3F8TA 1IBKL 1YNXA 1SMWA 1IBLL 4J15A 2M4YA 5IP7G 1CKMA 2K5NA 4DV6Q 1N32L 3CQZH 5ELOA 1OXVA 3GTGH 4NXMQ 4LUVA 4JI5Q 4YY3Q 1GO3E 4BXXH 1D8LA 4DR4Q 1DX8A 2BA0A 4H02A 4JI6L 4DKAC 3ICEA 2ID0A 4Y52H 5C3EH 3SS2A 3CCRA 2NVTH 1JYBA 2ZTCA 3PV0A 5GROA 3HKZG 1Q81C 1QCVA 1X6OA 1Q12A 1QVFA 3RZ6A 4O0AA 3HOUG 1KHIA 2VL6A 1NY4A 2NVYH 4OXPA 1SR3A 3GTJH 5IP9H 4JI3L 4MTNA 3CCSA 4IOCA 3CD6A 1EIFA 4DV5L 3RLOA 1TWHH 5GAGC 4HIMA 4JV5Q 3PIPA 4JI1L 3CPWA 3HOVG 4R4TA 1XPRA 4OX9Q 2JA8H 2E2JH 3GTPH 3CAMA 3M4OH 2NVXH 1U5KA 1HZ9A 1HZCA 4OWTB 4X62Q 2ASBA 2XGTA 4X65L 1N34Q 1M90C 3CCQA 1BVSA 1IU5A 4GNXC 1WJJA 1JB7A 2CCZA 2R92H 3F2BA 4LFBQ 1YBYA 3ERSX 1S24A 2UXCL 3CCJA 1K9MC 4TPUA 1E24A 2BH8A 1B7YB 2V3BB 1YVCA 1I94L 3KFUA 3U4ZA 2JA7H 4K9FA 1Q1BA 4UPAA 4DV1Q 1L1OA 2KHJA 3PGZA 1VQPA 2HHHL 2YU9H 1X65A 5FLXc 5FJ8G 4JI4Q 5JJKA 1SRUA 3GTKH 1LKPA 1N32Q 1IZ6A 4O2DA 5IYCH 1EUJA 1XMQQ 1ASYA 3PSIA 1MKHA 1N36Q 3HOXG 4A3BH 2R7ZG 4A3LG 3BJUA 4K0KQ 4OO1G 1QZGA 1G291 1L1OB 1YK4A 1YZ6A 1Y1VH 3JAMi 4A93H 1VCIA 4DV0Q 2BA1A 1I50H 1PH5A 2VZAA 2ZM6L 2GMGA 3AQQA 1NE3A 4JI7Q 2UUAQ 1VS0A 1VQNA 5M5WH 1UE7A 4AYBG 2WAQG 1XPOA 5LMNW 2JA6G 3TQYA 1IXRA 3CC7A 2WB1G 4B3ML 3GTLH 1S40A 3RZTA 1VQ9A 2IT1A 5JEAG 1VQJA 2K52A 4GKKL 4POGA 4DR7L 1C0AA 1JT8A 4DR5L 2HR5A 3T1YL 3I4OA 4LF9L 1PH1A 3H3VH 4A3IH 3I2ZA 4DV2L 2E5LQ 4DR3L 3GTOH 2JE6I 1OTCA 2E8GA 4X66Q 5IP7H 2JA5G 2Q2HA 4GKJQ 4DUYL 4IFDG 4X6AH 2ZJPA 5M3FH 3S16H 1KL9A 1U0LA 4LNQA 2MS3A 4HJ9A 2HIVA 4JBWA 4A3CG 1E1OA 1V1QA 1V43A 4P75A 2MNAA 3TRZA 1VQMA 2VQFQ 2UUCL 3RR5A 4GN5A 1K73C 4IJHA 5FLMG 4LWCA 4LF8L 1S30A 3SGIA 4JI0L 1Z9FA 1TXYA 2OQ0A 4RG1A 3HOUH 1VCXA 2JEAI 4OO1I 1L1OC 3PUWA 1IL2A 1EIYB 3PZAA 3DLLA 2OTLA 4HJ5A 2RHQB 2KCTA 3HOVH 4C2MH 4YY3L 2GVAA 4DV3L 3CCVA 3M4PA 1S72A 4BA2I 5K36G 2ZJRA 3S17H 4JOIA 5IYDG 3T1HL 1W3SA 2YTVA 1M1KC 4DK3C 4LF4Q 3S1QH 1T9HA 4PMWA 3M4QA 1YHBA 3PUYA 2KN9A 4P71A 3H15A 4DR7Q 4GKKQ 1A0IA 1T9QA 4A3MG 1Y1WH 3BZCA 3PO3G 1Z47A 1SFOH 4B3TQ 1MJEA 3JC63 2K5HA 4A76A 1R0GA 2MFIA 3RLFA 3CXCA 1HR0W 4DR3Q 4A3FG 2K4KA 1N8RC 3PF4A 1R0IA 1E8JA 2N8NA 1IRNA 4TQUS 4NXNL 5FJ8H 2UUBL 1TWGH 4IFDI 4X62L 1G51A 3HOYH 4X64Q 3PIOA 4EX5A 4GNXB 3RYGA 4HIKA 3BZKA 1V9PA 2LSSA 4UP7A 1VQKA 2Y0SE 2PQAA 1VQ8A 1HNWQ 2ES2A 1A8VA 3K81C 2WFWA 1LUZA 1NNQA 1PH8A 4LF8Q 3UDXA 4JI0Q 4DAYB 3CMEA 4A4IA 4DV1L 1R0FA 1CSQA 5AJ3L 3K8AA 4KI0A 3TS2A 4LW1A 3F2DA 4B3SL 4LF5Q 3PUZA 1KXLA 4JI4L 4DV4L 3H0GH 1XMQL 1E3PA 1H7VA 2I5MX 4A3JH 2PI2E 1S3OA 4DV3Q 4GLXA 1N36L 4K0KL 4EQ5A 4RXNA 4C3HH 3OYYA 4HJ7A 1JE5A 4UP9A 1HZAA 3J80i 4DV0L 3T1HQ 2B63G 2R93G 3S14H 3S1NH 4GN4B 2BH2A 1JJGA 3L2PA 1X9NA 5C0XI 1SROA 1YHAA 4AR6A 3UDIA 1PH4A 1PH3A 3QVDA 1E1TA 1FVIA 5C44G 2Q2TA 1E7ZA 2N78A 4JI7L 2UUAL 4YCWA 2AKWB 3I4MG 3IRBA 1VQEA 1R0HA 4JOIC 2R7FA 4OONA 1CSPA 4PZ7A 1PYSB 5M3MG 3S24A 3M9BA 3W1BA 4NXNQ 2NN6I 5LMUQ 4IO9A 2UUBQ 1VQOA 5JEAJ 2JK8A 1GKHA 2VY3A 3ER0A 3L7ZC 4FDBA 3E9IA 4IPHA 1PH6A 2E5LL 4ALPA 3G71A 2RCNA 4BBSH 1VQBA 4X66L 3GDEA 5JJIA 3ZJYC 4GKJL 3HKZE 1X56A 4HIDA 3S2HH 4QY7A 2N3SA 1KQSA 2K2DA 4R1JA 4L5QA 4Y7NH 2K14A 2ZJQA 3KYWA 1KRTA 3S1MH 4YCUA 1BBWA 4IFDJ 4IPDA 1YK5A 3ULJA 5AJ3Q 3AFPA 1GVPA 3J81i 4B3SQ 2VQFL 3PO2G 2VS1A 5BR8Q 1HH2P 2NZOA 5IYDH 4A3DG 1UE6A 4QIWE 4DV4Q 2DUDA 3A5ZB 1QVGA 1B8AA 1IU6A 3PO3H 3OW2A 1DVBA 3HOZG 2LXKA 3FKIG 3RN5A 1YJNA 4GLAC 2IX0A 3FHWA 4MZ9A 1WCMH 1X3EA 4A3FH 1YHQA 4BBRH 3D0FA 1B2OA 3A44A 3WWVA 1BQ9A 4A3GH 4ME3A 1LYLA 1BE7A 4DR1L 2A8VA 1YV1A 4LF4L 2B3GA 5AI2A 1WOCA 3A74A 1NBWA 1YIJA 5C4XG 5M5XH 1XPUA 3NBHB 3KJOA 4L5RC 6RXNA 1XNQQ 2PVXA 5C0XJ 5IYBG 3DM3A 4BY1G 4LF6Q 2ATWA 4B3TL 1C9OA 4KHPL 2IY5B 2Z0SA 1XJVA 3CCEA 3F1ZA 1HNZL 2KCMA 4GN3B 5HY6A 2IHEA 1W2BA 3KF6A 1CADA 2N49A 2UXBQ 1AE3A 4X64L 1SMUA 1X3FA 2RF4A 3K7AH 2AMCB 4AYBE 1P16A 2GVBA 1PA6A 4PG3A 2WB1E 1OXXK 3PUVA 1K0RA 5GAEC 4HJ8A 4A3KG 3KF6B 1YI2A 1HNWL 1G6PA 3GTQH 4XTCS 1SN8A 2CQOA 5C44H 5LMNQ 1OXTA 3I4MH 1I6HH 1I3QH 1VQ5A 1B71A 8RXNA 1XTDA 4R4IA 2KKDA 4LF5L 3UE1A 1YUXA 3A5UA 2OWOA 1R9TH 1FHHA 4JI8L 2ALYB 5M3MH 3CC4A 5IP9G 1RIPA 2V1CC 1GM5A 5IY0A 3ULPA 2PVEA 2PI2A 4OWWB 1EYGA 3M3YH 4DR1Q 1IYJB 1VQFA 2Z6KC 1VQ6A 2F3IA 3PF5A 3NEMA 5C0XG 1IBMQ 2K75A 1NTGA 3UDFA 2IX1A 5IE8A 3S2DH 3RNUA 5IWAL 2GN5A 3B6YA 3MPSA 4L5TA 2ZTDA 1K3RA 4KHPQ 1BRFA 1SE8A 4APVA 3TREA 1HZBA 1HNZQ 2I5LX 2NVQH 2CWAA 2NN6G 4JG2A 3PO2H 1FJGL 2QL0A 2HQLA 5E7NA 5LMUL 4DK6C 2KENA 4A3DH 1Q7YC 3CW2C 2JA9A 2JA7G 4A3LH 1A62A 2LCQA 3HOXH 3UE0A 2R7ZH 4JC0A 1SMXA 4XIGS 3JC62 1I5FA 3HKSA 1QUQA 3AYHB 2Y0SG 2HT1A 4DV7Q 4L5SA 4PZ6A 2YYZA 5IYCG 4A3BG 2F52A 2B29A 4AR5A 3G48A 1XMOL 1CKNA 1NMFA 1QZHA 2UXDQ 3STBD 3PUXA 1CAAA 4A93G 1X54A 1T9PA 2AHOB 4IJLA 2NZHA 4WJ3M 1QUQB 1Y14B 2PQAB 5J3BA 5BR8L 4JI2Q 3K7UC 2JA6H 2ZTEA 2OTJA 4A3EG 1FL0A 1EQQA 1RWDA 4JI8Q 4UP8A 1T9OA 1CKNB 3CCUA 4YHHQ 1YJ9A 5IYBH 4TVAB 3JAMc 1HR0Q 1PHJA 4BY1H 2AWNA 1MJCA 5JJLA 1L2FA 1ASZA 4LFCQ 3TEHB 4DPGA 5IWAQ 1KC8C 2JA5H 1C7YA 1H95A 2CKZB 4A3IG 4MNOA 1YJWA 1PVOA 1PH9A 1FGUA 2MO1A 1UWVA 2YTXA 4A3CH 4B3RQ 3I4NG 4DNIA 3UDGA 1FJGQ 1XNQL 5M3FG 2RHSB 1YITA 5H1SE 4A3KH 4LF6L 5FLMH 2VUMG 1L0WA 4WJ4A 2CWPA 4P74A 1J5EL 2LXJA 4LFAL 3KYVA 4JYAQ 1Q1EA 3KYHC 2QA4A 4DR6Q 4B3RL 1RB9A 1P8LA 3GD7A 1CUKA 1KD1C 3EIVA 4BY7G 4YWLA 4YCVA 1TWFH 1XMOQ 2UXBL 1ZRPA 3M85A 2H5XA 3AEVA 2FXQA 4GS3A 2UXCQ 1MIUA 2E2IH 3CC2A 4QL5A 5M5YH 3A0JA 3GTMH 3I55A 2DSXA 2WP8J 4IPCA 3HFZB 5GQOA 3G6EA 3CF5A 3L0OA 1XNRQ 3KLWA
chains in the Genus database with same CATH superfamily
1D5MC 4A3MH 1JOQA 1VQLA 1NUCA 4LMQD 4DK0A 4AYBB 4PQXA 2F0GA 1Q90A 3DXJC 2WB1B 3J7A5 4IOAA 1P7PA 1NMGA 1YNJD 4IUVA 2N55A 2K6AA 2MO0A 1PH7A 2B2TA 1PFUA 1E2ZA 2XSCA 2BCOA 4DN4M 4HJAA 2AUKA 3VYRA 4UY8C 5J39A 2YV5A 2D0PA 1WTOA 2J9UB 3ULLA 1J5EQ 1PZKD 5D65A 1A2TA 3TBIB 1DGSA 1QNUA 1RDVA 1KDBA 3AFQA 3OMCA 2HCCA 4MTKA 5C4JH 4IURA 1IKMA 4JI3Q 3BU2A 3DEOA 2D62A 4DV5Q 1VQHA 4UHVA 4BXXG 2PNHA 2WINB 3CMAA 1DONA 3QG1A 3MXNA 1GUOA 2HCIA 3S1MB 1A6XA 4KHZA 1HNXL 1VQDA 3GTMB 1PRTC 3IL8A 1UE5A 3I4NH 4IUQA 5CV8A 4A3MB 4YHHL 3VDYA 3J80c 3MHBA 1YEZA 1I94Q 1EWIA 3OTOL 3RLNA 1X3GA 3WOFA 2E2IL 2A68C 2HHHQ 2JA8G 5EJWA 3Q8DA 1OXSC 3DMUA 2OT2A 4DR2L 1HUMA 2JQOA 1AH9A 3J7Z1 1AZPA 3BG3A 2IHFA 1TWCH 1EOVA 2A19A 5GADc 2X69A 2OCEA 5AFWA 2QEJC 1WCML 4AH6A 2ZM6Q 4BBRL 1TS2A 1ZYRC 5EPJA 2DJFC 3A55A 3U58A 1ZEQX 2I0QA 4FYDA 1HUNA 2XTIA 3LWRB 2PYAA 4JBKA 3PCOB 5CORA 3KBGA 2P5ZX 3EBEA 1JJ2A 1WFQA 4DR5Q 1QYBA 3FDJA 1EQVA 3K7AB 5C4JB 1RYTA 3MVVA 1D5ZC 4DAMA 2JJQA 4JV5L 1IYUA 2WIIB 3EQLC 1A63A 1WCMG 2FMCA 4BBRG 3HOWH 1XXGA 1Q86C 5C44B 4BA1I 3I4MB 1I3QB 1QOHA 1BKBA 4QCLA 3T56B 4AR3A 1QVCA 2E2HH 5RXNA 4X3TA 4ZYSA 3GTQL 3E0EA 2CFMA 5HGQA 3M3YB 5ELNA 2JP1A 1KAWA 1D7QA 2VQEQ 3F8TA 3QO2A 1I6HL 4N8FA 3B08B 4ZUJA 2M2LA 5IP7G 1L0YB 2K5NA 1NSNS 1OXVA 4NXMQ 1BUVT 1GO3E 4Q5VA 4DR4Q 3K5LA 3LX0A 1RKNA 3PO2B 5CV9A 1SNCA 1Q81C 5EGTA 5GROA 3HKZG 4A3DB 4O0AA 1KHIA 4JI3L 4MTNA 5MFZA 2FMMA 4RGOS 4IOCA 1ET9A 1EIFA 4DV5L 3RLOA 1TWHH 4CBVA 1PDQA 4R4TA 1XPRA 2PMZP 3DUZA 4OX9Q 3GTPH 3M4OH 1HZ9A 1HZCA 2CCZA 2C6AA 4LFBQ 2R7ZL 1GUTA 3PIO1 4N8X1 3KBXA 4PMBA 2BH8A 1B7YB 2V3BB 2C9OA 2N88A 3RUZA 3U4ZA 4OELB 1I94L 3C3LA 1Q1BA 4UPAA 2YU9H 3PGZA 2HHHL 1X65A 5FLXc 5JJKA 2RDHA 3E3XA 1IZ6A 1ENCA 4ODGA 1EL0A 4K6DA 5KNBA 2R7ZG 4CDFC 5IYBL 1S4ZA 4OO1G 1QZGA 1Y1VH 2B39A 4DV0Q 3V96A 1LT5D 2F03A 2ZM6L 2JSOA 2PMZB 1NE3A 1KDCA 2F0EA 3K0YA 5M5WH 2WAQG 1XPOA 1QQTA 3ND9A 2JA6G 1IXRA 1S40A 1EFID 2IT1A 4GKKL 1RJTA 4DR5L 4M1UB 4C3HG 4A3KL 3I4OA 4P2CB 1B53A 3HGBA 1PH1A 2Q8RE 2E5LQ 2JE6I 3SK6A 5K2ME 1VDZA 4AHYA 3S16H 1KL9A 1TWFL 3VA5A 1U0LA 3GTJL 4K8IA 1V1QA 1V43A 2EY5A 4P75A 2VQFQ 5EQ0A 3HRZC 1K73C 4IJHA 1S30A 2A5HA 2R61A 2OQ0A 2CHBD 4RG1A 1VCXA 4LK1C 2VB3X 3DLLA 2RHQB 2KCTA 1JQYD 4WORA 4RGTA 3S1QH 4DK3C 3QOLA 5FO7B 5IGEA 3U9OA 2KN9A 4A3EB 4DR7Q 3R3OA 2FINB 3CRKC 3BZCA 1LTID 1Z47A 1SFOH 2RVLA 1G2SA 1PTOF 4B3TQ 4CKCA 3BDOA 3TP5A 4A3FG 3PF4A 2DJGC 3JR7A 5I9PA 1OWBA 2G5DA 5MFPA 5HGTA 3Q22A 1IRNA 4TQUS 2QF7A 1G51A 1DOMA 4X64Q 4EX5A 3RYGA 4C3IL 4HIKA 1V9PA 4KY5A 2LSSA 1VQKA 3E5SA 3OWEB 1EZ8A 4H7BA 1LUZA 3SK5A 1Z92B 2VUMB 3VR3A 3K8AA 2L0ZA 1KXLA 4K5VA 4C3IG 4DV3Q 1CHQD 2KVMA 4LHLA 2F0FA 3T1HQ 1AW7A 3J80i 3CKIB 4DV0L 1JJGA 2R93G 2BE5D 2BH2A 3QR8A 1PH3A 3QVDA 3BZDB 2RFKB 3K58A 1K0SA 2AKWB 3IRBA 1F9PA 4CKBA 4BY7L 2Z8LA 3S1QB 2R7FA 1SDFA 4PZ7A 5M3MG 2NBFA 1CA5A 3IU3I 5LMUQ 3M4YA 1SFOB 1ICWA 4IUPA 5JEAJ 1LTAD 4B9WA 4EGVA 2JK8A 4IPHA 2VY3A 3H3VC 3MXPA 2E5LL 3MWYW 2CH4A 4ALPA 2Z1CA 1VQBA 3FKIL 3LWUA 1KQSA 4L5QA 2ZJQA 5DAUA 3KYWA 4YCUA 3ULJA 3SE0A 4B3SQ 2VQFL 4KN7C 2NZOA 5C4XL 4U673 3J80L 3HAXC 3D6WA 3A5ZB 1QVGA 2O5JD 3OW2A 5E4WC 3FKIG 2A69D 1WCMH 4BBRH 3D0FA 2L9HA 1BQ9A 2A8VA 2B3GA 2Y0SP 5C4XG 4JW0A 3NWTA 3VPBE 6RXNA 4C56C 1G6ZA 3BVMA 4LF6Q 1KABA 1C48A 4B3TL 4R9WA 5KRUA 2IY5B 5EBCA 2Z0SA 2K03A 5C3EL 1HNZL 5C4ZA 2NVTL 2JA8B 2IHEA 3W3AA 2NVXB 1CADA 3Q6SA 2N49A 3NTIA 4X64L 1X3FA 4FF3A 2AMCB 4AYBE 2HD3A 1P16A 2GVBA 2WB1E 3EFXD 1K0RA 1YI2A 1RYQA 3KF6B 3GTQH 4XTCS 4JADA 2E2JL 1F9QA 1PTOB 3FMCA 5LMNQ 1I6HH 4XGHA 2BDNA 5EINC 3UE1A 2Y0SB 2OWOA 1FHHA 4HCSA 2ALYB 3CC4A 2XWJB 1RIPA 2V1CC 1EYGA 1FGBD 4DR1Q 4A93B 4J6HA 1X32A 3NEMA 1IBMQ 1NTGA 3UDFA 4ZUIA 1GJXA 3KUPA 2GN5A 3GTKL 3B6YA 3MPSA 3KLSA 5LHY1 3GTLB 4KHPQ 1BRFA 2A6EC 3AU7A 3R8BA 2QL0A 2HQLA 1STEA 5E7NA 4DK6C 5LMUL 1Q7YC 3CW2C 2F0DA 4BWGB 2LCQA 2R7ZH 4RWSC 4XIGS 1I5FA 1STHA 1O80A 4L5SA 4DF7A 2YYZA 1W6KA 2F0VA 1NAPA 3WDNA 4AR5A 5IGBA 1QZHA 4FXDA 1NR2A 1CAAA 2IX3A 1X54A 1T9PA 1Y14B 2PQAB 3FRPB 2JA6H 4JI2Q 3K7UC 2OTJA 1S5DD 3HKZB 1T9OA 1RCVD 4IALA 3HP3A 3NQIA 5M3FL 1PXUA 2F4IA 2XJVA 1R4QB 4TVAB 5IYBH 1YJ9A 4TRDA 1HR0Q 5A2QL 1L2FA 4KY6A 1ASZA 1O78A 2XJSA 4JAFA 5IWAQ 1C7YA 1H95A 2CKZB 4A3IG 3S17B 1YJWA 1GHKA 1EZ6A 3K6OA 1FGUA 2KQ3A 2YTXA 4B3RQ 3I4NG 2XJRA 5M3FG 4LF6L 4A3KH 1STBA 3HOVL 4G7HC 3SDZA 3PIP3 3KYVA 1Q1EA 3ERQA 3KYHC 3R2IA 1RB9A 3GD7A 1VZGA 1XYIA 1KD1C 4YCVA 1TWFH 3O13A 5TSSA 2R7ZB 3AEVA 4GS7D 1MIUA 2K1BA 5H1Sc 2WP8J 4IPCA 3IFTA 4K5WA 4RMFA 3CPFA 1Q82C 2LFNA 5LMNL 3ITPA 1TWGL 3SVMA 2F4VQ 2QGQA 1Q46A 1K8GA 4LF7Q 3KF8B 4IPGA 2JA6B 4POFA 1SMMA 3H0GB 5ELFA 3KDFA 5CBEE 4A3JB 2SEBD 3P20A 4C3HB 1PYBA 4R4CA 1LT4D 5IODA 4RH6A 1V1PB 4OHJA 5JVG3 3S14B 2H1EA 1IBLQ 1IBML 4HTHA 4GOPA 4QGUA 3S1NB 3HOWG 2RSNA 2UU9L 4OIJA 3W1GA 3HOYG 4JI6Q 1LKOA 1TS3A 3A56A 3U4VA 1HA6A 2Q2UA 2JYOA 1LO5D 3NXWA 1G91A 5DM63 4AQYL 2SDFA 1OWCA 5CV6A 3R93A 4C3IH 3STBC 1EQRA 2Z4HA 4NPSA 2R93H 3D3RA 1U4PA 4Y7NB 3TSSA 1SYGA 3PMFA 4IN3A 3CCLA 4JI2L 4F7XA 1JICA 2WV6D 4OWXB 2B2UA 2L15A 3S2HL 3MXNB 1S5ED 3CU7A 1HR0L 2KHIA 3TZUA 3I8ZA 1U4RA 3NPPA 1O7IA 3PKIA 5EAYA 4A3FB 2PO4A 3H94A 2PMZE 1BCPD 4KD4A 4NDXA 4BY7H 1HCZA 3PO3L 1Q8KA 1SNOA 2EQSA 4J1MA 4GOPC 4GLXA 5M5XB 3KYYA 4B3RL 3J81E 1F9SA 4J8QA 2C35B 4JCVE 3SK4A 1VQIA 4DV6L 2I5HA 3HS0C 3EROA 2YTYA 3FPUB 4C3JL 1GOZA 1X55A 3OSOA 2AWOA 3F2CA 5EKKA 3JAME 3G4SA 4WFN3 2EIFA 2LY7A 3FKIH 4NB3A 5C5LA 2E2DC 1Y1VG 3SEBA 1HNXQ 1KRSA 5C4XH 3OIPA 3K57A 2R93B 3H09A 2E76C 1J6QA 4QQBX 3SXHA 3TP6A 2F0OA 4DUYQ 1KIXA 2F4VL 3I4LA 4KK7A 2VNUD 1J8IA 4LF7L 1A3TA 1N34L 4NW2A 3V05A 1OXUA 5GAHC 3OTOQ 3PQIA 2B2UC 2UUCQ 5M3MB 4JBJA 3CP0A 4KLKA 4DR2Q 1X3QA 2R6GA 3NSWA 1DXMA 3OIQA 1YNXA 3DM1A 4CJ1B 3MFYA 5KNCA 1IBLL 4J15A 1K83L 1HQMC 1R9TL 1CI3M 3C1EA 2FJ2A 4E6YA 2FHTA 3NE5B 1D8LA 1DX8A 2BA0A 4H02A 4JI6L 3IFDA 2ID0A 3F2UA 5C3EH 2NVQB 2NVTH 3PV0A 3S2DL 1QCVA 3D4DA 1Q12A 1EEFD 1NY4A 3CCSA 1FNWA 4JV5Q 2EPBA 2KHSA 3PIPA 3CPWA 3I73A 3VR6A 2E2JH 2NZ1D 1BDOA 1U5KA 3VR5A 3P7JA 4G6BA 4A3LL 3HOXL 1BVSA 3CCQA 1WJJA 4HEDA 1EIHA 1EWHA 2XJQA 1WTVA 4TPUA 1AN8A 3ZYYX 5F2DA 4DV1Q 3MA2B 1SRUA 3GTKH 3RZDL 4A3LG 3PSIA 1MKHA 4K0KQ 3HOXG 1V1OA 4BY1L 1YK4A 1YZ6A 2XNAC 2EY4E 1QE6A 2VZAA 3AMUA 2GMGA 2EYOA 3AQQA 3SK8A 2JA5L 5BN3A 1VQNA 1RD9D 1UE7A 4KKUA 4AI0A 2D2CC 2IW3A 5LMNW 4KKSA 2A6HD 4TSSA 3C1FA 1HQRD 4A3CL 2MUYA 1VQ9A 1VQJA 4POGA 2CH4W 1C0AA 1JT8A 2ZXRA 3DWAA 3H3VH 4A3IH 1EU3A 1D1KA 1F9RA 4L8JA 1LT3D 4X66Q 2L11A 2JA5G 2Q2HA 4EQOA 1DCZA 4DUYL 4IFDG 4X6AH 2ZJPA 5M3FH 1WTPA 3C2PA 2MS3A 2M9VA 2VXWA 2JN4A 4HJ9A 4LNQA 4A3CG 3C46A 5M5YL 2UUCL 4B9XA 4LWCA 4LF8L 1Z9FA 5JAVA 1ODHA 4OO1I 1QJOA 4RCOA 1EYCA 1QB5D 3P75A 1EIYB 3PZAA 1IL2A 2BE5C 1TWAL 1F2ZA 2OTLA 3HOVH 4C2MH 2A74C 1RF2D 3M4PA 1S72A 2F1MA 2DY7A 2K5QA 4H0LC 2ZJRA 1W3SA 3TZDA 4LF4Q 1HFNA 3X3NA 2V0EA 3MQKB 3FPPA 4GKKQ 5C6AA 3HJWB 1T9QA 1EY8A 3S15L 4KHVA 1GHJA 1MJEA 3FEWX 1E2VA 2NYZD 4OEMB 2MFIA 4BS9A 1U4MA 1HR0W 2I46A 1RODA 3HZXA 1SYBA 2UUBL 3Q23A 2ZXOA 1TWGH 4RKLA 1BBXC 3HOYH 4A3IB 1PZJD 4GNXB 3BZKA 4ZKBB 2NB0A 4DA2A 2Y0SE 2EJGC 3BS1A 3I4NB 3RZOL 2B63L 2F0UA 1A8VA 3K81C 1PLFA 4H44C 2ES2A 5G3LF 1NNQA 1PH8A 4CKEA 2O5JC 4A4IA 4DV1L 5AJ3L 4KI0A 2PW5A 1BR9A 4PV1C 1D2BA 1K28A 4DV4L 5JEAH 2A69C 2I5MX 4K0KL 1KNAA 1PYWD 3I90A 1TWCB 4QB4A 5CV5A 4WRDA 5IOCA 2B63G 3EVQA 3L2PA 1I4QA 1SROA 4AR6A 1E1TA 1FVIA 1E7ZA 2N78A 4YCWA 4R8IA 1R0HA 4OONA 2DNEA 3LWOB 1PYSB 3AB9A 4HSVA 4LHNA 3M9BA 3D4RA 4B8CD 4IO9A 2F0KA 3K5MA 4FDBA 1F2YA 1GKHA 1U4LA 1GXDC 1PFVA 1KLUD 3GDEA 4X66L 1STYA 5JJIA 3HOZL 3HOWB 3P8BA 1STNA 2E75C 3HKZE 1X56A 3S2HH 3S1RL 2PZWA 1ONLA 3ONAB 5JPMC 3HOYB 5EPKA 2K14A 2MHVA 1KRTA 2E2HB 1BBWA 1JB3A 1RTOA 2ENBA 1GUWA 2VS1A 1HH2P 2L0CA 3URYA 1PTOD 2X6GA 3VR2A 1IU6A 3PO3H 1QNKA 4Q0FA 1DVBA 3HOZG 2PZTA 2K28A 3MXUA 2IX0A 3FHWA 1YHQA 1CZGA 1B2OA 1VMCA 2LS01 2KEDA 4ME3A 1BE7A 1YV1A 4LF4L 4ZCKA 2WKCA 4Z9CB 3NBHB 4JVZA 4AI1A 2D9UA 2PVXA 1QG7A 5IGGA 3CQZL 5IYBG 3GTGL 2ATWA 2PPBC 2EYFA 1TWHB 4R8NA 4X3SA 3V2TA 1XJVA 3F1ZA 2KCMA 3GTPB 3M4OB 1JC7A 2NVYL 1AE3A 2KCCA 2RF4A 5IP9L 1EY0A 2PW7A 1G6PA 4A3KG 2Z6BA 1SN8A 1TY2A 2X6LA 1HXYD 1EY9A 1VQ5A 1YNND 1B71A 5FK9C 2YU9B 4RHRA 2R92L 2OF1A 1Z7TA 4HSPA 1R9TH 4JI8L 5IP9G 4U671 5IY0A 1II3A 2PI2A 3T16A 2XJUA 4AHXA 1Y1VB 1MI2A 1VQ6A 2Z6KC 3LPEB 2JA7L 3CHBD 2IX1A 3S2DH 1SNQA 1VF7A 5M5WB 3QQCE 5COYA 4A3BL 1DOKA 1W6JA 1SYFA 4XXBB 4APVA 3I91A 4QIWP 1HNZQ 1I50L 3DEPA 4L63B 4CDEC 2J7ZA 1FJGL 4B08A 2JA7G 4A3LH 4A3GL 3HOXH 3UE0A 1GUGA 3HKSA 1V8QA 2HT1A 5AN9H 3MTSA 1EWCA 2NUCA 2B29A 4A3BG 3S16B 1XMOL 1XWEA 2JXMB 3VYSA 2FFKB 2QCPX 4FF4A 2AHOB 2EDGA 4PMCA 3MSUA 3OOCA 1STGA 1JWSD 1SBBB 1MGSA 5DM73 3JAMc 4BY1H 3CRLC 1F77A 3DWQA 1R9TB 4QIWB 2JA5H 4IFDH 3WOEA 3HOUL 1PH9A 4AI3A 5MGNA 2MO1A 1UWVA 4A3CH 4ZRZA 4V190 2RHSB 1I4GA 1SSOA 2EYHA 1L0WA 5ELEA 2NTTA 1BQQT 1GUSA 4LFAL 3DHQA 4JYAQ 2Q8IB 2QA4A 4DR6Q 2TMPA 3J7AF 4BY7G 4YWLA 1Y1WL 1ZYRD 3M85A 5FO8B 2UXCQ 2E2IH 4QL5A 5M5YH 5IGCA 1XNRQ 2RA4A 3G6EA 5I2XA 5C0XH 4AHWA 3KLWA 2J0TD 3K80C 2D0OA 4DUZQ 3LWPB 5FJ8L 5JVH3 2A1AA 2B8GA 3CCMA 3U50C 1L0XB 1TWAH 4R4QA 1FD7D 2SNMA 4JAGA 1Y1WG 2DY8A 1RL2A 4FXGC 1GD7A 2NN6H 3P1HA 5M9OA 4UY81 1ENAA 2K04A 1BCPC 1LM0A 1VQAA 3H3VI 2V0FA 1XTCD 2F0WA 2QDLA 4RA8A 2XJTA 4TVMA 1S2ZA 1D6EC 3MXGA 4AIMA 1AP0A 3A7AB 3KDFB 4X3KA 3S15H 2RKSA 1ET6A 1TVXA 1CQVA 4HIOA 3LWVB 4GOPB 2WACA 1PRTF 1JJCB 3I7FA 1VZHA 2APOB 1N33L 2Q2IA 1KTKA 1PH2A 3T53B 4A75A 5ISRA 1MHWC 3I72A 3J80E 1VQ7A 1B2TA 3RZOH 2B63H 1O7ZA 3PIP1 1EY6A 2EVBA 4C1NK 1TR5A 3W5OA 2CVRA 5C3EG 2F0HA 1DYQA 1K8AC 4MN3A 2E2IB 4IZ8A 5CMDA 3KYXA 5CV4A 3Q0AA 1K8MA 3KJPA 4GLVB 4AR4A 1C4QA 2DGYA 2RDFA 2EJMA 3A8KE 3S1ML 1I4HA 3HKZP 1XX8A 4TKOB 2K5WA 5IYDL 3GTML 1WCMB 4P73A 1JMCA 4R4OA 2D5DA 4XYQA 4BBRB 2UU9Q 2AYJA 2J4XA 3TS0A 4QJFA 4A3ML 1FHMA 2K50A 2HIXA 2G9DA 3WWLA 3QOJA 1Q8IA 5JVG1 3A54A 2HDMA 5I2YA 3J7ZC 4JK1C 1HJPA 4JI5L 1VZIA 4AQYQ 7RXNA 3JC66 3VA7A 1F2MA 2B2WA 4G4KA 4JYAL 4B3MQ 3HOZH 4DR6L 1IROA 4N9TA 2F3WA 4QUCA 3H9CA 3S1RH 3GO5A 2B8FA 1VQ4A 4UDUC 4LF9Q 2UXCL 5DLQE 4G7OC 5DM61 4JAEA 3FP9A 1WTRA 1XNRL 3NELA 2B63B 3KYUA 3T4AC 4EQPA 1X3PA 3GTQB 1MBYA 1TIID 1YNJC 1QWYA 4DUZL 1I6HB 2L12A 1JOOA 2NWGA 4PZ8A 5C4JL 3K7AL 2CKCA 1PFSA 3J81j 1R4PB 2KOLA 5MLC3 1EY7A 2IJ0A 3BYTB 4P72A 5GAHc 1B13A 4KKTA 4JBMA 1BO0A 3GV3A 5MF6A 2WAQP 1UEBA 5C44L 3I4ML 2WKDA 1I3QL 1SMWA 1VF5C 4DV6Q 1N32L 3CQZH 3GTGH 2L5TA 2EY6A 2AQ2B 3M3YL 2Q8TA 3ICEA 3CCRA 4WJWA 5EKLA 1Y8NB 2A6HC 3KLSX 1BNZA 1JYBA 2ZTCA 3VYUA 1X6OA 1QVFA 2NVYH 2VL6A 4OXPA 3GTJH 5IP9H 1ILPA 3CD6A 2B2WC 4HIMA 1OO9B 3HOVG 4F88A 4KTAA 3QWNA 2HUGA 3PO2L 4WFN1 3CAMA 4A3DL 2ZT9C 5FLXE 1DD2A 1LABA 4OIKA 1HHVA 2WAQB 1N34Q 2C6BA 1PRTB 1JB7A 2HVYC 2R92H 1CK1A 3NK9A 5KNDA 2MJ8A 2NTSA 1LLRD 3ERSX 3CCJA 3HEJA 2A73B 3J7YW 5IT9E 1E24A 2F0LA 1YVCA 1ZKOA 2JA7H 1L1OA 2KHJA 1QCBD 3J7Y1 4JI4Q 2KJXA 1LKPA 1T5EA 1TS5A 4O2DA 4A3BH 4DFAA 5KIXA 1G291 3ZG6A 3JAMi 2BA1A 1I50H 1LTGD 1S5FD 3D6CA 4A3KB 2O4XA 4JI7Q 4UAIA 1VS0A 3A7LA 2R3ZA 3TQYA 3K5OA 4KJOA 3CC7A 4B3ML 3RZTA 5JEAG 1CTMA 1WD0A 2K52A 4ZN3B 1TWFB 4M8AA 2HR5A 3GTJB 4LF9L 2XN9C 3I2ZA 2K7VA 3T13A 4DR3L 1SE2A 2E8GA 1FYCA 5ELDA 3J81L 1A2UA 3OW7A 5JPNC 2CKAA 2M00A 4RAUC 2HIVA 4ZLTF 4CJ2C 2F0JA 3JAML 5LL6S 4FO2A 3SGIA 4JI0L 2M6OA 1TXYA 3HOUH 3NP8A 1H9KA 1L1OC 5C5MA 1NR4A 2NYDA 1LT6D 1Y69U 5T1IA 2JI1A 5C4HA 3M7GA 1K3BC 1PZXA 1SE4A 2EOTA 1ESRA 3NUCA 4JOIA 1M1KC 2YTVA 1JR0D 1T9HA 4PMWA 1B3AA 1YHBA 3M4QA 4P71A 3TP8A 1A0IA 1Y1WH 3PO3G 4C3IB 5FOBB 3JC63 2K5HA 4A76A 4PNYA 2QILA 4C1NI 3CXCA 1N8RC 2K4KA 1R0IA 2QKIC 2RBMA 4NXNL 4C3JG 5FJ8H 2EYLA 4A3EL 4IFDI 3MEHA 4DAYA 3QIAA 4ILWA 3G7LA 3QJYA 3IKJA 4RGNA 2PQAA 4EQNA 1VQ8A 1HNWQ 2WFWA 2GA4B 4LF8Q 2L55A 1PTOC 3TS2A 1CSQA 4JPBW 4DNRB 1JE4A 3F2DA 3PUZA 4I7AA 4JI4L 1J9OA 3LWEA 3WWNB 1E3PA 1H7VA 1A3VA 4YIJA 3PKJA 4DU9A 4BY7B 4RXNA 4K2LA 2H12A 3OYYA 4HAEA 4F87A 1JE5A 1HZAA 4ZAIA 5BN4A 2VUML 5IIFA 5C0XI 1YHAA 2Q2TA 4JI7L 2PQEA 1B1ZA 1VQEA 2K05A 3OHXC 4JOIC 1SAPA 2EE1A 1CSPA 3A8IE 3FKIB 2KUMA 4RFBA 3S24A 1Y1WB 1PMRA 2NN6I 2UUBQ 2ZIXA 4O1NA 3L7ZC 2RSOA 3EA6A 4KN4C 1PH6A 3G71A 2RCNA 5C4XB 3S1QL 3DWPA 4QY7A 2PSMC 1Y8PB 2K2DA 3S9WA 1SFOL 1BCPF 3S1MH 1YNNC 1YK5A 4IPDA 5AJ3Q 5IYDH 5K5PA 5C3XA 4QIWE 4RGMA 4DV4Q 3OMGA 2DUDA 1B8AA 4C2M1 4KD3A 4XYOA 4CDDC 1S5CD 1E0BA 2LXKA 3TDQA 1V1PA 3RN5A 1YJNA 3NTHA 4GLAC 1ZXTA 3A44A 3WWVA 2CR8A 2CW0D 1JWMD 1LYLA 3BDCA 5ELBA 3A74A 5AI2A 1WOCA 5C3EB 1YIJA 2NVTB 1I6VC 1IW7D 1XPUA 2KA7A 4L5RC 5G3LD 4K14A 3DM3A 4BY1G 4BXXL 3L3OC 4Y52L 3CCEA 4GN3B 2EJFC 2E2JB 2B5ID 1W2BA 2EZVA 2L1BA 4XQQA 1SMUA 3K7AH 2ERSA 4RKBA 1SJHD 4PG3A 1OXXK 2Z9HA 2ICEC 5GAEC 4HJ8A 1HNWL 2JA8L 3R2TA 2CQOA 5C44H 4KY7A 2NVXL 1SNMA 3I4MH 1I3QH 3H3VM 4QMGA 2KKDA 3VYTA 1YUXA 3GTKB 3A5UA 4I65A 1GM5A 3ULPA 3M3YH 2PVEA 2B2VA 2EYMA 4O42A 1IYJB 4ABNA 1DM0B 2F3IA 5C0XG 4FP5D 1D1IA 4QUFA 4E6IA 5IYCL 4HR7B 4L5TA 4CJ0B 2K01A 4OL7A 2AUSB 2B2TC 3TP7A 4A93L 3TREA 2I5LX 2NN6G 4JG2A 3PO2H 2BOSA 2AQ1B 1H9MA 4A3DH 2KENA 2EY2A 1ML0D 3PL5A 3FVQA 5EBDA 3NFPI 3GTLL 1FR3A 1QUQA 4IUTA 2Y0SG 4DV7Q 4PZ6A 5IYCG 2F0MA 5M3FB 4XQJA 1CKNA 1NMFA 5I4DA 2UXDQ 3STBD 3PUXA 4A93G 4XT3B 4IJLA 4DAVA 1EY4A 3GTOL 2LKVA 5JOBA 1RWDA 5IP7L 4JI8Q 1SJED 1PHJA 1BXTA 4KMUC 1IHZA 5JJLA 4NKLA 4ZK9B 4LFCQ 1SXTA 3HOVB 4C2MB 3HG9A 1UNSA 1BCPB 2B2VC 1H9SA 2V4DA 1FJGQ 5I6WA 5H1SE 4KJNA 2HDLA 4NMZA 4WJ4A 2CWPA 3BDLA 1J5EL 3S17L 1O7YA 5E1FA 4AHZA 1UEAB 1TWGB 3EIVA 2IWHA 4AI2A 1XMOQ 2G9HD 1ZRPA 5NUCA 1B50A 2PPTA 2H5XA 2FXQA 4GS3A 3MAQA 2EYJA 3CC2A 3A0JA 3I55A 2DSXA 4FF2A 5GQOA 1PFNA 3L0OA 5GAGc 5KGUA 5IGFA 4YWMA 2Z6KA 1C09A 1N9WA 2DNCA 2M4VA 1RDPD 3D31A 1D5XC 4FNFA 3MEFA 1B3QA 4C3JH 4XQNA 5KYLA 1E22A 4MIUA 5KYIA 1IBKQ 1SLJA 5DM71 1AE2A 5E4XA 1CZWA 1RTNA 2JA6L 3K0XA 1VQGA 1SMYD 3H0GL 3ND8A 4A3JL 5EPLA 4C3HL 3RN2A 1ESFA 4LFAQ 5C3WA 1LACA 1CKOA 2XRQD 5IT9c 3S14L 3S1NL 3KOJA 1HTLD 1EYAA 1F2LA 2E74C 2RCFA 2RQXA 4A3EH 3IAYA 1IL8A 1BQ8A 2WAQE 4V196 1NJIC 3I56A 3I3CA 4QF4A 1UE1A 2K5VA 4DV7L 3M7NA 2KBNA 4JI1Q 3H0GG 5AI3A 2Z4IA 1HFGA 4RCNA 3UI2A 4A3JG 3S2HB 1B2JA 1EOTA 3T51B 2UXDL 1BBUA 1VQCA 4LUOA 1K83H 2F3VA 4X65Q 4BBSL 2VW9A 4LUZA 3LGJA 5CYUA 2EXDA 2PNRC 3PO3B 1EFWA 4Y7NL 3MC0B 4CGYB 5JVH1 2MQHA 2VUMH 3NTKA 4IUUA 5L37A 3RMHA 4LFCL 1EEID 3GQBA 1PV4A 3H99A 5CR3A 3L9AX 4C3JB 4BBSG 2VQEL 5GADC 3PWFA 2R92G 2I07B 1FNUA 1LTLA 1YUZA 1WYDA 2JEBI 1WI5A 2QEXA 1KNEA 1LKMA 4A3FL 4HCEA 4NXML 3I70A 1N33Q 3K5NA 4DR4L 1CHPD 2OQKA 3LNLA 2F0PA 4X3UA 2XWBB 5M5XL 2MP1A 2EYPA 2R7DA 5CC4A 1R0JA 1UAPA 3T1YQ 3EN2A 3NENA 1B70B 3J81c 3PIO3 1KLGD 3E9HA 4DV2Q 4GNXA 3TMEA 1BFYA 4HMIA 2K32A 2F0TA 4OX9L 2RDVA 3RZDH 4A3GG 1NXGA 1K83B 3X3MA 2F0QA 1RDGA 1PRTD 4G7ZC 2CQAA 4LFBL 2R93L 1K8OA 4YWKA 3K59A 3FDTA 1IBKL 1I4XA 4EVOA 2KCNA 2A68D 3S2DB 2M4YA 1PFMA 1CKMA 2B2YA 3NQTA 5ELOA 5M3ML 4LUVA 4JI5Q 3MZ5A 4YY3Q 4BXXH 3BVGA 2MGSA 4DKAC 1B4OA 4Y52H 4KV6A 3SS2A 1BF4A 4K2KA 4DXFA 2PCFB 1I4PA 1Q3LA 4H13C 4IUNA 3HOUG 3RZ6A 1SYCA 1SR3A 3HOXB 4ULLA 1CFMA 5GAGC 1ENFA 2EXZA 1SNDA 2IL8A 4I7ZC 4JI1L 2NVQL 2JA8H 1PZID 4FVMA 2NVXH 3N6RA 4OWTB 4X62Q 2ASBA 2XGTA 1NCVA 4X65L 1RHPA 1M90C 4GNXC 1IU5A 1DJRD 3F2BA 1YBYA 2C5CA 2LMCB 1S24A 3QB3A 3RZDB 1JORA 1K9MC 2IPKD 4BY1B 4FXKC 1PTOH 3P2AA 3KFUA 1HRJA 4K9FA 5LL6X 2XIWA 1VQPA 5FJ8G 2JA5B 1N32Q 5IYCH 1EUJA 2OXPA 1XMQQ 1ASYA 1N36Q 3BJUA 1U9RA 1M4VA 1L1OB 4A93H 1LV9A 5EIOC 1VCIA 4V0BA 1PH5A 2B2YC 1G8ZD 3NBHA 1TQOA 1IYVA 2UUAQ 3TN2A 1KAAA 4AYBG 3GTLH 3K35A 1AZQA 2WB1G 4DR7L 1S5BD 3T1YL 2AQ3B 5FLML 1CA6A 4DV2L 2K5DA 1H9JA 5M5YB 1PFWA 2JI2A 3J7AV 2SNSA 2MPMA 3GTOH 3A8JE 1PFBA 1OTCA 5IP7H 4GKJQ 5JJZA 2Z3QB 3H91A 4JBWA 1E1OA 1TWAB 3N52A 3H6MA 2MNAA 3TRZA 1VQMA 4OGQC 5T1GA 3RR5A 2QDBA 2ZXPA 4GN5A 4G57A 5FLMG 4RHSA 1C8CA 1AEXA 2JEAI 1UUPA 3PUWA 1MSHA 1WJVA 3S15B 1CM9A 4HJ5A 3E6ZX 4LAAA 4YY3L 2GVAA 4DV3L 3CCVA 2KEEA 4BA2I 2AUJD 3S17H 5K36G 5IYDG 3T1HL 5FO9B 5FKAC 1TT2A 3PUYA 2OEOA 3H15A 4A3MG 1M8AA 3D4WA 1DOLA 5I6YA 1R0GA 2RDGA 3RLFA 3RZOB 4DR3Q 1E8JA 2N8NA 3KLRA 1LTTD 2Z3RB 4K8JA 4X62L 3W2DA 2L4NA 3PIOA 4CDCC 3GTOB 3E0JA 4UP7A 4OO1H 3GV6A 5J22A 3HJYB 1MD2D 3OPOA 1I4RA 1ILQA 3UDXA 4DXGA 4JI0Q 4DAYB 3CMEA 3H9BA 4ZQ3A 4ZN1B 1R0FA 1QILA 1TU2B 4A3IL 3KK7A 4LW1A 4B3SL 4LF5Q 5A35A 2ERJA 1SYDA 1CQFA 3H0GH 1XMQL 3I4NL 2DN8A 1B9MA 4DGZA 2PI2E 1S3OA 4A3JH 4X6AL 1N36L 4EQ5A 4C3HH 2CW0C 4HJ7A 4UP9A 5E3FA 5FLXL 3S14H 3S1NH 4GN4B 1X9NA 3UDIA 1PH4A 1IW7C 5C44G 1Z6HA 3I4MG 2O5IC 2UUAL 1TS4A 5IT9L 5HURA 3HOZB 1TWCL 4DNTB 1WTHA 3S1RB 4ZKCB 5DNFA 3W1BA 1E2WA 4NXNQ 1VQOA 5J1ZA 4IQZA 5A2QE 3ER0A 4XDXA 3E9IA 4BBSH 5D3IB 3MFGA 3B0AB 3ZJYC 4XT1B 4GKJL 1CT1D 4HIDA 2N3SA 2BDOA 4R1JA 4Y7NH 4IFDJ 3AFPA 1GVPA 3LNNA 3J81i 3PO2G 5BR8Q 3SR1A 4A3DG 1LTRD 1UE6A 1AFPA 2K33A 1EY5A 3HOWL 1WD1A 3HOYL 1B9NA 1WTXA 2E2HL 4FF1A 3CQZB 4A3FH 5CV7A 4MZ9A 1X3EA 3GTGB 2M6PA 4A3GH 3BVZA 4K5XA 1A15A 4MHEA 4F8MA 4DR1L 5IGDA 2F0SA 1NBWA 2XRSD 3Q24A 5M5XH 3KJOA 1G2TA 3EJIA 1XNQQ 2NVYB 5C0XJ 3OWFA 1C9OA 4KHPL 5I9OA 4K6LA 5HY6A 1H9RA 3KF6A 4DAPA 2UXBQ 4CHTB 4BBSB 2R92B 1PA6A 1TWHL 3PUVA 4LJZC 1NNXA 1SEBD 2TSSA 3GTPL 4L6TB 3LWQB 1WTQA 5GAEc 2KECA 3M4OL 2ICIA 1OXTA 2JA7B 8RXNA 1XTDA 1VMPA 4R4IA 2HQEA 1DZ1A 4LF5L 1MSGA 1HTPA 4GZYC 2F0IA 1A3UA 2EY1A 5M3MH 4A3BB 2JI3A 4OWWB 1HPCA 1EYDA 3NHHA 1KDAA 4HN7A 1VQFA 3BYYB 1I50B 1O7LA 5EKIA 1SYEA 3PF5A 1ICFB 2YU9L 2K75A 5IE8A 3H97A 3D8GA 3NBIA 4ID6A 3RNUA 5IWAL 4A3GB 1SE3A 1EU4A 3G6JB 1STAA 1LTBD 5BN5A 2ZTDA 1K3RA 5ELCA 1WTWA 1SE8A 1Y1VL 1HZBA 2NVQH 2CWAA 1Y8OB 2PYKA 2JA9A 2F0NA 1A62A 5M5WL 1JOKA 4JC0A 4XXEA 1GUNA 1SMXA 1FNVA 3JC62 3NWSA 3AYHB 1WVLA 4ME5A 4S3SA 2F52A 2AQCA 5D3DA 1NXEA 3G48A 4HMJA 2VB2X 3U9SA 2H4OA 4NP5A 1T5XD 2NZHA 4WJ3M 1QUQB 5BR8L 5J3BA 1LTSD 2ZTEA 4A3EG 1FL0A 5D14A 1EQQA 5KEEA 4UP8A 3CCUA 1CKNB 4U68A 3HOUB 4YHHQ 3S16L 5CBAE 2AWNA 1MJCA 1BOSA 1SNPA 3TEHB 4DPGA 1KC8C 1SMYC 4AYBP 4MNOA 2QW7A 1PVOA 2WB1P 5DEHA 4DNIA 4N9PA 3UDGA 1TY0A 1XNQL 1YITA 1JCKB 1JWUD 2O2LD 1B44D 5CGKA 5FLMH 2VUMG 1IKLA 1H9SB 3GP7A 4P74A 2LXJA 2A6ED 1TKWB 1P8LA 1CUKA 3VR4A 2PZUA 4DK1A 2UXBL 2SOBA 2XJPA 1EQTA 1EIGA 1HA5A 3SHLA 3RD4A 5K36H 1PFYA 2XVSA 3KF8A 3GTMH 1F4LA 3HFZB 3CF5A
chains in the Genus database with same CATH topology
4A3MH 1VQLA 3J7A5 4IOAA 1NMGA 2MO0A 1PH7A 4HJAA 4UY8C 2YV5A 2D0PA 2J9UB 3ULLA 1J5EQ 1DGSA 1RDVA 3AFQA 5C4JH 4JI3Q 3BU2A 2D62A 4DV5Q 1VQHA 4BXXG 2PNHA 3CMAA 4KHZA 1HNXL 1VQDA 1UE5A 3I4NH 4YHHL 3VDYA 3J80c 1YEZA 1I94Q 1EWIA 3OTOL 3RLNA 1X3GA 2HHHQ 2JA8G 3Q8DA 1OXSC 4DR2L 2JQOA 1AH9A 3J7Z1 2IHFA 1TWCH 1EOVA 2A19A 5GADc 2OCEA 4AH6A 2ZM6Q 2I0QA 3U58A 2XTIA 2PYAA 4JBKA 3PCOB 3EBEA 1JJ2A 1WFQA 4DR5Q 1QYBA 1RYTA 4DAMA 2JJQA 4JV5L 1A63A 1WCMG 4BBRG 3HOWH 1Q86C 4BA1I 1BKBA 4AR3A 1QVCA 2E2HH 5RXNA 3E0EA 2CFMA 5HGQA 5ELNA 1KAWA 1D7QA 2VQEQ 3F8TA 3B08B 5IP7G 2K5NA 1OXVA 4NXMQ 1GO3E 4DR4Q 1Q81C 5GROA 3HKZG 4O0AA 1KHIA 4JI3L 4MTNA 5MFZA 4IOCA 1EIFA 4DV5L 3RLOA 1TWHH 4R4TA 1XPRA 4OX9Q 3GTPH 3M4OH 1HZ9A 1HZCA 2CCZA 2C6AA 4LFBQ 3PIO1 2BH8A 1B7YB 2V3BB 1I94L 3U4ZA 1Q1BA 4UPAA 2YU9H 3PGZA 2HHHL 1X65A 5FLXc 5JJKA 1IZ6A 2R7ZG 4OO1G 1QZGA 1Y1VH 4DV0Q 2ZM6L 1NE3A 5M5WH 2WAQG 1XPOA 2JA6G 1IXRA 1S40A 2IT1A 4GKKL 4DR5L 3I4OA 1PH1A 2E5LQ 2JE6I 5K2ME 4AHYA 3S16H 1KL9A 1U0LA 1V1QA 1V43A 4P75A 2VQFQ 1K73C 4IJHA 1S30A 2OQ0A 4RG1A 1VCXA 3DLLA 2RHQB 2KCTA 3S1QH 4DK3C 2KN9A 4DR7Q 3BZCA 1Z47A 1SFOH 4B3TQ 4A3FG 3PF4A 1OWBA 5MFPA 1IRNA 4TQUS 1G51A 4X64Q 4EX5A 3RYGA 4HIKA 1V9PA 2LSSA 1VQKA 1LUZA 1Z92B 3K8AA 2L0ZA 1KXLA 4DV3Q 4LHLA 3T1HQ 3J80i 4DV0L 1JJGA 2R93G 2BE5D 2BH2A 1PH3A 3QVDA 2AKWB 3IRBA 2R7FA 4PZ7A 5M3MG 3IU3I 5LMUQ 5JEAJ 2JK8A 4IPHA 2VY3A 2E5LL 4ALPA 1VQBA 1KQSA 4L5QA 2ZJQA 3KYWA 4YCUA 3ULJA 4B3SQ 2VQFL 2NZOA 1QVGA 3A5ZB 2O5JD 3OW2A 3FKIG 2A69D 1WCMH 4BBRH 3D0FA 1BQ9A 2A8VA 2B3GA 5C4XG 3VPBE 6RXNA 4LF6Q 4B3TL 2IY5B 2Z0SA 1HNZL 2IHEA 1CADA 2N49A 4X64L 1X3FA 2AMCB 4AYBE 1P16A 2GVBA 2WB1E 1K0RA 1YI2A 1RYQA 3KF6B 3GTQH 4XTCS 4JADA 5LMNQ 1I6HH 4XGHA 5EINC 3UE1A 2OWOA 1FHHA 3CC4A 2ALYB 1RIPA 2V1CC 1EYGA 4DR1Q 3NEMA 1IBMQ 1NTGA 3UDFA 2GN5A 3B6YA 3MPSA 4KHPQ 1BRFA 2QL0A 2HQLA 5E7NA 5LMUL 4DK6C 1Q7YC 3CW2C 2LCQA 2R7ZH 4XIGS 1I5FA 4L5SA 2YYZA 4AR5A 1QZHA 1CAAA 1X54A 1T9PA 1Y14B 2PQAB 2JA6H 4JI2Q 3K7UC 2OTJA 1T9OA 1YJ9A 5IYBH 2XJVA 4TVAB 1HR0Q 1L2FA 1ASZA 2XJSA 4JAFA 5IWAQ 1C7YA 1H95A 2CKZB 4A3IG 1YJWA 1FGUA 2YTXA 4B3RQ 3I4NG 2XJRA 5M3FG 4LF6L 4A3KH 3KYVA 1Q1EA 3KYHC 1RB9A 3GD7A 1VZGA 1KD1C 4YCVA 1TWFH 3AEVA 4GS7D 1MIUA 5H1Sc 2WP8J 4IPCA 4RMFA 3CPFA 1Q82C 5LMNL 2F4VQ 2QGQA 1Q46A 1K8GA 4LF7Q 3KF8B 4IPGA 4POFA 1SMMA 3KDFA 1PYBA 4R4CA 1IBLQ 1IBML 4GOPA 4QGUA 3HOWG 2UU9L 3W1GA 3HOYG 4JI6Q 1LKOA 3U4VA 2Q2UA 4AQYL 1OWCA 4C3IH 3STBC 1EQRA 4NPSA 2R93H 3CCLA 4JI2L 4OWXB 2L15A 3MXNB 1HR0L 2KHIA 1O7IA 3PKIA 5EAYA 2PMZE 4BY7H 1Q8KA 2EQSA 4GLXA 4GOPC 4B3RL 3KYYA 4DV6L 4JCVE 2C35B 1VQIA 2I5HA 2YTYA 1X55A 2AWOA 3F2CA 3G4SA 2EIFA 3FKIH 4NB3A 1Y1VG 1HNXQ 1KRSA 5C4XH 1J6QA 4QQBX 4DUYQ 1KIXA 2F4VL 2VNUD 4LF7L 1N34L 1OXUA 5GAHC 3OTOQ 2UUCQ 4JBJA 3CP0A 4KLKA 4DR2Q 2R6GA 1YNXA 1IBLL 4J15A 4E6YA 1D8LA 1DX8A 2BA0A 4H02A 4JI6L 2ID0A 5C3EH 2NVTH 3PV0A 1QCVA 1Q12A 1NY4A 3CCSA 4JV5Q 3PIPA 3CPWA 2E2JH 1U5KA 4G6BA 3CCQA 1BVSA 1WJJA 2XJQA 4TPUA 4DV1Q 1SRUA 3GTKH 4A3LG 3PSIA 1MKHA 4K0KQ 3HOXG 1YK4A 1YZ6A 2VZAA 2GMGA 3AQQA 1VQNA 1UE7A 4AI0A 5LMNW 2A6HD 1VQ9A 1VQJA 4POGA 1C0AA 1JT8A 3H3VH 4A3IH 4X66Q 2JA5G 2Q2HA 4DUYL 4IFDG 4X6AH 2ZJPA 5M3FH 4LNQA 2MS3A 4HJ9A 4A3CG 2UUCL 4LWCA 4LF8L 1Z9FA 1ODHA 4OO1I 1IL2A 1EIYB 3PZAA 2OTLA 3HOVH 4C2MH 3M4PA 1S72A 2ZJRA 1W3SA 4LF4Q 2V0EA 4GKKQ 1T9QA 1MJEA 2MFIA 1HR0W 2UUBL 1TWGH 3HOYH 4GNXB 3BZKA 2Y0SE 2ES2A 1A8VA 3K81C 1NNQA 1PH8A 4A4IA 4DV1L 5AJ3L 4KI0A 4DV4L 2I5MX 4K0KL 2B63G 3L2PA 1SROA 4AR6A 1E1TA 1FVIA 1E7ZA 2N78A 4YCWA 1R0HA 4OONA 1PYSB 4LHNA 3M9BA 4B8CD 4IO9A 4FDBA 1GKHA 4X66L 3GDEA 5JJIA 3P8BA 3HKZE 1X56A 3S2HH 2K14A 1KRTA 1BBWA 2VS1A 1HH2P 1IU6A 3PO3H 1DVBA 3HOZG 2IX0A 3FHWA 1YHQA 1B2OA 4ME3A 1BE7A 1YV1A 4LF4L 3NBHB 4AI1A 2PVXA 5IYBG 2ATWA 1XJVA 3F1ZA 2KCMA 1AE3A 2RF4A 1G6PA 4A3KG 1SN8A 1VQ5A 1B71A 1R9TH 4JI8L 5IP9G 4U671 5IY0A 2PI2A 2XJUA 4AHXA 1VQ6A 2Z6KC 3LPEB 2IX1A 3S2DH 3QQCE 4XXBB 4APVA 1HNZQ 1FJGL 2JA7G 4A3LH 3HOXH 3UE0A 3HKSA 2HT1A 5AN9H 4A3BG 2B29A 1XMOL 2AHOB 3MSUA 3JAMc 4BY1H 2JA5H 1PH9A 4AI3A 5MGNA 2MO1A 1UWVA 4A3CH 2RHSB 1L0WA 4LFAL 4JYAQ 2QA4A 4DR6Q 4BY7G 4YWLA 3M85A 2UXCQ 2E2IH 4QL5A 5M5YH 1XNRQ 3G6EA 4AHWA 3KLWA 3K80C 2D0OA 4DUZQ 2A1AA 3CCMA 3U50C 1TWAH 4R4QA 4JAGA 1Y1WG 1RL2A 1GD7A 4UY81 1LM0A 3H3VI 1VQAA 2V0FA 2XJTA 4TVMA 1S2ZA 4AIMA 3KDFB 3S15H 4HIOA 4GOPB 1JJCB 3I7FA 1VZHA 1N33L 2Q2IA 1PH2A 4A75A 1VQ7A 3RZOH 2B63H 3PIP1 3W5OA 5C3EG 1K8AC 3KYXA 3KJPA 4GLVB 4AR4A 2DGYA 4P73A 1JMCA 4R4OA 2UU9Q 2AYJA 3TS0A 4QJFA 1FHMA 2K50A 2HIXA 3WWLA 5JVG1 3J7ZC 1HJPA 4JI5L 1VZIA 4AQYQ 7RXNA 3JC66 4JYAL 4B3MQ 3HOZH 4DR6L 1IROA 3S1RH 3GO5A 1VQ4A 4LF9Q 2UXCL 5DLQE 5DM61 4JAEA 3FP9A 1XNRL 3NELA 3KYUA 4DUZL 4PZ8A 2CKCA 1PFSA 3J81j 5MLC3 4JBMA 4P72A 5GAHc 1B13A 5MF6A 1UEBA 1SMWA 4DV6Q 1N32L 3CQZH 3GTGH 3ICEA 3CCRA 1JYBA 2ZTCA 1X6OA 1QVFA 2NVYH 2VL6A 4OXPA 3GTJH 5IP9H 3CD6A 4HIMA 3HOVG 4WFN1 3CAMA 1N34Q 2C6BA 1JB7A 2R92H 3ERSX 3CCJA 1E24A 1YVCA 2JA7H 1L1OA 2KHJA 3J7Y1 4JI4Q 1LKPA 4O2DA 4A3BH 1G291 3ZG6A 3JAMi 2BA1A 1I50H 4JI7Q 1VS0A 3TQYA 4B3ML 3CC7A 3RZTA 5JEAG 2K52A 4ZN3B 2HR5A 4LF9L 3I2ZA 4DR3L 2E8GA 2CKAA 2HIVA 3SGIA 4JI0L 2M6OA 1TXYA 3HOUH 1L1OC 2NYDA 2JI1A 4JOIA 1M1KC 2YTVA 1T9HA 4PMWA 3M4QA 1YHBA 4P71A 1A0IA 1Y1WH 3PO3G 3JC63 2K5HA 4A76A 3CXCA 1N8RC 2K4KA 1R0IA 4NXNL 5FJ8H 4IFDI 2PQAA 1VQ8A 1HNWQ 2WFWA 4LF8Q 3TS2A 1CSQA 3F2DA 3PUZA 4JI4L 3WWNB 1E3PA 1H7VA 3PKJA 4RXNA 2H12A 3OYYA 1JE5A 1HZAA 5C0XI 1YHAA 2Q2TA 4JI7L 1VQEA 4JOIC 1CSPA 3S24A 2NN6I 2UUBQ 2ZIXA 3L7ZC 1PH6A 3G71A 2RCNA 4QY7A 2PSMC 2K2DA 3S1MH 4IPDA 1YK5A 5AJ3Q 5IYDH 4QIWE 4DV4Q 2DUDA 1B8AA 2LXKA 3RN5A 1YJNA 4GLAC 3A44A 3WWVA 2CR8A 1LYLA 3A74A 5AI2A 1WOCA 1YIJA 1XPUA 1IW7D 4L5RC 3DM3A 4BY1G 3CCEA 4GN3B 2B5ID 1W2BA 1SMUA 3K7AH 2ERSA 4PG3A 1OXXK 5GAEC 4HJ8A 1HNWL 2CQOA 5C44H 3I4MH 1I3QH 2KKDA 1YUXA 3A5UA 1GM5A 3ULPA 3M3YH 2PVEA 1IYJB 2F3IA 5C0XG 4L5TA 3TREA 2I5LX 2NN6G 4JG2A 3PO2H 4A3DH 2KENA 3NFPI 1QUQA 2Y0SG 4DV7Q 4PZ6A 5IYCG 1CKNA 1NMFA 2UXDQ 3STBD 3PUXA 4A93G 4IJLA 1RWDA 4JI8Q 1PHJA 5JJLA 4LFCQ 1FJGQ 5H1SE 4WJ4A 2CWPA 1J5EL 4AHZA 3EIVA 4AI2A 1XMOQ 1ZRPA 2PPTA 2H5XA 2FXQA 4GS3A 3CC2A 3A0JA 3I55A 2DSXA 5GQOA 3L0OA 5GAGc 4YWMA 2Z6KA 1C09A 1N9WA 2M4VA 3D31A 3MEFA 4C3JH 1E22A 1IBKQ 1SLJA 5DM71 1AE2A 3K0XA 1VQGA 3RN2A 4LFAQ 1CKOA 5IT9c 3KOJA 4A3EH 1BQ8A 2WAQE 4V196 1NJIC 3I56A 1UE1A 2K5VA 4DV7L 3M7NA 2KBNA 4JI1Q 3H0GG 5AI3A 4A3JG 1B2JA 2UXDL 1BBUA 1VQCA 4LUOA 1K83H 4X65Q 2VW9A 4LUZA 3LGJA 2EXDA 1EFWA 5JVH1 2MQHA 2VUMH 1PV4A 4LFCL 4BBSG 2VQEL 5GADC 3PWFA 2R92G 1LTLA 1YUZA 1WYDA 2JEBI 1WI5A 2QEXA 1LKMA 4NXML 1N33Q 4DR4L 2OQKA 3LNLA 2R7DA 1R0JA 3T1YQ 3EN2A 3NENA 1B70B 3J81c 3E9HA 4DV2Q 4GNXA 1BFYA 4OX9L 2RDVA 3RZDH 4A3GG 1NXGA 1RDGA 4LFBL 4YWKA 1IBKL 2A68D 2M4YA 1CKMA 5ELOA 4LUVA 4JI5Q 4YY3Q 4BXXH 4DKAC 4Y52H 3SS2A 3HOUG 3RZ6A 1SR3A 5GAGC 4JI1L 2JA8H 2NVXH 4OWTB 4X62Q 2ASBA 2XGTA 4X65L 1M90C 4GNXC 1IU5A 3F2BA 1YBYA 1S24A 1K9MC 3P2AA 3KFUA 4K9FA 1VQPA 5FJ8G 1N32Q 5IYCH 1EUJA 1XMQQ 1ASYA 1N36Q 3BJUA 1L1OB 4A93H 1VCIA 5EIOC 1PH5A 2UUAQ 4AYBG 3GTLH 3K35A 2WB1G 4DR7L 3T1YL 4DV2L 2JI2A 3GTOH 1OTCA 5IP7H 4GKJQ 2Z3QB 4JBWA 1E1OA 2MNAA 3TRZA 1VQMA 3RR5A 4GN5A 5FLMG 2JEAI 3PUWA 1WJVA 4HJ5A 4YY3L 2GVAA 4DV3L 3CCVA 4BA2I 5K36G 3S17H 5IYDG 3T1HL 3PUYA 3H15A 4A3MG 1R0GA 3RLFA 4DR3Q 1E8JA 2N8NA 2Z3RB 4X62L 3PIOA 4UP7A 3UDXA 4JI0Q 4DAYB 3CMEA 4ZN1B 1R0FA 4LW1A 4B3SL 4LF5Q 2ERJA 3H0GH 1XMQL 4A3JH 1N36L 2PI2E 1S3OA 4EQ5A 4C3HH 4HJ7A 4UP9A 3S14H 3S1NH 4GN4B 1X9NA 3UDIA 1PH4A 5C44G 3I4MG 2UUAL 3W1BA 4NXNQ 1VQOA 3ER0A 3E9IA 4BBSH 3B0AB 3ZJYC 4GKJL 4HIDA 2N3SA 4R1JA 4Y7NH 4IFDJ 3AFPA 1GVPA 3J81i 3PO2G 5BR8Q 4A3DG 1UE6A 4A3FH 4MZ9A 1X3EA 2M6PA 4A3GH 4DR1L 1NBWA 5M5XH 3KJOA 1XNQQ 5C0XJ 1C9OA 4KHPL 5HY6A 3KF6A 2UXBQ 1PA6A 3PUVA 5GAEc 1OXTA 8RXNA 1XTDA 4R4IA 4LF5L 5M3MH 2JI3A 4OWWB 1VQFA 3PF5A 2K75A 5IE8A 3RNUA 5IWAL 2ZTDA 1K3RA 1SE8A 1HZBA 2NVQH 2CWAA 2JA9A 1A62A 4JC0A 1SMXA 3JC62 3AYHB 2F52A 1NXEA 3G48A 2NZHA 4WJ3M 1QUQB 5BR8L 5J3BA 2ZTEA 4A3EG 1FL0A 1EQQA 4UP8A 3CCUA 1CKNB 4YHHQ 2AWNA 1MJCA 3TEHB 4DPGA 1KC8C 4MNOA 1PVOA 4DNIA 3UDGA 1XNQL 1YITA 5FLMH 2VUMG 4P74A 2LXJA 2A6ED 1P8LA 1CUKA 2UXBL 2XJPA 3GTMH 3HFZB 3CF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RMF A;  3CPF A;  3K80 C;  1Q82 C;  2D0O A;  4DUZ Q;  5LMN L;  4A3M H;  1VQL A;  2F4V Q;  4YWM A;  2QGQ A;  2A1A A;  1Q46 A;  3CCM A;  2Z6K A;  1K8G A;  4LF7 Q;  3KF8 B;  3U50 C;  4IPG A;  1C09 A;  1N9W A;  4POF A;  1TWA H;  1SMM A;  4R4Q A;  3J7A 5;  1Y1W G;  4IOA A;  1RL2 A;  1NMG A;  3D31 A;  3KDF A;  1GD7 A;  3MEF A;  4C3J H;  1PYB A;  1LM0 A;  4R4C A;  1VQA A;  1E22 A;  2MO0 A;  3H3V I;  1PH7 A;  1SLJ A;  1IBK Q;  4JI3 Q;  1AE2 A;  1S2Z A;  1IBM L;  4AIM A;  4GOP A;  4QGU A;  1IBL Q;  3HOW G;  3KDF B;  4HJA A;  2UU9 L;  3S15 H;  3K0X A;  3W1G A;  1VQG A;  4UY8 C;  3HOY G;  2YV5 A;  2D0P A;  4HIO A;  3ULL A;  3RN2 A;  4JI6 Q;  1J5E Q;  4LFA Q;  1LKO A;  4GOP B;  3U4V A;  1CKO A;  1JJC B;  3I7F A;  5IT9 c;  3KOJ A;  1DGS A;  2Q2U A;  1RDV A;  3AFQ A;  1N33 L;  2Q2I A;  4A3E H;  5C4J H;  4AQY L;  4C3I H;  1BQ8 A;  3BU2 A;  2WAQ E;  3STB C;  1EQR A;  4NPS A;  1PH2 A;  4A75 A;  1NJI C;  2D62 A;  3I56 A;  4DV5 Q;  1UE1 A;  2K5V A;  1VQH A;  4DV7 L;  2KBN A;  1VQ7 A;  2B63 H;  4JI1 Q;  3M7N A;  3RZO H;  2R93 H;  3H0G G;  5AI3 A;  4A3J G;  4BXX G;  2PNH A;  1B2J A;  3CMA A;  2UXD L;  1BBU A;  1VQC A;  4KHZ A;  3W5O A;  4LUO A;  5C3E G;  1K83 H;  1HNX L;  1K8A C;  4X65 Q;  1VQD A;  3CCL A;  4JI2 L;  2VW9 A;  3KYX A;  1UE5 A;  4OWX B;  3KJP A;  4GLV B;  4AR4 A;  4LUZ A;  3I4N H;  3LGJ A;  2DGY A;  2EXD A;  2L15 A;  3MXN B;  4YHH L;  3VDY A;  1EFW A;  3J80 c;  1HR0 L;  1YEZ A;  2KHI A;  1I94 Q;  1EWI A;  2VUM H;  2MQH A;  3OTO L;  3RLN A;  1X3G A;  1PV4 A;  1O7I A;  2HHH Q;  4LFC L;  5EAY A;  4P73 A;  2JA8 G;  1JMC A;  3Q8D A;  4R4O A;  2UU9 Q;  1OXS C;  2PMZ E;  4DR2 L;  2JQO A;  1AH9 A;  4BY7 H;  4BBS G;  3TS0 A;  4QJF A;  2VQE L;  5GAD C;  3PWF A;  2R92 G;  2IHF A;  1FHM A;  1TWC H;  2K50 A;  1Q8K A;  2EQS A;  1EOV A;  2HIX A;  4GOP C;  1LTL A;  1YUZ A;  3KYY A;  1WYD A;  2A19 A;  2JEB I;  4DV6 L;  4JCV E;  2C35 B;  1WI5 A;  1VQI A;  2OCE A;  2QEX A;  2I5H A;  1LKM A;  4AH6 A;  2ZM6 Q;  3J7Z C;  4NXM L;  1N33 Q;  1HJP A;  4JI5 L;  2I0Q A;  3U58 A;  4DR4 L;  4AQY Q;  7RXN A;  2YTY A;  3JC6 6;  2XTI A;  2OQK A;  1X55 A;  4JYA L;  2AWO A;  3F2C A;  4B3M Q;  3HOZ H;  4DR6 L;  1IRO A;  3G4S A;  2EIF A;  2PYA A;  4JBK A;  3PCO B;  3FKI H;  3S1R H;  4NB3 A;  3GO5 A;  3EBE A;  2R7D A;  1JJ2 A;  1WFQ A;  1R0J A;  1QYB A;  4DR5 Q;  3T1Y Q;  1VQ4 A;  3EN2 A;  3NEN A;  1RYT A;  1B70 B;  4DAM A;  1Y1V G;  3J81 c;  5DLQ E;  2JJQ A;  3E9H A;  1HNX Q;  4DV2 Q;  4LF9 Q;  4JV5 L;  3FP9 A;  4GNX A;  1A63 A;  1BFY A;  1KRS A;  3NEL A;  1XNR L;  5C4X H;  3KYU A;  1WCM G;  4OX9 L;  4BBR G;  2RDV A;  3HOW H;  3RZD H;  1J6Q A;  1Q86 C;  4A3G G;  4DUZ L;  4QQB X;  4BA1 I;  4DUY Q;  1KIX A;  2F4V L;  2VNU D;  1BKB A;  4PZ8 A;  4LF7 L;  1N34 L;  1RDG A;  4AR3 A;  1PFS A;  1OXU A;  1QVC A;  5RXN A;  5GAH C;  3J81 j;  3OTO Q;  2E2H H;  4LFB L;  2UUC Q;  4JBJ A;  4JBM A;  4P72 A;  1B13 A;  3CP0 A;  4KLK A;  3E0E A;  4YWK A;  2CFM A;  5HGQ A;  4DR2 Q;  2R6G A;  5ELN A;  1KAW A;  1UEB A;  1D7Q A;  2VQE Q;  3F8T A;  1IBK L;  1YNX A;  1SMW A;  1IBL L;  4J15 A;  2M4Y A;  5IP7 G;  1CKM A;  2K5N A;  4DV6 Q;  1N32 L;  3CQZ H;  5ELO A;  1OXV A;  3GTG H;  4NXM Q;  4LUV A;  4JI5 Q;  4YY3 Q;  1GO3 E;  4BXX H;  1D8L A;  4DR4 Q;  1DX8 A;  2BA0 A;  4H02 A;  4JI6 L;  4DKA C;  3ICE A;  2ID0 A;  4Y52 H;  5C3E H;  3SS2 A;  3CCR A;  2NVT H;  1JYB A;  2ZTC A;  3PV0 A;  5GRO A;  3HKZ G;  1Q81 C;  1QCV A;  1X6O A;  1Q12 A;  1QVF A;  3RZ6 A;  4O0A A;  3HOU G;  1KHI A;  2VL6 A;  1NY4 A;  2NVY H;  4OXP A;  1SR3 A;  3GTJ H;  5IP9 H;  4JI3 L;  4MTN A;  3CCS A;  4IOC A;  3CD6 A;  1EIF A;  4DV5 L;  3RLO A;  1TWH H;  5GAG C;  4HIM A;  4JV5 Q;  3PIP A;  4JI1 L;  3CPW A;  3HOV G;  4R4T A;  1XPR A;  4OX9 Q;  2JA8 H;  2E2J H;  3GTP H;  3CAM A;  3M4O H;  2NVX H;  1U5K A;  1HZ9 A;  1HZC A;  4OWT B;  4X62 Q;  2ASB A;  2XGT A;  4X65 L;  1N34 Q;  1M90 C;  3CCQ A;  1BVS A;  1IU5 A;  4GNX C;  1WJJ A;  1JB7 A;  2CCZ A;  2R92 H;  3F2B A;  4LFB Q;  1YBY A;  3ERS X;  1S24 A;  2UXC L;  3CCJ A;  1K9M C;  4TPU A;  1E24 A;  2BH8 A;  1B7Y B;  2V3B B;  1YVC A;  1I94 L;  3KFU A;  3U4Z A;  2JA7 H;  4K9F A;  1Q1B A;  4UPA A;  4DV1 Q;  1L1O A;  2KHJ A;  3PGZ A;  1VQP A;  2HHH L;  2YU9 H;  1X65 A;  5FLX c;  5FJ8 G;  4JI4 Q;  5JJK A;  1SRU A;  3GTK H;  1LKP A;  1N32 Q;  1IZ6 A;  4O2D A;  5IYC H;  1EUJ A;  1XMQ Q;  1ASY A;  3PSI A;  1MKH A;  1N36 Q;  3HOX G;  4A3B H;  2R7Z G;  4A3L G;  3BJU A;  4K0K Q;  4OO1 G;  1QZG A;  1G29 1;  1L1O B;  1YK4 A;  1YZ6 A;  1Y1V H;  3JAM i;  4A93 H;  1VCI A;  4DV0 Q;  2BA1 A;  1I50 H;  1PH5 A;  2VZA A;  2ZM6 L;  2GMG A;  3AQQ A;  1NE3 A;  4JI7 Q;  2UUA Q;  1VS0 A;  1VQN A;  5M5W H;  1UE7 A;  4AYB G;  2WAQ G;  1XPO A;  5LMN W;  2JA6 G;  3TQY A;  1IXR A;  3CC7 A;  2WB1 G;  4B3M L;  3GTL H;  1S40 A;  3RZT A;  1VQ9 A;  2IT1 A;  5JEA G;  1VQJ A;  2K52 A;  4GKK L;  4POG A;  4DR7 L;  1C0A A;  1JT8 A;  4DR5 L;  2HR5 A;  3T1Y L;  3I4O A;  4LF9 L;  1PH1 A;  3H3V H;  4A3I H;  3I2Z A;  4DV2 L;  2E5L Q;  4DR3 L;  3GTO H;  2JE6 I;  1OTC A;  2E8G A;  4X66 Q;  5IP7 H;  2JA5 G;  2Q2H A;  4GKJ Q;  4DUY L;  4IFD G;  4X6A H;  2ZJP A;  5M3F H;  3S16 H;  1KL9 A;  1U0L A;  4LNQ A;  2MS3 A;  4HJ9 A;  2HIV A;  4JBW A;  4A3C G;  1E1O A;  1V1Q A;  1V43 A;  4P75 A;  2MNA A;  3TRZ A;  1VQM A;  2VQF Q;  2UUC L;  3RR5 A;  4GN5 A;  1K73 C;  4IJH A;  5FLM G;  4LWC A;  4LF8 L;  1S30 A;  3SGI A;  4JI0 L;  1Z9F A;  1TXY A;  2OQ0 A;  4RG1 A;  3HOU H;  1VCX A;  2JEA I;  4OO1 I;  1L1O C;  3PUW A;  1IL2 A;  1EIY B;  3PZA A;  3DLL A;  2OTL A;  4HJ5 A;  2RHQ B;  2KCT A;  3HOV H;  4C2M H;  4YY3 L;  2GVA A;  4DV3 L;  3CCV A;  3M4P A;  1S72 A;  4BA2 I;  5K36 G;  2ZJR A;  3S17 H;  4JOI A;  5IYD G;  3T1H L;  1W3S A;  2YTV A;  1M1K C;  4DK3 C;  4LF4 Q;  3S1Q H;  1T9H A;  4PMW A;  3M4Q A;  1YHB A;  3PUY A;  2KN9 A;  4P71 A;  3H15 A;  4DR7 Q;  4GKK Q;  1A0I A;  1T9Q A;  4A3M G;  1Y1W H;  3BZC A;  3PO3 G;  1Z47 A;  1SFO H;  4B3T Q;  1MJE A;  3JC6 3;  2K5H A;  4A76 A;  1R0G A;  2MFI A;  3RLF A;  3CXC A;  1HR0 W;  4DR3 Q;  4A3F G;  2K4K A;  1N8R C;  3PF4 A;  1R0I A;  1E8J A;  2N8N A;  1IRN A;  4TQU S;  4NXN L;  5FJ8 H;  2UUB L;  1TWG H;  4IFD I;  4X62 L;  1G51 A;  3HOY H;  4X64 Q;  3PIO A;  4EX5 A;  4GNX B;  3RYG A;  4HIK A;  3BZK A;  1V9P A;  2LSS A;  4UP7 A;  1VQK A;  2Y0S E;  2PQA A;  1VQ8 A;  1HNW Q;  2ES2 A;  1A8V A;  3K81 C;  2WFW A;  1LUZ A;  1NNQ A;  1PH8 A;  4LF8 Q;  3UDX A;  4JI0 Q;  4DAY B;  3CME A;  4A4I A;  4DV1 L;  1R0F A;  1CSQ A;  5AJ3 L;  3K8A A;  4KI0 A;  3TS2 A;  4LW1 A;  3F2D A;  4B3S L;  4LF5 Q;  3PUZ A;  1KXL A;  4JI4 L;  4DV4 L;  3H0G H;  1XMQ L;  1E3P A;  1H7V A;  2I5M X;  4A3J H;  2PI2 E;  1S3O A;  4DV3 Q;  4GLX A;  1N36 L;  4K0K L;  4EQ5 A;  4RXN A;  4C3H H;  3OYY A;  4HJ7 A;  1JE5 A;  4UP9 A;  1HZA A;  3J80 i;  4DV0 L;  3T1H Q;  2B63 G;  2R93 G;  3S14 H;  3S1N H;  4GN4 B;  2BH2 A;  1JJG A;  3L2P A;  1X9N A;  5C0X I;  1SRO A;  1YHA A;  4AR6 A;  3UDI A;  1PH4 A;  1PH3 A;  3QVD A;  1E1T A;  1FVI A;  5C44 G;  2Q2T A;  1E7Z A;  2N78 A;  4JI7 L;  2UUA L;  4YCW A;  2AKW B;  3I4M G;  3IRB A;  1VQE A;  1R0H A;  4JOI C;  2R7F A;  4OON A;  1CSP A;  4PZ7 A;  1PYS B;  5M3M G;  3S24 A;  3M9B A;  3W1B A;  4NXN Q;  2NN6 I;  5LMU Q;  4IO9 A;  2UUB Q;  1VQO A;  5JEA J;  2JK8 A;  1GKH A;  2VY3 A;  3ER0 A;  3L7Z C;  4FDB A;  3E9I A;  4IPH A;  1PH6 A;  2E5L L;  4ALP A;  3G71 A;  2RCN A;  4BBS H;  1VQB A;  4X66 L;  3GDE A;  5JJI A;  3ZJY C;  4GKJ L;  3HKZ E;  1X56 A;  4HID A;  3S2H H;  4QY7 A;  2N3S A;  1KQS A;  2K2D A;  4R1J A;  4L5Q A;  4Y7N H;  2K14 A;  2ZJQ A;  3KYW A;  1KRT A;  3S1M H;  4YCU A;  1BBW A;  4IFD J;  4IPD A;  1YK5 A;  3ULJ A;  5AJ3 Q;  3AFP A;  1GVP A;  3J81 i;  4B3S Q;  2VQF L;  3PO2 G;  2VS1 A;  5BR8 Q;  1HH2 P;  2NZO A;  5IYD H;  4A3D G;  1UE6 A;  4QIW E;  4DV4 Q;  2DUD A;  3A5Z B;  1QVG A;  1B8A A;  1IU6 A;  3PO3 H;  3OW2 A;  1DVB A;  3HOZ G;  2LXK A;  3FKI G;  3RN5 A;  1YJN A;  4GLA C;  2IX0 A;  3FHW A;  4MZ9 A;  1WCM H;  1X3E A;  4A3F H;  1YHQ A;  4BBR H;  3D0F A;  1B2O A;  3A44 A;  3WWV A;  1BQ9 A;  4A3G H;  4ME3 A;  1LYL A;  1BE7 A;  4DR1 L;  2A8V A;  1YV1 A;  4LF4 L;  2B3G A;  5AI2 A;  1WOC A;  3A74 A;  1NBW A;  1YIJ A;  5C4X G;  5M5X H;  1XPU A;  3NBH B;  3KJO A;  4L5R C;  6RXN A;  1XNQ Q;  2PVX A;  5C0X J;  5IYB G;  3DM3 A;  4BY1 G;  4LF6 Q;  2ATW A;  4B3T L;  1C9O A;  4KHP L;  2IY5 B;  2Z0S A;  1XJV A;  3CCE A;  3F1Z A;  1HNZ L;  2KCM A;  4GN3 B;  5HY6 A;  2IHE A;  1W2B A;  3KF6 A;  1CAD A;  2N49 A;  2UXB Q;  1AE3 A;  4X64 L;  1SMU A;  1X3F A;  2RF4 A;  3K7A H;  2AMC B;  4AYB E;  1P16 A;  2GVB A;  1PA6 A;  4PG3 A;  2WB1 E;  1OXX K;  3PUV A;  1K0R A;  5GAE C;  4HJ8 A;  4A3K G;  3KF6 B;  1YI2 A;  1HNW L;  1G6P A;  3GTQ H;  4XTC S;  1SN8 A;  2CQO A;  5C44 H;  5LMN Q;  1OXT A;  3I4M H;  1I6H H;  1I3Q H;  1VQ5 A;  1B71 A;  8RXN A;  1XTD A;  4R4I A;  2KKD A;  4LF5 L;  3UE1 A;  1YUX A;  3A5U A;  2OWO A;  1R9T H;  1FHH A;  4JI8 L;  2ALY B;  5M3M H;  3CC4 A;  5IP9 G;  1RIP A;  2V1C C;  1GM5 A;  5IY0 A;  3ULP A;  2PVE A;  2PI2 A;  4OWW B;  1EYG A;  3M3Y H;  4DR1 Q;  1IYJ B;  1VQF A;  2Z6K C;  1VQ6 A;  2F3I A;  3PF5 A;  3NEM A;  5C0X G;  1IBM Q;  2K75 A;  1NTG A;  3UDF A;  2IX1 A;  5IE8 A;  3S2D H;  3RNU A;  5IWA L;  2GN5 A;  3B6Y A;  3MPS A;  4L5T A;  2ZTD A;  1K3R A;  4KHP Q;  1BRF A;  1SE8 A;  4APV A;  3TRE A;  1HZB A;  1HNZ Q;  2I5L X;  2NVQ H;  2CWA A;  2NN6 G;  4JG2 A;  3PO2 H;  1FJG L;  2QL0 A;  2HQL A;  5E7N A;  5LMU L;  4DK6 C;  2KEN A;  4A3D H;  1Q7Y C;  3CW2 C;  2JA9 A;  2JA7 G;  4A3L H;  1A62 A;  2LCQ A;  3HOX H;  3UE0 A;  2R7Z H;  4JC0 A;  1SMX A;  4XIG S;  3JC6 2;  1I5F A;  3HKS A;  1QUQ A;  3AYH B;  2Y0S G;  2HT1 A;  4DV7 Q;  4L5S A;  4PZ6 A;  2YYZ A;  5IYC G;  4A3B G;  2F52 A;  2B29 A;  4AR5 A;  3G48 A;  1XMO L;  1CKN A;  1NMF A;  1QZH A;  2UXD Q;  3STB D;  3PUX A;  1CAA A;  4A93 G;  1X54 A;  1T9P A;  2AHO B;  4IJL A;  2NZH A;  4WJ3 M;  1QUQ B;  1Y14 B;  2PQA B;  5J3B A;  5BR8 L;  4JI2 Q;  3K7U C;  2JA6 H;  2ZTE A;  2OTJ A;  4A3E G;  1FL0 A;  1EQQ A;  1RWD A;  4JI8 Q;  4UP8 A;  1T9O A;  1CKN B;  3CCU A;  4YHH Q;  1YJ9 A;  5IYB H;  4TVA B;  3JAM c;  1HR0 Q;  1PHJ A;  4BY1 H;  2AWN A;  1MJC A;  5JJL A;  1L2F A;  1ASZ A;  4LFC Q;  3TEH B;  4DPG A;  5IWA Q;  1KC8 C;  2JA5 H;  1C7Y A;  1H95 A;  2CKZ B;  4A3I G;  4MNO A;  1YJW A;  1PVO A;  1PH9 A;  1FGU A;  2MO1 A;  1UWV A;  2YTX A;  4A3C H;  4B3R Q;  3I4N G;  4DNI A;  3UDG A;  1FJG Q;  1XNQ L;  5M3F G;  2RHS B;  1YIT A;  5H1S E;  4A3K H;  4LF6 L;  5FLM H;  2VUM G;  1L0W A;  4WJ4 A;  2CWP A;  4P74 A;  1J5E L;  2LXJ A;  4LFA L;  3KYV A;  4JYA Q;  1Q1E A;  3KYH C;  2QA4 A;  4DR6 Q;  4B3R L;  1RB9 A;  1P8L A;  3GD7 A;  1CUK A;  1KD1 C;  3EIV A;  4BY7 G;  4YWL A;  4YCV A;  1TWF H;  1XMO Q;  2UXB L;  1ZRP A;  3M85 A;  2H5X A;  3AEV A;  2FXQ A;  4GS3 A;  2UXC Q;  1MIU A;  2E2I H;  3CC2 A;  4QL5 A;  5M5Y H;  3A0J A;  3GTM H;  3I55 A;  2DSX A;  2WP8 J;  4IPC A;  3HFZ B;  5GQO A;  3G6E A;  3CF5 A;  3L0O A;  1XNR Q;  3KLW A; 
#chains in the Genus database with same CATH topology
 1D5M C;  4A3M H;  1JOQ A;  1VQL A;  1NUC A;  4LMQ D;  4DK0 A;  4AYB B;  4PQX A;  2F0G A;  1Q90 A;  3DXJ C;  2WB1 B;  3J7A 5;  4IOA A;  1P7P A;  1NMG A;  1YNJ D;  4IUV A;  2N55 A;  2K6A A;  2MO0 A;  1PH7 A;  2B2T A;  1PFU A;  1E2Z A;  2XSC A;  2BCO A;  4DN4 M;  4HJA A;  2AUK A;  3VYR A;  4UY8 C;  5J39 A;  2YV5 A;  2D0P A;  1WTO A;  2J9U B;  3ULL A;  1J5E Q;  1PZK D;  5D65 A;  1A2T A;  3TBI B;  1DGS A;  1QNU A;  1RDV A;  1KDB A;  3AFQ A;  3OMC A;  2HCC A;  4MTK A;  5C4J H;  4IUR A;  1IKM A;  4JI3 Q;  3BU2 A;  3DEO A;  2D62 A;  4DV5 Q;  1VQH A;  4UHV A;  4BXX G;  2PNH A;  2WIN B;  3CMA A;  1DON A;  3QG1 A;  3MXN A;  1GUO A;  2HCI A;  3S1M B;  1A6X A;  4KHZ A;  1HNX L;  1VQD A;  3GTM B;  1PRT C;  3IL8 A;  1UE5 A;  3I4N H;  4IUQ A;  5CV8 A;  4A3M B;  4YHH L;  3VDY A;  3J80 c;  3MHB A;  1YEZ A;  1I94 Q;  1EWI A;  3OTO L;  3RLN A;  1X3G A;  3WOF A;  2E2I L;  2A68 C;  2HHH Q;  2JA8 G;  5EJW A;  3Q8D A;  1OXS C;  3DMU A;  2OT2 A;  4DR2 L;  1HUM A;  2JQO A;  1AH9 A;  3J7Z 1;  1AZP A;  3BG3 A;  2IHF A;  1TWC H;  1EOV A;  2A19 A;  5GAD c;  2X69 A;  2OCE A;  5AFW A;  2QEJ C;  1WCM L;  4AH6 A;  2ZM6 Q;  4BBR L;  1TS2 A;  1ZYR C;  5EPJ A;  2DJF C;  3A55 A;  3U58 A;  1ZEQ X;  2I0Q A;  4FYD A;  1HUN A;  2XTI A;  3LWR B;  2PYA A;  4JBK A;  3PCO B;  5COR A;  3KBG A;  2P5Z X;  3EBE A;  1JJ2 A;  1WFQ A;  4DR5 Q;  1QYB A;  3FDJ A;  1EQV A;  3K7A B;  5C4J B;  1RYT A;  3MVV A;  1D5Z C;  4DAM A;  2JJQ A;  4JV5 L;  1IYU A;  2WII B;  3EQL C;  1A63 A;  1WCM G;  2FMC A;  4BBR G;  3HOW H;  1XXG A;  1Q86 C;  5C44 B;  4BA1 I;  3I4M B;  1I3Q B;  1QOH A;  1BKB A;  4QCL A;  3T56 B;  4AR3 A;  1QVC A;  2E2H H;  5RXN A;  4X3T A;  4ZYS A;  3GTQ L;  3E0E A;  2CFM A;  5HGQ A;  3M3Y B;  5ELN A;  2JP1 A;  1KAW A;  1D7Q A;  2VQE Q;  3F8T A;  3QO2 A;  1I6H L;  4N8F A;  3B08 B;  4ZUJ A;  2M2L A;  5IP7 G;  1L0Y B;  2K5N A;  1NSN S;  1OXV A;  4NXM Q;  1BUV T;  1GO3 E;  4Q5V A;  4DR4 Q;  3K5L A;  3LX0 A;  1RKN A;  3PO2 B;  5CV9 A;  1SNC A;  1Q81 C;  5EGT A;  5GRO A;  3HKZ G;  4A3D B;  4O0A A;  1KHI A;  4JI3 L;  4MTN A;  5MFZ A;  2FMM A;  4RGO S;  4IOC A;  1ET9 A;  1EIF A;  4DV5 L;  3RLO A;  1TWH H;  4CBV A;  1PDQ A;  4R4T A;  1XPR A;  2PMZ P;  3DUZ A;  4OX9 Q;  3GTP H;  3M4O H;  1HZ9 A;  1HZC A;  2CCZ A;  2C6A A;  4LFB Q;  2R7Z L;  1GUT A;  3PIO 1;  4N8X 1;  3KBX A;  4PMB A;  2BH8 A;  1B7Y B;  2V3B B;  2C9O A;  2N88 A;  3RUZ A;  3U4Z A;  4OEL B;  1I94 L;  3C3L A;  1Q1B A;  4UPA A;  2YU9 H;  3PGZ A;  2HHH L;  1X65 A;  5FLX c;  5JJK A;  2RDH A;  3E3X A;  1IZ6 A;  1ENC A;  4ODG A;  1EL0 A;  4K6D A;  5KNB A;  2R7Z G;  4CDF C;  5IYB L;  1S4Z A;  4OO1 G;  1QZG A;  1Y1V H;  2B39 A;  4DV0 Q;  3V96 A;  1LT5 D;  2F03 A;  2ZM6 L;  2JSO A;  2PMZ B;  1NE3 A;  1KDC A;  2F0E A;  3K0Y A;  5M5W H;  2WAQ G;  1XPO A;  1QQT A;  3ND9 A;  2JA6 G;  1IXR A;  1S40 A;  1EFI D;  2IT1 A;  4GKK L;  1RJT A;  4DR5 L;  4M1U B;  4C3H G;  4A3K L;  3I4O A;  4P2C B;  1B53 A;  3HGB A;  1PH1 A;  2Q8R E;  2E5L Q;  2JE6 I;  3SK6 A;  5K2M E;  1VDZ A;  4AHY A;  3S16 H;  1KL9 A;  1TWF L;  3VA5 A;  1U0L A;  3GTJ L;  4K8I A;  1V1Q A;  1V43 A;  2EY5 A;  4P75 A;  2VQF Q;  5EQ0 A;  3HRZ C;  1K73 C;  4IJH A;  1S30 A;  2A5H A;  2R61 A;  2OQ0 A;  2CHB D;  4RG1 A;  1VCX A;  4LK1 C;  2VB3 X;  3DLL A;  2RHQ B;  2KCT A;  1JQY D;  4WOR A;  4RGT A;  3S1Q H;  4DK3 C;  3QOL A;  5FO7 B;  5IGE A;  3U9O A;  2KN9 A;  4A3E B;  4DR7 Q;  3R3O A;  2FIN B;  3CRK C;  3BZC A;  1LTI D;  1Z47 A;  1SFO H;  2RVL A;  1G2S A;  1PTO F;  4B3T Q;  4CKC A;  3BDO A;  3TP5 A;  4A3F G;  3PF4 A;  2DJG C;  3JR7 A;  5I9P A;  1OWB A;  2G5D A;  5MFP A;  5HGT A;  3Q22 A;  1IRN A;  4TQU S;  2QF7 A;  1G51 A;  1DOM A;  4X64 Q;  4EX5 A;  3RYG A;  4C3I L;  4HIK A;  1V9P A;  4KY5 A;  2LSS A;  1VQK A;  3E5S A;  3OWE B;  1EZ8 A;  4H7B A;  1LUZ A;  3SK5 A;  1Z92 B;  2VUM B;  3VR3 A;  3K8A A;  2L0Z A;  1KXL A;  4K5V A;  4C3I G;  4DV3 Q;  1CHQ D;  2KVM A;  4LHL A;  2F0F A;  3T1H Q;  1AW7 A;  3J80 i;  3CKI B;  4DV0 L;  1JJG A;  2R93 G;  2BE5 D;  2BH2 A;  3QR8 A;  1PH3 A;  3QVD A;  3BZD B;  2RFK B;  3K58 A;  1K0S A;  2AKW B;  3IRB A;  1F9P A;  4CKB A;  4BY7 L;  2Z8L A;  3S1Q B;  2R7F A;  1SDF A;  4PZ7 A;  5M3M G;  2NBF A;  1CA5 A;  3IU3 I;  5LMU Q;  3M4Y A;  1SFO B;  1ICW A;  4IUP A;  5JEA J;  1LTA D;  4B9W A;  4EGV A;  2JK8 A;  4IPH A;  2VY3 A;  3H3V C;  3MXP A;  2E5L L;  3MWY W;  2CH4 A;  4ALP A;  2Z1C A;  1VQB A;  3FKI L;  3LWU A;  1KQS A;  4L5Q A;  2ZJQ A;  5DAU A;  3KYW A;  4YCU A;  3ULJ A;  3SE0 A;  4B3S Q;  2VQF L;  4KN7 C;  2NZO A;  5C4X L;  4U67 3;  3J80 L;  3HAX C;  3D6W A;  3A5Z B;  1QVG A;  2O5J D;  3OW2 A;  5E4W C;  3FKI G;  2A69 D;  1WCM H;  4BBR H;  3D0F A;  2L9H A;  1BQ9 A;  2A8V A;  2B3G A;  2Y0S P;  5C4X G;  4JW0 A;  3NWT A;  3VPB E;  6RXN A;  4C56 C;  1G6Z A;  3BVM A;  4LF6 Q;  1KAB A;  1C48 A;  4B3T L;  4R9W A;  5KRU A;  2IY5 B;  5EBC A;  2Z0S A;  2K03 A;  5C3E L;  1HNZ L;  5C4Z A;  2NVT L;  2JA8 B;  2IHE A;  3W3A A;  2NVX B;  1CAD A;  3Q6S A;  2N49 A;  3NTI A;  4X64 L;  1X3F A;  4FF3 A;  2AMC B;  4AYB E;  2HD3 A;  1P16 A;  2GVB A;  2WB1 E;  3EFX D;  1K0R A;  1YI2 A;  1RYQ A;  3KF6 B;  3GTQ H;  4XTC S;  4JAD A;  2E2J L;  1F9Q A;  1PTO B;  3FMC A;  5LMN Q;  1I6H H;  4XGH A;  2BDN A;  5EIN C;  3UE1 A;  2Y0S B;  2OWO A;  1FHH A;  4HCS A;  2ALY B;  3CC4 A;  2XWJ B;  1RIP A;  2V1C C;  1EYG A;  1FGB D;  4DR1 Q;  4A93 B;  4J6H A;  1X32 A;  3NEM A;  1IBM Q;  1NTG A;  3UDF A;  4ZUI A;  1GJX A;  3KUP A;  2GN5 A;  3GTK L;  3B6Y A;  3MPS A;  3KLS A;  5LHY 1;  3GTL B;  4KHP Q;  1BRF A;  2A6E C;  3AU7 A;  3R8B A;  2QL0 A;  2HQL A;  1STE A;  5E7N A;  4DK6 C;  5LMU L;  1Q7Y C;  3CW2 C;  2F0D A;  4BWG B;  2LCQ A;  2R7Z H;  4RWS C;  4XIG S;  1I5F A;  1STH A;  1O80 A;  4L5S A;  4DF7 A;  2YYZ A;  1W6K A;  2F0V A;  1NAP A;  3WDN A;  4AR5 A;  5IGB A;  1QZH A;  4FXD A;  1NR2 A;  1CAA A;  2IX3 A;  1X54 A;  1T9P A;  1Y14 B;  2PQA B;  3FRP B;  2JA6 H;  4JI2 Q;  3K7U C;  2OTJ A;  1S5D D;  3HKZ B;  1T9O A;  1RCV D;  4IAL A;  3HP3 A;  3NQI A;  5M3F L;  1PXU A;  2F4I A;  2XJV A;  1R4Q B;  4TVA B;  5IYB H;  1YJ9 A;  4TRD A;  1HR0 Q;  5A2Q L;  1L2F A;  4KY6 A;  1ASZ A;  1O78 A;  2XJS A;  4JAF A;  5IWA Q;  1C7Y A;  1H95 A;  2CKZ B;  4A3I G;  3S17 B;  1YJW A;  1GHK A;  1EZ6 A;  3K6O A;  1FGU A;  2KQ3 A;  2YTX A;  4B3R Q;  3I4N G;  2XJR A;  5M3F G;  4LF6 L;  4A3K H;  1STB A;  3HOV L;  4G7H C;  3SDZ A;  3PIP 3;  3KYV A;  1Q1E A;  3ERQ A;  3KYH C;  3R2I A;  1RB9 A;  3GD7 A;  1VZG A;  1XYI A;  1KD1 C;  4YCV A;  1TWF H;  3O13 A;  5TSS A;  2R7Z B;  3AEV A;  4GS7 D;  1MIU A;  2K1B A;  5H1S c;  2WP8 J;  4IPC A;  3IFT A;  4K5W A;  4RMF A;  3CPF A;  1Q82 C;  2LFN A;  5LMN L;  3ITP A;  1TWG L;  3SVM A;  2F4V Q;  2QGQ A;  1Q46 A;  1K8G A;  4LF7 Q;  3KF8 B;  4IPG A;  2JA6 B;  4POF A;  1SMM A;  3H0G B;  5ELF A;  3KDF A;  5CBE E;  4A3J B;  2SEB D;  3P20 A;  4C3H B;  1PYB A;  4R4C A;  1LT4 D;  5IOD A;  4RH6 A;  1V1P B;  4OHJ A;  5JVG 3;  3S14 B;  2H1E A;  1IBL Q;  1IBM L;  4HTH A;  4GOP A;  4QGU A;  3S1N B;  3HOW G;  2RSN A;  2UU9 L;  4OIJ A;  3W1G A;  3HOY G;  4JI6 Q;  1LKO A;  1TS3 A;  3A56 A;  3U4V A;  1HA6 A;  2Q2U A;  2JYO A;  1LO5 D;  3NXW A;  1G91 A;  5DM6 3;  4AQY L;  2SDF A;  1OWC A;  5CV6 A;  3R93 A;  4C3I H;  3STB C;  1EQR A;  2Z4H A;  4NPS A;  2R93 H;  3D3R A;  1U4P A;  4Y7N B;  3TSS A;  1SYG A;  3PMF A;  4IN3 A;  3CCL A;  4JI2 L;  4F7X A;  1JIC A;  2WV6 D;  4OWX B;  2B2U A;  2L15 A;  3S2H L;  3MXN B;  1S5E D;  3CU7 A;  1HR0 L;  2KHI A;  3TZU A;  3I8Z A;  1U4R A;  3NPP A;  1O7I A;  3PKI A;  5EAY A;  4A3F B;  2PO4 A;  3H94 A;  2PMZ E;  1BCP D;  4KD4 A;  4NDX A;  4BY7 H;  1HCZ A;  3PO3 L;  1Q8K A;  1SNO A;  2EQS A;  4J1M A;  4GOP C;  4GLX A;  5M5X B;  3KYY A;  4B3R L;  3J81 E;  1F9S A;  4J8Q A;  2C35 B;  4JCV E;  3SK4 A;  1VQI A;  4DV6 L;  2I5H A;  3HS0 C;  3ERO A;  2YTY A;  3FPU B;  4C3J L;  1GOZ A;  1X55 A;  3OSO A;  2AWO A;  3F2C A;  5EKK A;  3JAM E;  3G4S A;  4WFN 3;  2EIF A;  2LY7 A;  3FKI H;  4NB3 A;  5C5L A;  2E2D C;  1Y1V G;  3SEB A;  1HNX Q;  1KRS A;  5C4X H;  3OIP A;  3K57 A;  2R93 B;  3H09 A;  2E76 C;  1J6Q A;  4QQB X;  3SXH A;  3TP6 A;  2F0O A;  4DUY Q;  1KIX A;  2F4V L;  3I4L A;  4KK7 A;  2VNU D;  1J8I A;  4LF7 L;  1A3T A;  1N34 L;  4NW2 A;  3V05 A;  1OXU A;  5GAH C;  3OTO Q;  3PQI A;  2B2U C;  2UUC Q;  5M3M B;  4JBJ A;  3CP0 A;  4KLK A;  4DR2 Q;  1X3Q A;  2R6G A;  3NSW A;  1DXM A;  3OIQ A;  1YNX A;  3DM1 A;  4CJ1 B;  3MFY A;  5KNC A;  1IBL L;  4J15 A;  1K83 L;  1HQM C;  1R9T L;  1CI3 M;  3C1E A;  2FJ2 A;  4E6Y A;  2FHT A;  3NE5 B;  1D8L A;  1DX8 A;  2BA0 A;  4H02 A;  4JI6 L;  3IFD A;  2ID0 A;  3F2U A;  5C3E H;  2NVQ B;  2NVT H;  3PV0 A;  3S2D L;  1QCV A;  3D4D A;  1Q12 A;  1EEF D;  1NY4 A;  3CCS A;  1FNW A;  4JV5 Q;  2EPB A;  2KHS A;  3PIP A;  3CPW A;  3I73 A;  3VR6 A;  2E2J H;  2NZ1 D;  1BDO A;  1U5K A;  3VR5 A;  3P7J A;  4G6B A;  4A3L L;  3HOX L;  1BVS A;  3CCQ A;  1WJJ A;  4HED A;  1EIH A;  1EWH A;  2XJQ A;  1WTV A;  4TPU A;  1AN8 A;  3ZYY X;  5F2D A;  4DV1 Q;  3MA2 B;  1SRU A;  3GTK H;  3RZD L;  4A3L G;  3PSI A;  1MKH A;  4K0K Q;  3HOX G;  1V1O A;  4BY1 L;  1YK4 A;  1YZ6 A;  2XNA C;  2EY4 E;  1QE6 A;  2VZA A;  3AMU A;  2GMG A;  2EYO A;  3AQQ A;  3SK8 A;  2JA5 L;  5BN3 A;  1VQN A;  1RD9 D;  1UE7 A;  4KKU A;  4AI0 A;  2D2C C;  2IW3 A;  5LMN W;  4KKS A;  2A6H D;  4TSS A;  3C1F A;  1HQR D;  4A3C L;  2MUY A;  1VQ9 A;  1VQJ A;  4POG A;  2CH4 W;  1C0A A;  1JT8 A;  2ZXR A;  3DWA A;  3H3V H;  4A3I H;  1EU3 A;  1D1K A;  1F9R A;  4L8J A;  1LT3 D;  4X66 Q;  2L11 A;  2JA5 G;  2Q2H A;  4EQO A;  1DCZ A;  4DUY L;  4IFD G;  4X6A H;  2ZJP A;  5M3F H;  1WTP A;  3C2P A;  2MS3 A;  2M9V A;  2VXW A;  2JN4 A;  4HJ9 A;  4LNQ A;  4A3C G;  3C46 A;  5M5Y L;  2UUC L;  4B9X A;  4LWC A;  4LF8 L;  1Z9F A;  5JAV A;  1ODH A;  4OO1 I;  1QJO A;  4RCO A;  1EYC A;  1QB5 D;  3P75 A;  1EIY B;  3PZA A;  1IL2 A;  2BE5 C;  1TWA L;  1F2Z A;  2OTL A;  3HOV H;  4C2M H;  2A74 C;  1RF2 D;  3M4P A;  1S72 A;  2F1M A;  2DY7 A;  2K5Q A;  4H0L C;  2ZJR A;  1W3S A;  3TZD A;  4LF4 Q;  1HFN A;  3X3N A;  2V0E A;  3MQK B;  3FPP A;  4GKK Q;  5C6A A;  3HJW B;  1T9Q A;  1EY8 A;  3S15 L;  4KHV A;  1GHJ A;  1MJE A;  3FEW X;  1E2V A;  2NYZ D;  4OEM B;  2MFI A;  4BS9 A;  1U4M A;  1HR0 W;  2I46 A;  1ROD A;  3HZX A;  1SYB A;  2UUB L;  3Q23 A;  2ZXO A;  1TWG H;  4RKL A;  1BBX C;  3HOY H;  4A3I B;  1PZJ D;  4GNX B;  3BZK A;  4ZKB B;  2NB0 A;  4DA2 A;  2Y0S E;  2EJG C;  3BS1 A;  3I4N B;  3RZO L;  2B63 L;  2F0U A;  1A8V A;  3K81 C;  1PLF A;  4H44 C;  2ES2 A;  5G3L F;  1NNQ A;  1PH8 A;  4CKE A;  2O5J C;  4A4I A;  4DV1 L;  5AJ3 L;  4KI0 A;  2PW5 A;  1BR9 A;  4PV1 C;  1D2B A;  1K28 A;  4DV4 L;  5JEA H;  2A69 C;  2I5M X;  4K0K L;  1KNA A;  1PYW D;  3I90 A;  1TWC B;  4QB4 A;  5CV5 A;  4WRD A;  5IOC A;  2B63 G;  3EVQ A;  3L2P A;  1I4Q A;  1SRO A;  4AR6 A;  1E1T A;  1FVI A;  1E7Z A;  2N78 A;  4YCW A;  4R8I A;  1R0H A;  4OON A;  2DNE A;  3LWO B;  1PYS B;  3AB9 A;  4HSV A;  4LHN A;  3M9B A;  3D4R A;  4B8C D;  4IO9 A;  2F0K A;  3K5M A;  4FDB A;  1F2Y A;  1GKH A;  1U4L A;  1GXD C;  1PFV A;  1KLU D;  3GDE A;  4X66 L;  1STY A;  5JJI A;  3HOZ L;  3HOW B;  3P8B A;  1STN A;  2E75 C;  3HKZ E;  1X56 A;  3S2H H;  3S1R L;  2PZW A;  1ONL A;  3ONA B;  5JPM C;  3HOY B;  5EPK A;  2K14 A;  2MHV A;  1KRT A;  2E2H B;  1BBW A;  1JB3 A;  1RTO A;  2ENB A;  1GUW A;  2VS1 A;  1HH2 P;  2L0C A;  3URY A;  1PTO D;  2X6G A;  3VR2 A;  1IU6 A;  3PO3 H;  1QNK A;  4Q0F A;  1DVB A;  3HOZ G;  2PZT A;  2K28 A;  3MXU A;  2IX0 A;  3FHW A;  1YHQ A;  1CZG A;  1B2O A;  1VMC A;  2LS0 1;  2KED A;  4ME3 A;  1BE7 A;  1YV1 A;  4LF4 L;  4ZCK A;  2WKC A;  4Z9C B;  3NBH B;  4JVZ A;  4AI1 A;  2D9U A;  2PVX A;  1QG7 A;  5IGG A;  3CQZ L;  5IYB G;  3GTG L;  2ATW A;  2PPB C;  2EYF A;  1TWH B;  4R8N A;  4X3S A;  3V2T A;  1XJV A;  3F1Z A;  2KCM A;  3GTP B;  3M4O B;  1JC7 A;  2NVY L;  1AE3 A;  2KCC A;  2RF4 A;  5IP9 L;  1EY0 A;  2PW7 A;  1G6P A;  4A3K G;  2Z6B A;  1SN8 A;  1TY2 A;  2X6L A;  1HXY D;  1EY9 A;  1VQ5 A;  1YNN D;  1B71 A;  5FK9 C;  2YU9 B;  4RHR A;  2R92 L;  2OF1 A;  1Z7T A;  4HSP A;  1R9T H;  4JI8 L;  5IP9 G;  4U67 1;  5IY0 A;  1II3 A;  2PI2 A;  3T16 A;  2XJU A;  4AHX A;  1Y1V B;  1MI2 A;  1VQ6 A;  2Z6K C;  3LPE B;  2JA7 L;  3CHB D;  2IX1 A;  3S2D H;  1SNQ A;  1VF7 A;  5M5W B;  3QQC E;  5COY A;  4A3B L;  1DOK A;  1W6J A;  1SYF A;  4XXB B;  4APV A;  3I91 A;  4QIW P;  1HNZ Q;  1I50 L;  3DEP A;  4L63 B;  4CDE C;  2J7Z A;  1FJG L;  4B08 A;  2JA7 G;  4A3L H;  4A3G L;  3HOX H;  3UE0 A;  1GUG A;  3HKS A;  1V8Q A;  2HT1 A;  5AN9 H;  3MTS A;  1EWC A;  2NUC A;  2B29 A;  4A3B G;  3S16 B;  1XMO L;  1XWE A;  2JXM B;  3VYS A;  2FFK B;  2QCP X;  4FF4 A;  2AHO B;  2EDG A;  4PMC A;  3MSU A;  3OOC A;  1STG A;  1JWS D;  1SBB B;  1MGS A;  5DM7 3;  3JAM c;  4BY1 H;  3CRL C;  1F77 A;  3DWQ A;  1R9T B;  4QIW B;  2JA5 H;  4IFD H;  3WOE A;  3HOU L;  1PH9 A;  4AI3 A;  5MGN A;  2MO1 A;  1UWV A;  4A3C H;  4ZRZ A;  4V19 0;  2RHS B;  1I4G A;  1SSO A;  2EYH A;  1L0W A;  5ELE A;  2NTT A;  1BQQ T;  1GUS A;  4LFA L;  3DHQ A;  4JYA Q;  2Q8I B;  2QA4 A;  4DR6 Q;  2TMP A;  3J7A F;  4BY7 G;  4YWL A;  1Y1W L;  1ZYR D;  3M85 A;  5FO8 B;  2UXC Q;  2E2I H;  4QL5 A;  5M5Y H;  5IGC A;  1XNR Q;  2RA4 A;  3G6E A;  5I2X A;  5C0X H;  4AHW A;  3KLW A;  2J0T D;  3K80 C;  2D0O A;  4DUZ Q;  3LWP B;  5FJ8 L;  5JVH 3;  2A1A A;  2B8G A;  3CCM A;  3U50 C;  1L0X B;  1TWA H;  4R4Q A;  1FD7 D;  2SNM A;  4JAG A;  1Y1W G;  2DY8 A;  1RL2 A;  4FXG C;  1GD7 A;  2NN6 H;  3P1H A;  5M9O A;  4UY8 1;  1ENA A;  2K04 A;  1BCP C;  1LM0 A;  1VQA A;  3H3V I;  2V0F A;  1XTC D;  2F0W A;  2QDL A;  4RA8 A;  2XJT A;  4TVM A;  1S2Z A;  1D6E C;  3MXG A;  4AIM A;  1AP0 A;  3A7A B;  3KDF B;  4X3K A;  3S15 H;  2RKS A;  1ET6 A;  1TVX A;  1CQV A;  4HIO A;  3LWV B;  4GOP B;  2WAC A;  1PRT F;  1JJC B;  3I7F A;  1VZH A;  2APO B;  1N33 L;  2Q2I A;  1KTK A;  1PH2 A;  3T53 B;  4A75 A;  5ISR A;  1MHW C;  3I72 A;  3J80 E;  1VQ7 A;  1B2T A;  3RZO H;  2B63 H;  1O7Z A;  3PIP 1;  1EY6 A;  2EVB A;  4C1N K;  1TR5 A;  3W5O A;  2CVR A;  5C3E G;  2F0H A;  1DYQ A;  1K8A C;  4MN3 A;  2E2I B;  4IZ8 A;  5CMD A;  3KYX A;  5CV4 A;  3Q0A A;  1K8M A;  3KJP A;  4GLV B;  4AR4 A;  1C4Q A;  2DGY A;  2RDF A;  2EJM A;  3A8K E;  3S1M L;  1I4H A;  3HKZ P;  1XX8 A;  4TKO B;  2K5W A;  5IYD L;  3GTM L;  1WCM B;  4P73 A;  1JMC A;  4R4O A;  2D5D A;  4XYQ A;  4BBR B;  2UU9 Q;  2AYJ A;  2J4X A;  3TS0 A;  4QJF A;  4A3M L;  1FHM A;  2K50 A;  2HIX A;  2G9D A;  3WWL A;  3QOJ A;  1Q8I A;  5JVG 1;  3A54 A;  2HDM A;  5I2Y A;  3J7Z C;  4JK1 C;  1HJP A;  4JI5 L;  1VZI A;  4AQY Q;  7RXN A;  3JC6 6;  3VA7 A;  1F2M A;  2B2W A;  4G4K A;  4JYA L;  4B3M Q;  3HOZ H;  4DR6 L;  1IRO A;  4N9T A;  2F3W A;  4QUC A;  3H9C A;  3S1R H;  3GO5 A;  2B8F A;  1VQ4 A;  4UDU C;  4LF9 Q;  2UXC L;  5DLQ E;  4G7O C;  5DM6 1;  4JAE A;  3FP9 A;  1WTR A;  1XNR L;  3NEL A;  2B63 B;  3KYU A;  3T4A C;  4EQP A;  1X3P A;  3GTQ B;  1MBY A;  1TII D;  1YNJ C;  1QWY A;  4DUZ L;  1I6H B;  2L12 A;  1JOO A;  2NWG A;  4PZ8 A;  5C4J L;  3K7A L;  2CKC A;  1PFS A;  3J81 j;  1R4P B;  2KOL A;  5MLC 3;  1EY7 A;  2IJ0 A;  3BYT B;  4P72 A;  5GAH c;  1B13 A;  4KKT A;  4JBM A;  1BO0 A;  3GV3 A;  5MF6 A;  2WAQ P;  1UEB A;  5C44 L;  3I4M L;  2WKD A;  1I3Q L;  1SMW A;  1VF5 C;  4DV6 Q;  1N32 L;  3CQZ H;  3GTG H;  2L5T A;  2EY6 A;  2AQ2 B;  3M3Y L;  2Q8T A;  3ICE A;  3CCR A;  4WJW A;  5EKL A;  1Y8N B;  2A6H C;  3KLS X;  1BNZ A;  1JYB A;  2ZTC A;  3VYU A;  1X6O A;  1QVF A;  2NVY H;  2VL6 A;  4OXP A;  3GTJ H;  5IP9 H;  1ILP A;  3CD6 A;  2B2W C;  4HIM A;  1OO9 B;  3HOV G;  4F88 A;  4KTA A;  3QWN A;  2HUG A;  3PO2 L;  4WFN 1;  3CAM A;  4A3D L;  2ZT9 C;  5FLX E;  1DD2 A;  1LAB A;  4OIK A;  1HHV A;  2WAQ B;  1N34 Q;  2C6B A;  1PRT B;  1JB7 A;  2HVY C;  2R92 H;  1CK1 A;  3NK9 A;  5KND A;  2MJ8 A;  2NTS A;  1LLR D;  3ERS X;  3CCJ A;  3HEJ A;  2A73 B;  3J7Y W;  5IT9 E;  1E24 A;  2F0L A;  1YVC A;  1ZKO A;  2JA7 H;  1L1O A;  2KHJ A;  1QCB D;  3J7Y 1;  4JI4 Q;  2KJX A;  1LKP A;  1T5E A;  1TS5 A;  4O2D A;  4A3B H;  4DFA A;  5KIX A;  1G29 1;  3ZG6 A;  3JAM i;  2BA1 A;  1I50 H;  1LTG D;  1S5F D;  3D6C A;  4A3K B;  2O4X A;  4JI7 Q;  4UAI A;  1VS0 A;  3A7L A;  2R3Z A;  3TQY A;  3K5O A;  4KJO A;  3CC7 A;  4B3M L;  3RZT A;  5JEA G;  1CTM A;  1WD0 A;  2K52 A;  4ZN3 B;  1TWF B;  4M8A A;  2HR5 A;  3GTJ B;  4LF9 L;  2XN9 C;  3I2Z A;  2K7V A;  3T13 A;  4DR3 L;  1SE2 A;  2E8G A;  1FYC A;  5ELD A;  3J81 L;  1A2U A;  3OW7 A;  5JPN C;  2CKA A;  2M00 A;  4RAU C;  2HIV A;  4ZLT F;  4CJ2 C;  2F0J A;  3JAM L;  5LL6 S;  4FO2 A;  3SGI A;  4JI0 L;  2M6O A;  1TXY A;  3HOU H;  3NP8 A;  1H9K A;  1L1O C;  5C5M A;  1NR4 A;  2NYD A;  1LT6 D;  1Y69 U;  5T1I A;  2JI1 A;  5C4H A;  3M7G A;  1K3B C;  1PZX A;  1SE4 A;  2EOT A;  1ESR A;  3NUC A;  4JOI A;  1M1K C;  2YTV A;  1JR0 D;  1T9H A;  4PMW A;  1B3A A;  1YHB A;  3M4Q A;  4P71 A;  3TP8 A;  1A0I A;  1Y1W H;  3PO3 G;  4C3I B;  5FOB B;  3JC6 3;  2K5H A;  4A76 A;  4PNY A;  2QIL A;  4C1N I;  3CXC A;  1N8R C;  2K4K A;  1R0I A;  2QKI C;  2RBM A;  4NXN L;  4C3J G;  5FJ8 H;  2EYL A;  4A3E L;  4IFD I;  3MEH A;  4DAY A;  3QIA A;  4ILW A;  3G7L A;  3QJY A;  3IKJ A;  4RGN A;  2PQA A;  4EQN A;  1VQ8 A;  1HNW Q;  2WFW A;  2GA4 B;  4LF8 Q;  2L55 A;  1PTO C;  3TS2 A;  1CSQ A;  4JPB W;  4DNR B;  1JE4 A;  3F2D A;  3PUZ A;  4I7A A;  4JI4 L;  1J9O A;  3LWE A;  3WWN B;  1E3P A;  1H7V A;  1A3V A;  4YIJ A;  3PKJ A;  4DU9 A;  4BY7 B;  4RXN A;  4K2L A;  2H12 A;  3OYY A;  4HAE A;  4F87 A;  1JE5 A;  1HZA A;  4ZAI A;  5BN4 A;  2VUM L;  5IIF A;  5C0X I;  1YHA A;  2Q2T A;  4JI7 L;  2PQE A;  1B1Z A;  1VQE A;  2K05 A;  3OHX C;  4JOI C;  1SAP A;  2EE1 A;  1CSP A;  3A8I E;  3FKI B;  2KUM A;  4RFB A;  3S24 A;  1Y1W B;  1PMR A;  2NN6 I;  2UUB Q;  2ZIX A;  4O1N A;  3L7Z C;  2RSO A;  3EA6 A;  4KN4 C;  1PH6 A;  3G71 A;  2RCN A;  5C4X B;  3S1Q L;  3DWP A;  4QY7 A;  2PSM C;  1Y8P B;  2K2D A;  3S9W A;  1SFO L;  1BCP F;  3S1M H;  1YNN C;  1YK5 A;  4IPD A;  5AJ3 Q;  5IYD H;  5K5P A;  5C3X A;  4QIW E;  4RGM A;  4DV4 Q;  3OMG A;  2DUD A;  1B8A A;  4C2M 1;  4KD3 A;  4XYO A;  4CDD C;  1S5C D;  1E0B A;  2LXK A;  3TDQ A;  1V1P A;  3RN5 A;  1YJN A;  3NTH A;  4GLA C;  1ZXT A;  3A44 A;  3WWV A;  2CR8 A;  2CW0 D;  1JWM D;  1LYL A;  3BDC A;  5ELB A;  3A74 A;  5AI2 A;  1WOC A;  5C3E B;  1YIJ A;  2NVT B;  1I6V C;  1IW7 D;  1XPU A;  2KA7 A;  4L5R C;  5G3L D;  4K14 A;  3DM3 A;  4BY1 G;  4BXX L;  3L3O C;  4Y52 L;  3CCE A;  4GN3 B;  2EJF C;  2E2J B;  2B5I D;  1W2B A;  2EZV A;  2L1B A;  4XQQ A;  1SMU A;  3K7A H;  2ERS A;  4RKB A;  1SJH D;  4PG3 A;  1OXX K;  2Z9H A;  2ICE C;  5GAE C;  4HJ8 A;  1HNW L;  2JA8 L;  3R2T A;  2CQO A;  5C44 H;  4KY7 A;  2NVX L;  1SNM A;  3I4M H;  1I3Q H;  3H3V M;  4QMG A;  2KKD A;  3VYT A;  1YUX A;  3GTK B;  3A5U A;  4I65 A;  1GM5 A;  3ULP A;  3M3Y H;  2PVE A;  2B2V A;  2EYM A;  4O42 A;  1IYJ B;  4ABN A;  1DM0 B;  2F3I A;  5C0X G;  4FP5 D;  1D1I A;  4QUF A;  4E6I A;  5IYC L;  4HR7 B;  4L5T A;  4CJ0 B;  2K01 A;  4OL7 A;  2AUS B;  2B2T C;  3TP7 A;  4A93 L;  3TRE A;  2I5L X;  2NN6 G;  4JG2 A;  3PO2 H;  2BOS A;  2AQ1 B;  1H9M A;  4A3D H;  2KEN A;  2EY2 A;  1ML0 D;  3PL5 A;  3FVQ A;  5EBD A;  3NFP I;  3GTL L;  1FR3 A;  1QUQ A;  4IUT A;  2Y0S G;  4DV7 Q;  4PZ6 A;  5IYC G;  2F0M A;  5M3F B;  4XQJ A;  1CKN A;  1NMF A;  5I4D A;  2UXD Q;  3STB D;  3PUX A;  4A93 G;  4XT3 B;  4IJL A;  4DAV A;  1EY4 A;  3GTO L;  2LKV A;  5JOB A;  1RWD A;  5IP7 L;  4JI8 Q;  1SJE D;  1PHJ A;  1BXT A;  4KMU C;  1IHZ A;  5JJL A;  4NKL A;  4ZK9 B;  4LFC Q;  1SXT A;  3HOV B;  4C2M B;  3HG9 A;  1UNS A;  1BCP B;  2B2V C;  1H9S A;  2V4D A;  1FJG Q;  5I6W A;  5H1S E;  4KJN A;  2HDL A;  4NMZ A;  4WJ4 A;  2CWP A;  3BDL A;  1J5E L;  3S17 L;  1O7Y A;  5E1F A;  4AHZ A;  1UEA B;  1TWG B;  3EIV A;  2IWH A;  4AI2 A;  1XMO Q;  2G9H D;  1ZRP A;  5NUC A;  1B50 A;  2PPT A;  2H5X A;  2FXQ A;  4GS3 A;  3MAQ A;  2EYJ A;  3CC2 A;  3A0J A;  3I55 A;  2DSX A;  4FF2 A;  5GQO A;  1PFN A;  3L0O A;  5GAG c;  5KGU A;  5IGF A;  4YWM A;  2Z6K A;  1C09 A;  1N9W A;  2DNC A;  2M4V A;  1RDP D;  3D31 A;  1D5X C;  4FNF A;  3MEF A;  1B3Q A;  4C3J H;  4XQN A;  5KYL A;  1E22 A;  4MIU A;  5KYI A;  1IBK Q;  1SLJ A;  5DM7 1;  1AE2 A;  5E4X A;  1CZW A;  1RTN A;  2JA6 L;  3K0X A;  1VQG A;  1SMY D;  3H0G L;  3ND8 A;  4A3J L;  5EPL A;  4C3H L;  3RN2 A;  1ESF A;  4LFA Q;  5C3W A;  1LAC A;  1CKO A;  2XRQ D;  5IT9 c;  3S14 L;  3S1N L;  3KOJ A;  1HTL D;  1EYA A;  1F2L A;  2E74 C;  2RCF A;  2RQX A;  4A3E H;  3IAY A;  1IL8 A;  1BQ8 A;  2WAQ E;  4V19 6;  1NJI C;  3I56 A;  3I3C A;  4QF4 A;  1UE1 A;  2K5V A;  4DV7 L;  3M7N A;  2KBN A;  4JI1 Q;  3H0G G;  5AI3 A;  2Z4I A;  1HFG A;  4RCN A;  3UI2 A;  4A3J G;  3S2H B;  1B2J A;  1EOT A;  3T51 B;  2UXD L;  1BBU A;  1VQC A;  4LUO A;  1K83 H;  2F3V A;  4X65 Q;  4BBS L;  2VW9 A;  4LUZ A;  3LGJ A;  5CYU A;  2EXD A;  2PNR C;  3PO3 B;  1EFW A;  4Y7N L;  3MC0 B;  4CGY B;  5JVH 1;  2MQH A;  2VUM H;  3NTK A;  4IUU A;  5L37 A;  3RMH A;  4LFC L;  1EEI D;  3GQB A;  1PV4 A;  3H99 A;  5CR3 A;  3L9A X;  4C3J B;  4BBS G;  2VQE L;  5GAD C;  3PWF A;  2R92 G;  2I07 B;  1FNU A;  1LTL A;  1YUZ A;  1WYD A;  2JEB I;  1WI5 A;  2QEX A;  1KNE A;  1LKM A;  4A3F L;  4HCE A;  4NXM L;  3I70 A;  1N33 Q;  3K5N A;  4DR4 L;  1CHP D;  2OQK A;  3LNL A;  2F0P A;  4X3U A;  2XWB B;  5M5X L;  2MP1 A;  2EYP A;  2R7D A;  5CC4 A;  1R0J A;  1UAP A;  3T1Y Q;  3EN2 A;  3NEN A;  1B70 B;  3J81 c;  3PIO 3;  1KLG D;  3E9H A;  4DV2 Q;  4GNX A;  3TME A;  1BFY A;  4HMI A;  2K32 A;  2F0T A;  4OX9 L;  2RDV A;  3RZD H;  4A3G G;  1NXG A;  1K83 B;  3X3M A;  2F0Q A;  1RDG A;  1PRT D;  4G7Z C;  2CQA A;  4LFB L;  2R93 L;  1K8O A;  4YWK A;  3K59 A;  3FDT A;  1IBK L;  1I4X A;  4EVO A;  2KCN A;  2A68 D;  3S2D B;  2M4Y A;  1PFM A;  1CKM A;  2B2Y A;  3NQT A;  5ELO A;  5M3M L;  4LUV A;  4JI5 Q;  3MZ5 A;  4YY3 Q;  4BXX H;  3BVG A;  2MGS A;  4DKA C;  1B4O A;  4Y52 H;  4KV6 A;  3SS2 A;  1BF4 A;  4K2K A;  4DXF A;  2PCF B;  1I4P A;  1Q3L A;  4H13 C;  4IUN A;  3HOU G;  3RZ6 A;  1SYC A;  1SR3 A;  3HOX B;  4ULL A;  1CFM A;  5GAG C;  1ENF A;  2EXZ A;  1SND A;  2IL8 A;  4I7Z C;  4JI1 L;  2NVQ L;  2JA8 H;  1PZI D;  4FVM A;  2NVX H;  3N6R A;  4OWT B;  4X62 Q;  2ASB A;  2XGT A;  1NCV A;  4X65 L;  1RHP A;  1M90 C;  4GNX C;  1IU5 A;  1DJR D;  3F2B A;  1YBY A;  2C5C A;  2LMC B;  1S24 A;  3QB3 A;  3RZD B;  1JOR A;  1K9M C;  2IPK D;  4BY1 B;  4FXK C;  1PTO H;  3P2A A;  3KFU A;  1HRJ A;  4K9F A;  5LL6 X;  2XIW A;  1VQP A;  5FJ8 G;  2JA5 B;  1N32 Q;  5IYC H;  1EUJ A;  2OXP A;  1XMQ Q;  1ASY A;  1N36 Q;  3BJU A;  1U9R A;  1M4V A;  1L1O B;  4A93 H;  1LV9 A;  5EIO C;  1VCI A;  4V0B A;  1PH5 A;  2B2Y C;  1G8Z D;  3NBH A;  1TQO A;  1IYV A;  2UUA Q;  3TN2 A;  1KAA A;  4AYB G;  3GTL H;  3K35 A;  1AZQ A;  2WB1 G;  4DR7 L;  1S5B D;  3T1Y L;  2AQ3 B;  5FLM L;  1CA6 A;  4DV2 L;  2K5D A;  1H9J A;  5M5Y B;  1PFW A;  2JI2 A;  3J7A V;  2SNS A;  2MPM A;  3GTO H;  3A8J E;  1PFB A;  1OTC A;  5IP7 H;  4GKJ Q;  5JJZ A;  2Z3Q B;  3H91 A;  4JBW A;  1E1O A;  1TWA B;  3N52 A;  3H6M A;  2MNA A;  3TRZ A;  1VQM A;  4OGQ C;  5T1G A;  3RR5 A;  2QDB A;  2ZXP A;  4GN5 A;  4G57 A;  5FLM G;  4RHS A;  1C8C A;  1AEX A;  2JEA I;  1UUP A;  3PUW A;  1MSH A;  1WJV A;  3S15 B;  1CM9 A;  4HJ5 A;  3E6Z X;  4LAA A;  4YY3 L;  2GVA A;  4DV3 L;  3CCV A;  2KEE A;  4BA2 I;  2AUJ D;  3S17 H;  5K36 G;  5IYD G;  3T1H L;  5FO9 B;  5FKA C;  1TT2 A;  3PUY A;  2OEO A;  3H15 A;  4A3M G;  1M8A A;  3D4W A;  1DOL A;  5I6Y A;  1R0G A;  2RDG A;  3RLF A;  3RZO B;  4DR3 Q;  1E8J A;  2N8N A;  3KLR A;  1LTT D;  2Z3R B;  4K8J A;  4X62 L;  3W2D A;  2L4N A;  3PIO A;  4CDC C;  3GTO B;  3E0J A;  4UP7 A;  4OO1 H;  3GV6 A;  5J22 A;  3HJY B;  1MD2 D;  3OPO A;  1I4R A;  1ILQ A;  3UDX A;  4DXG A;  4JI0 Q;  4DAY B;  3CME A;  3H9B A;  4ZQ3 A;  4ZN1 B;  1R0F A;  1QIL A;  1TU2 B;  4A3I L;  3KK7 A;  4LW1 A;  4B3S L;  4LF5 Q;  5A35 A;  2ERJ A;  1SYD A;  1CQF A;  3H0G H;  1XMQ L;  3I4N L;  2DN8 A;  1B9M A;  4DGZ A;  2PI2 E;  1S3O A;  4A3J H;  4X6A L;  1N36 L;  4EQ5 A;  4C3H H;  2CW0 C;  4HJ7 A;  4UP9 A;  5E3F A;  5FLX L;  3S14 H;  3S1N H;  4GN4 B;  1X9N A;  3UDI A;  1PH4 A;  1IW7 C;  5C44 G;  1Z6H A;  3I4M G;  2O5I C;  2UUA L;  1TS4 A;  5IT9 L;  5HUR A;  3HOZ B;  1TWC L;  4DNT B;  1WTH A;  3S1R B;  4ZKC B;  5DNF A;  3W1B A;  1E2W A;  4NXN Q;  1VQO A;  5J1Z A;  4IQZ A;  5A2Q E;  3ER0 A;  4XDX A;  3E9I A;  4BBS H;  5D3I B;  3MFG A;  3B0A B;  3ZJY C;  4XT1 B;  4GKJ L;  1CT1 D;  4HID A;  2N3S A;  2BDO A;  4R1J A;  4Y7N H;  4IFD J;  3AFP A;  1GVP A;  3LNN A;  3J81 i;  3PO2 G;  5BR8 Q;  3SR1 A;  4A3D G;  1LTR D;  1UE6 A;  1AFP A;  2K33 A;  1EY5 A;  3HOW L;  1WD1 A;  3HOY L;  1B9N A;  1WTX A;  2E2H L;  4FF1 A;  3CQZ B;  4A3F H;  5CV7 A;  4MZ9 A;  1X3E A;  3GTG B;  2M6P A;  4A3G H;  3BVZ A;  4K5X A;  1A15 A;  4MHE A;  4F8M A;  4DR1 L;  5IGD A;  2F0S A;  1NBW A;  2XRS D;  3Q24 A;  5M5X H;  3KJO A;  1G2T A;  3EJI A;  1XNQ Q;  2NVY B;  5C0X J;  3OWF A;  1C9O A;  4KHP L;  5I9O A;  4K6L A;  5HY6 A;  1H9R A;  3KF6 A;  4DAP A;  2UXB Q;  4CHT B;  4BBS B;  2R92 B;  1PA6 A;  1TWH L;  3PUV A;  4LJZ C;  1NNX A;  1SEB D;  2TSS A;  3GTP L;  4L6T B;  3LWQ B;  1WTQ A;  5GAE c;  2KEC A;  3M4O L;  2ICI A;  1OXT A;  2JA7 B;  8RXN A;  1XTD A;  1VMP A;  4R4I A;  2HQE A;  1DZ1 A;  4LF5 L;  1MSG A;  1HTP A;  4GZY C;  2F0I A;  1A3U A;  2EY1 A;  5M3M H;  4A3B B;  2JI3 A;  4OWW B;  1HPC A;  1EYD A;  3NHH A;  1KDA A;  4HN7 A;  1VQF A;  3BYY B;  1I50 B;  1O7L A;  5EKI A;  1SYE A;  3PF5 A;  1ICF B;  2YU9 L;  2K75 A;  5IE8 A;  3H97 A;  3D8G A;  3NBI A;  4ID6 A;  3RNU A;  5IWA L;  4A3G B;  1SE3 A;  1EU4 A;  3G6J B;  1STA A;  1LTB D;  5BN5 A;  2ZTD A;  1K3R A;  5ELC A;  1WTW A;  1SE8 A;  1Y1V L;  1HZB A;  2NVQ H;  2CWA A;  1Y8O B;  2PYK A;  2JA9 A;  2F0N A;  1A62 A;  5M5W L;  1JOK A;  4JC0 A;  4XXE A;  1GUN A;  1SMX A;  1FNV A;  3JC6 2;  3NWS A;  3AYH B;  1WVL A;  4ME5 A;  4S3S A;  2F52 A;  2AQC A;  5D3D A;  1NXE A;  3G48 A;  4HMJ A;  2VB2 X;  3U9S A;  2H4O A;  4NP5 A;  1T5X D;  2NZH A;  4WJ3 M;  1QUQ B;  5BR8 L;  5J3B A;  1LTS D;  2ZTE A;  4A3E G;  1FL0 A;  5D14 A;  1EQQ A;  5KEE A;  4UP8 A;  3CCU A;  1CKN B;  4U68 A;  3HOU B;  4YHH Q;  3S16 L;  5CBA E;  2AWN A;  1MJC A;  1BOS A;  1SNP A;  3TEH B;  4DPG A;  1KC8 C;  1SMY C;  4AYB P;  4MNO A;  2QW7 A;  1PVO A;  2WB1 P;  5DEH A;  4DNI A;  4N9P A;  3UDG A;  1TY0 A;  1XNQ L;  1YIT A;  1JCK B;  1JWU D;  2O2L D;  1B44 D;  5CGK A;  5FLM H;  2VUM G;  1IKL A;  1H9S B;  3GP7 A;  4P74 A;  2LXJ A;  2A6E D;  1TKW B;  1P8L A;  1CUK A;  3VR4 A;  2PZU A;  4DK1 A;  2UXB L;  2SOB A;  2XJP A;  1EQT A;  1EIG A;  1HA5 A;  3SHL A;  3RD4 A;  5K36 H;  1PFY A;  2XVS A;  3KF8 A;  3GTM H;  1F4L A;  3HFZ B;  3CF5 A; 
#chains in the Genus database with same CATH homology
 4A3M H;  1VQL A;  3J7A 5;  4IOA A;  1NMG A;  2MO0 A;  1PH7 A;  4HJA A;  4UY8 C;  2YV5 A;  2D0P A;  2J9U B;  3ULL A;  1J5E Q;  1DGS A;  1RDV A;  3AFQ A;  5C4J H;  4JI3 Q;  3BU2 A;  2D62 A;  4DV5 Q;  1VQH A;  4BXX G;  2PNH A;  3CMA A;  4KHZ A;  1HNX L;  1VQD A;  1UE5 A;  3I4N H;  4YHH L;  3VDY A;  3J80 c;  1YEZ A;  1I94 Q;  1EWI A;  3OTO L;  3RLN A;  1X3G A;  2HHH Q;  2JA8 G;  3Q8D A;  1OXS C;  4DR2 L;  2JQO A;  1AH9 A;  3J7Z 1;  2IHF A;  1TWC H;  1EOV A;  2A19 A;  5GAD c;  2OCE A;  4AH6 A;  2ZM6 Q;  2I0Q A;  3U58 A;  2XTI A;  2PYA A;  4JBK A;  3PCO B;  3EBE A;  1JJ2 A;  1WFQ A;  4DR5 Q;  1QYB A;  1RYT A;  4DAM A;  2JJQ A;  4JV5 L;  1A63 A;  1WCM G;  4BBR G;  3HOW H;  1Q86 C;  4BA1 I;  1BKB A;  4AR3 A;  1QVC A;  2E2H H;  5RXN A;  3E0E A;  2CFM A;  5HGQ A;  5ELN A;  1KAW A;  1D7Q A;  2VQE Q;  3F8T A;  3B08 B;  5IP7 G;  2K5N A;  1OXV A;  4NXM Q;  1GO3 E;  4DR4 Q;  1Q81 C;  5GRO A;  3HKZ G;  4O0A A;  1KHI A;  4JI3 L;  4MTN A;  5MFZ A;  4IOC A;  1EIF A;  4DV5 L;  3RLO A;  1TWH H;  4R4T A;  1XPR A;  4OX9 Q;  3GTP H;  3M4O H;  1HZ9 A;  1HZC A;  2CCZ A;  2C6A A;  4LFB Q;  3PIO 1;  2BH8 A;  1B7Y B;  2V3B B;  1I94 L;  3U4Z A;  1Q1B A;  4UPA A;  2YU9 H;  3PGZ A;  2HHH L;  1X65 A;  5FLX c;  5JJK A;  1IZ6 A;  2R7Z G;  4OO1 G;  1QZG A;  1Y1V H;  4DV0 Q;  2ZM6 L;  1NE3 A;  5M5W H;  2WAQ G;  1XPO A;  2JA6 G;  1IXR A;  1S40 A;  2IT1 A;  4GKK L;  4DR5 L;  3I4O A;  1PH1 A;  2E5L Q;  2JE6 I;  5K2M E;  4AHY A;  3S16 H;  1KL9 A;  1U0L A;  1V1Q A;  1V43 A;  4P75 A;  2VQF Q;  1K73 C;  4IJH A;  1S30 A;  2OQ0 A;  4RG1 A;  1VCX A;  3DLL A;  2RHQ B;  2KCT A;  3S1Q H;  4DK3 C;  2KN9 A;  4DR7 Q;  3BZC A;  1Z47 A;  1SFO H;  4B3T Q;  4A3F G;  3PF4 A;  1OWB A;  5MFP A;  1IRN A;  4TQU S;  1G51 A;  4X64 Q;  4EX5 A;  3RYG A;  4HIK A;  1V9P A;  2LSS A;  1VQK A;  1LUZ A;  1Z92 B;  3K8A A;  2L0Z A;  1KXL A;  4DV3 Q;  4LHL A;  3T1H Q;  3J80 i;  4DV0 L;  1JJG A;  2R93 G;  2BE5 D;  2BH2 A;  1PH3 A;  3QVD A;  2AKW B;  3IRB A;  2R7F A;  4PZ7 A;  5M3M G;  3IU3 I;  5LMU Q;  5JEA J;  2JK8 A;  4IPH A;  2VY3 A;  2E5L L;  4ALP A;  1VQB A;  1KQS A;  4L5Q A;  2ZJQ A;  3KYW A;  4YCU A;  3ULJ A;  4B3S Q;  2VQF L;  2NZO A;  1QVG A;  3A5Z B;  2O5J D;  3OW2 A;  3FKI G;  2A69 D;  1WCM H;  4BBR H;  3D0F A;  1BQ9 A;  2A8V A;  2B3G A;  5C4X G;  3VPB E;  6RXN A;  4LF6 Q;  4B3T L;  2IY5 B;  2Z0S A;  1HNZ L;  2IHE A;  1CAD A;  2N49 A;  4X64 L;  1X3F A;  2AMC B;  4AYB E;  1P16 A;  2GVB A;  2WB1 E;  1K0R A;  1YI2 A;  1RYQ A;  3KF6 B;  3GTQ H;  4XTC S;  4JAD A;  5LMN Q;  1I6H H;  4XGH A;  5EIN C;  3UE1 A;  2OWO A;  1FHH A;  3CC4 A;  2ALY B;  1RIP A;  2V1C C;  1EYG A;  4DR1 Q;  3NEM A;  1IBM Q;  1NTG A;  3UDF A;  2GN5 A;  3B6Y A;  3MPS A;  4KHP Q;  1BRF A;  2QL0 A;  2HQL A;  5E7N A;  5LMU L;  4DK6 C;  1Q7Y C;  3CW2 C;  2LCQ A;  2R7Z H;  4XIG S;  1I5F A;  4L5S A;  2YYZ A;  4AR5 A;  1QZH A;  1CAA A;  1X54 A;  1T9P A;  1Y14 B;  2PQA B;  2JA6 H;  4JI2 Q;  3K7U C;  2OTJ A;  1T9O A;  1YJ9 A;  5IYB H;  2XJV A;  4TVA B;  1HR0 Q;  1L2F A;  1ASZ A;  2XJS A;  4JAF A;  5IWA Q;  1C7Y A;  1H95 A;  2CKZ B;  4A3I G;  1YJW A;  1FGU A;  2YTX A;  4B3R Q;  3I4N G;  2XJR A;  5M3F G;  4LF6 L;  4A3K H;  3KYV A;  1Q1E A;  3KYH C;  1RB9 A;  3GD7 A;  1VZG A;  1KD1 C;  4YCV A;  1TWF H;  3AEV A;  4GS7 D;  1MIU A;  5H1S c;  2WP8 J;  4IPC A;  4RMF A;  3CPF A;  1Q82 C;  5LMN L;  2F4V Q;  2QGQ A;  1Q46 A;  1K8G A;  4LF7 Q;  3KF8 B;  4IPG A;  4POF A;  1SMM A;  3KDF A;  1PYB A;  4R4C A;  1IBL Q;  1IBM L;  4GOP A;  4QGU A;  3HOW G;  2UU9 L;  3W1G A;  3HOY G;  4JI6 Q;  1LKO A;  3U4V A;  2Q2U A;  4AQY L;  1OWC A;  4C3I H;  3STB C;  1EQR A;  4NPS A;  2R93 H;  3CCL A;  4JI2 L;  4OWX B;  2L15 A;  3MXN B;  1HR0 L;  2KHI A;  1O7I A;  3PKI A;  5EAY A;  2PMZ E;  4BY7 H;  1Q8K A;  2EQS A;  4GLX A;  4GOP C;  4B3R L;  3KYY A;  4DV6 L;  4JCV E;  2C35 B;  1VQI A;  2I5H A;  2YTY A;  1X55 A;  2AWO A;  3F2C A;  3G4S A;  2EIF A;  3FKI H;  4NB3 A;  1Y1V G;  1HNX Q;  1KRS A;  5C4X H;  1J6Q A;  4QQB X;  4DUY Q;  1KIX A;  2F4V L;  2VNU D;  4LF7 L;  1N34 L;  1OXU A;  5GAH C;  3OTO Q;  2UUC Q;  4JBJ A;  3CP0 A;  4KLK A;  4DR2 Q;  2R6G A;  1YNX A;  1IBL L;  4J15 A;  4E6Y A;  1D8L A;  1DX8 A;  2BA0 A;  4H02 A;  4JI6 L;  2ID0 A;  5C3E H;  2NVT H;  3PV0 A;  1QCV A;  1Q12 A;  1NY4 A;  3CCS A;  4JV5 Q;  3PIP A;  3CPW A;  2E2J H;  1U5K A;  4G6B A;  3CCQ A;  1BVS A;  1WJJ A;  2XJQ A;  4TPU A;  4DV1 Q;  1SRU A;  3GTK H;  4A3L G;  3PSI A;  1MKH A;  4K0K Q;  3HOX G;  1YK4 A;  1YZ6 A;  2VZA A;  2GMG A;  3AQQ A;  1VQN A;  1UE7 A;  4AI0 A;  5LMN W;  2A6H D;  1VQ9 A;  1VQJ A;  4POG A;  1C0A A;  1JT8 A;  3H3V H;  4A3I H;  4X66 Q;  2JA5 G;  2Q2H A;  4DUY L;  4IFD G;  4X6A H;  2ZJP A;  5M3F H;  4LNQ A;  2MS3 A;  4HJ9 A;  4A3C G;  2UUC L;  4LWC A;  4LF8 L;  1Z9F A;  1ODH A;  4OO1 I;  1IL2 A;  1EIY B;  3PZA A;  2OTL A;  3HOV H;  4C2M H;  3M4P A;  1S72 A;  2ZJR A;  1W3S A;  4LF4 Q;  2V0E A;  4GKK Q;  1T9Q A;  1MJE A;  2MFI A;  1HR0 W;  2UUB L;  1TWG H;  3HOY H;  4GNX B;  3BZK A;  2Y0S E;  2ES2 A;  1A8V A;  3K81 C;  1NNQ A;  1PH8 A;  4A4I A;  4DV1 L;  5AJ3 L;  4KI0 A;  4DV4 L;  2I5M X;  4K0K L;  2B63 G;  3L2P A;  1SRO A;  4AR6 A;  1E1T A;  1FVI A;  1E7Z A;  2N78 A;  4YCW A;  1R0H A;  4OON A;  1PYS B;  4LHN A;  3M9B A;  4B8C D;  4IO9 A;  4FDB A;  1GKH A;  4X66 L;  3GDE A;  5JJI A;  3P8B A;  3HKZ E;  1X56 A;  3S2H H;  2K14 A;  1KRT A;  1BBW A;  2VS1 A;  1HH2 P;  1IU6 A;  3PO3 H;  1DVB A;  3HOZ G;  2IX0 A;  3FHW A;  1YHQ A;  1B2O A;  4ME3 A;  1BE7 A;  1YV1 A;  4LF4 L;  3NBH B;  4AI1 A;  2PVX A;  5IYB G;  2ATW A;  1XJV A;  3F1Z A;  2KCM A;  1AE3 A;  2RF4 A;  1G6P A;  4A3K G;  1SN8 A;  1VQ5 A;  1B71 A;  1R9T H;  4JI8 L;  5IP9 G;  4U67 1;  5IY0 A;  2PI2 A;  2XJU A;  4AHX A;  1VQ6 A;  2Z6K C;  3LPE B;  2IX1 A;  3S2D H;  3QQC E;  4XXB B;  4APV A;  1HNZ Q;  1FJG L;  2JA7 G;  4A3L H;  3HOX H;  3UE0 A;  3HKS A;  2HT1 A;  5AN9 H;  4A3B G;  2B29 A;  1XMO L;  2AHO B;  3MSU A;  3JAM c;  4BY1 H;  2JA5 H;  1PH9 A;  4AI3 A;  5MGN A;  2MO1 A;  1UWV A;  4A3C H;  2RHS B;  1L0W A;  4LFA L;  4JYA Q;  2QA4 A;  4DR6 Q;  4BY7 G;  4YWL A;  3M85 A;  2UXC Q;  2E2I H;  4QL5 A;  5M5Y H;  1XNR Q;  3G6E A;  4AHW A;  3KLW A;  3K80 C;  2D0O A;  4DUZ Q;  2A1A A;  3CCM A;  3U50 C;  1TWA H;  4R4Q A;  4JAG A;  1Y1W G;  1RL2 A;  1GD7 A;  4UY8 1;  1LM0 A;  3H3V I;  1VQA A;  2V0F A;  2XJT A;  4TVM A;  1S2Z A;  4AIM A;  3KDF B;  3S15 H;  4HIO A;  4GOP B;  1JJC B;  3I7F A;  1VZH A;  1N33 L;  2Q2I A;  1PH2 A;  4A75 A;  1VQ7 A;  3RZO H;  2B63 H;  3PIP 1;  3W5O A;  5C3E G;  1K8A C;  3KYX A;  3KJP A;  4GLV B;  4AR4 A;  2DGY A;  4P73 A;  1JMC A;  4R4O A;  2UU9 Q;  2AYJ A;  3TS0 A;  4QJF A;  1FHM A;  2K50 A;  2HIX A;  3WWL A;  5JVG 1;  3J7Z C;  1HJP A;  4JI5 L;  1VZI A;  4AQY Q;  7RXN A;  3JC6 6;  4JYA L;  4B3M Q;  3HOZ H;  4DR6 L;  1IRO A;  3S1R H;  3GO5 A;  1VQ4 A;  4LF9 Q;  2UXC L;  5DLQ E;  5DM6 1;  4JAE A;  3FP9 A;  1XNR L;  3NEL A;  3KYU A;  4DUZ L;  4PZ8 A;  2CKC A;  1PFS A;  3J81 j;  5MLC 3;  4JBM A;  4P72 A;  5GAH c;  1B13 A;  5MF6 A;  1UEB A;  1SMW A;  4DV6 Q;  1N32 L;  3CQZ H;  3GTG H;  3ICE A;  3CCR A;  1JYB A;  2ZTC A;  1X6O A;  1QVF A;  2NVY H;  2VL6 A;  4OXP A;  3GTJ H;  5IP9 H;  3CD6 A;  4HIM A;  3HOV G;  4WFN 1;  3CAM A;  1N34 Q;  2C6B A;  1JB7 A;  2R92 H;  3ERS X;  3CCJ A;  1E24 A;  1YVC A;  2JA7 H;  1L1O A;  2KHJ A;  3J7Y 1;  4JI4 Q;  1LKP A;  4O2D A;  4A3B H;  1G29 1;  3ZG6 A;  3JAM i;  2BA1 A;  1I50 H;  4JI7 Q;  1VS0 A;  3TQY A;  4B3M L;  3CC7 A;  3RZT A;  5JEA G;  2K52 A;  4ZN3 B;  2HR5 A;  4LF9 L;  3I2Z A;  4DR3 L;  2E8G A;  2CKA A;  2HIV A;  3SGI A;  4JI0 L;  2M6O A;  1TXY A;  3HOU H;  1L1O C;  2NYD A;  2JI1 A;  4JOI A;  1M1K C;  2YTV A;  1T9H A;  4PMW A;  3M4Q A;  1YHB A;  4P71 A;  1A0I A;  1Y1W H;  3PO3 G;  3JC6 3;  2K5H A;  4A76 A;  3CXC A;  1N8R C;  2K4K A;  1R0I A;  4NXN L;  5FJ8 H;  4IFD I;  2PQA A;  1VQ8 A;  1HNW Q;  2WFW A;  4LF8 Q;  3TS2 A;  1CSQ A;  3F2D A;  3PUZ A;  4JI4 L;  3WWN B;  1E3P A;  1H7V A;  3PKJ A;  4RXN A;  2H12 A;  3OYY A;  1JE5 A;  1HZA A;  5C0X I;  1YHA A;  2Q2T A;  4JI7 L;  1VQE A;  4JOI C;  1CSP A;  3S24 A;  2NN6 I;  2UUB Q;  2ZIX A;  3L7Z C;  1PH6 A;  3G71 A;  2RCN A;  4QY7 A;  2PSM C;  2K2D A;  3S1M H;  4IPD A;  1YK5 A;  5AJ3 Q;  5IYD H;  4QIW E;  4DV4 Q;  2DUD A;  1B8A A;  2LXK A;  3RN5 A;  1YJN A;  4GLA C;  3A44 A;  3WWV A;  2CR8 A;  1LYL A;  3A74 A;  5AI2 A;  1WOC A;  1YIJ A;  1XPU A;  1IW7 D;  4L5R C;  3DM3 A;  4BY1 G;  3CCE A;  4GN3 B;  2B5I D;  1W2B A;  1SMU A;  3K7A H;  2ERS A;  4PG3 A;  1OXX K;  5GAE C;  4HJ8 A;  1HNW L;  2CQO A;  5C44 H;  3I4M H;  1I3Q H;  2KKD A;  1YUX A;  3A5U A;  1GM5 A;  3ULP A;  3M3Y H;  2PVE A;  1IYJ B;  2F3I A;  5C0X G;  4L5T A;  3TRE A;  2I5L X;  2NN6 G;  4JG2 A;  3PO2 H;  4A3D H;  2KEN A;  3NFP I;  1QUQ A;  2Y0S G;  4DV7 Q;  4PZ6 A;  5IYC G;  1CKN A;  1NMF A;  2UXD Q;  3STB D;  3PUX A;  4A93 G;  4IJL A;  1RWD A;  4JI8 Q;  1PHJ A;  5JJL A;  4LFC Q;  1FJG Q;  5H1S E;  4WJ4 A;  2CWP A;  1J5E L;  4AHZ A;  3EIV A;  4AI2 A;  1XMO Q;  1ZRP A;  2PPT A;  2H5X A;  2FXQ A;  4GS3 A;  3CC2 A;  3A0J A;  3I55 A;  2DSX A;  5GQO A;  3L0O A;  5GAG c;  4YWM A;  2Z6K A;  1C09 A;  1N9W A;  2M4V A;  3D31 A;  3MEF A;  4C3J H;  1E22 A;  1IBK Q;  1SLJ A;  5DM7 1;  1AE2 A;  3K0X A;  1VQG A;  3RN2 A;  4LFA Q;  1CKO A;  5IT9 c;  3KOJ A;  4A3E H;  1BQ8 A;  2WAQ E;  4V19 6;  1NJI C;  3I56 A;  1UE1 A;  2K5V A;  4DV7 L;  3M7N A;  2KBN A;  4JI1 Q;  3H0G G;  5AI3 A;  4A3J G;  1B2J A;  2UXD L;  1BBU A;  1VQC A;  4LUO A;  1K83 H;  4X65 Q;  2VW9 A;  4LUZ A;  3LGJ A;  2EXD A;  1EFW A;  5JVH 1;  2MQH A;  2VUM H;  1PV4 A;  4LFC L;  4BBS G;  2VQE L;  5GAD C;  3PWF A;  2R92 G;  1LTL A;  1YUZ A;  1WYD A;  2JEB I;  1WI5 A;  2QEX A;  1LKM A;  4NXM L;  1N33 Q;  4DR4 L;  2OQK A;  3LNL A;  2R7D A;  1R0J A;  3T1Y Q;  3EN2 A;  3NEN A;  1B70 B;  3J81 c;  3E9H A;  4DV2 Q;  4GNX A;  1BFY A;  4OX9 L;  2RDV A;  3RZD H;  4A3G G;  1NXG A;  1RDG A;  4LFB L;  4YWK A;  1IBK L;  2A68 D;  2M4Y A;  1CKM A;  5ELO A;  4LUV A;  4JI5 Q;  4YY3 Q;  4BXX H;  4DKA C;  4Y52 H;  3SS2 A;  3HOU G;  3RZ6 A;  1SR3 A;  5GAG C;  4JI1 L;  2JA8 H;  2NVX H;  4OWT B;  4X62 Q;  2ASB A;  2XGT A;  4X65 L;  1M90 C;  4GNX C;  1IU5 A;  3F2B A;  1YBY A;  1S24 A;  1K9M C;  3P2A A;  3KFU A;  4K9F A;  1VQP A;  5FJ8 G;  1N32 Q;  5IYC H;  1EUJ A;  1XMQ Q;  1ASY A;  1N36 Q;  3BJU A;  1L1O B;  4A93 H;  1VCI A;  5EIO C;  1PH5 A;  2UUA Q;  4AYB G;  3GTL H;  3K35 A;  2WB1 G;  4DR7 L;  3T1Y L;  4DV2 L;  2JI2 A;  3GTO H;  1OTC A;  5IP7 H;  4GKJ Q;  2Z3Q B;  4JBW A;  1E1O A;  2MNA A;  3TRZ A;  1VQM A;  3RR5 A;  4GN5 A;  5FLM G;  2JEA I;  3PUW A;  1WJV A;  4HJ5 A;  4YY3 L;  2GVA A;  4DV3 L;  3CCV A;  4BA2 I;  5K36 G;  3S17 H;  5IYD G;  3T1H L;  3PUY A;  3H15 A;  4A3M G;  1R0G A;  3RLF A;  4DR3 Q;  1E8J A;  2N8N A;  2Z3R B;  4X62 L;  3PIO A;  4UP7 A;  3UDX A;  4JI0 Q;  4DAY B;  3CME A;  4ZN1 B;  1R0F A;  4LW1 A;  4B3S L;  4LF5 Q;  2ERJ A;  3H0G H;  1XMQ L;  4A3J H;  1N36 L;  2PI2 E;  1S3O A;  4EQ5 A;  4C3H H;  4HJ7 A;  4UP9 A;  3S14 H;  3S1N H;  4GN4 B;  1X9N A;  3UDI A;  1PH4 A;  5C44 G;  3I4M G;  2UUA L;  3W1B A;  4NXN Q;  1VQO A;  3ER0 A;  3E9I A;  4BBS H;  3B0A B;  3ZJY C;  4GKJ L;  4HID A;  2N3S A;  4R1J A;  4Y7N H;  4IFD J;  3AFP A;  1GVP A;  3J81 i;  3PO2 G;  5BR8 Q;  4A3D G;  1UE6 A;  4A3F H;  4MZ9 A;  1X3E A;  2M6P A;  4A3G H;  4DR1 L;  1NBW A;  5M5X H;  3KJO A;  1XNQ Q;  5C0X J;  1C9O A;  4KHP L;  5HY6 A;  3KF6 A;  2UXB Q;  1PA6 A;  3PUV A;  5GAE c;  1OXT A;  8RXN A;  1XTD A;  4R4I A;  4LF5 L;  5M3M H;  2JI3 A;  4OWW B;  1VQF A;  3PF5 A;  2K75 A;  5IE8 A;  3RNU A;  5IWA L;  2ZTD A;  1K3R A;  1SE8 A;  1HZB A;  2NVQ H;  2CWA A;  2JA9 A;  1A62 A;  4JC0 A;  1SMX A;  3JC6 2;  3AYH B;  2F52 A;  1NXE A;  3G48 A;  2NZH A;  4WJ3 M;  1QUQ B;  5BR8 L;  5J3B A;  2ZTE A;  4A3E G;  1FL0 A;  1EQQ A;  4UP8 A;  3CCU A;  1CKN B;  4YHH Q;  2AWN A;  1MJC A;  3TEH B;  4DPG A;  1KC8 C;  4MNO A;  1PVO A;  4DNI A;  3UDG A;  1XNQ L;  1YIT A;  5FLM H;  2VUM G;  4P74 A;  2LXJ A;  2A6E D;  1P8L A;  1CUK A;  2UXB L;  2XJP A;  3GTM H;  3HFZ B;  3CF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...