2VL6A

Structural analysis of the sulfolobus solfataricus mcm protein n- terminal domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
259
structure length
259
Chain Sequence
QIDYRDVFIEFLTTFKGNNNQNKYIERINELVAYRKKSLIIEFSDVLSFNENLAYEIINNTKIILPILEGALYDHILQLDPTYQRDIEKVHVRIVGIPRVIELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVLEMPTICPKCGKPGQFRLIPEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPGDRVKVTGILDIKQDSPVKRGSRAVFDIYMKVSSIEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords MINICHROMOSOME MAINTENANCE PROTEIN MCM
publication title Structural Analysis of the Sulfolobus Solfataricus Mcm Protein N-Terminal Domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 66
structure length 259
sequence length 259
chains with identical sequence B, C
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2vl6A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vl6A02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 2vl6A01
4LF9L 1JE5A 1VS0A 2VUMG 4B3TQ 1RDVA 3OYYA 1L2FA 2MO1A 3TS2A 2KCTA 1C0AA 2HIXA 3ULJA 3OTOL 3FKIG 4XTCS 1QZGA 4DR5L 4DV1L 1YK4A 2VQFQ 4PZ7A 4ALPA 1N8RC 2YV5A 4YWMA 1JMCA 5IP9G 2RCNA 1HNXQ 1C9OA 1J6QA 1VQ7A 1Y1VH 3KYYA 5C4XH 2VW9A 5LMNQ 3J80c 4JYAL 2KHJA 3CCEA 3HOUH 1SFOH 2KN9A 2PNHA 1VQFA 3H3VH 4JV5L 2K75A 1BBUA 2Q2HA 2R7DA 3SGIA 3M7NA 2A1AA 4JI7L 1W3SA 2Z6KC 4DV5L 1IBKQ 1YUZA 2I0QA 1VQDA 3CC7A 2ZM6Q 1VQCA 2F4VQ 4BXXG 1SROA 1XMOL 2MS3A 3S24A 3AYHB 4DV2Q 2UXBL 1PH7A 4R1JA 1GKHA 3BJUA 4IPGA 1A8VA 1SE8A 2JA9A 4A3DH 2I5MX 4GKKL 3T1YQ 1S72A 3M85A 3E9IA 3JAMi 4OXPA 3S2HH 1HNWQ 1NMFA 2JJQA 4NXMQ 1PA6A 4JOIA 3PO2H 1CUKA 3HOXH 1I6HH 1E8JA 1Y1WH 3I4NH 2QEXA 1FJGL 3M3YH 1VQBA 4QQBX 3CCUA 2PI2A 1T9HA 4HIMA 1BQ9A 3EIVA 5M5XH 5JJLA 4IPDA 3KYXA 4JBKA 3J81c 3VDYA 3Q8DA 3CPWA 1IBML 3MXNB 1RDGA 3STBD 1C09A 4B3SQ 1IU6A 5C4XG 3HKZE 4QIWE 3A5ZB 4LF4Q 3HOUG 1LKOA 1SLJA 3CAMA 3RLFA 3CMAA 2K52A 3AFQA 4R4TA 1ASZA 4LFAL 2UXDL 2ID0A 3AQQA 4BBRG 3PWFA 2JEBI 2NN6I 2UU9Q 4WJ3M 4P72A 1J5EQ 4NPSA 1BQ8A 1G51A 4A3JH 2Q2IA 1CKNA 4XIGS 4DR2Q 4A76A 1B70B 4JI8Q 4YY3L 3HOZH 1HZBA 1VQEA 1X6OA 2MO0A 2NZOA 1RWDA 4PZ6A 3W5OA 4A3DG 4KHPQ 1GM5A 3CMEA 2KKDA 2CWPA 1VQHA 1YZ6A 2WB1E 4IFDJ 1YHAA 2ZTDA 1I94Q 2N8NA 3NELA 5IE8A 3CCJA 1L0WA 4K0KQ 3HOVG 4JI6L 1ASYA 3L7ZC 1WOCA 1JYBA 1VQIA 1CKNB 2K14A 2VL6A 3H0GH 4NXNL 5GQOA 4DAYB 2PMZE 3H15A 3RZDH 2OTLA 2UXCL 3U4ZA 2VNUD 3M9BA 1YNXA 1B2JA 1AE2A 2EIFA 1EYGA 2OTJA 1CKOA 4DR1Q 2JA8G 2UXDQ 1AH9A 1JT8A 3AEVA 4HIKA 2WP8J 4R4OA 3HOWH 2KBNA 2JQOA 2LSSA 3PUWA 1VQPA 1MJEA 1KQSA 1VQ8A 4B3ML 1NJIC 5AI3A 4QL5A 4JI3Q 1TWCH 3ZJYC 4A3JG 2YTYA 4NXML 1OXVA 1GO3E 4YWKA 1XPOA 2JA6H 1YIJA 2Y0SG 3HOZG 3PCOB 4DR3Q 1X55A 1VQNA 3PUZA 2BA0A 4JOIC 1UWVA 1X3EA 1R0JA 2Q2TA 3M4PA 2R7ZH 4JI4Q 3U4VA 2PVXA 4AYBE 3RZOH 1YEZA 3ICEA 3TREA 7RXNA 3KOJA 5IP7G 4DV7L 1YITA 2YU9H 4B3SL 2V3BB 4P75A 3S1MH 5JJKA 1R0HA 1K83H 4LUVA 4DUYL 4L5RC 2ZTEA 1IL2A 3I4MG 5IYDH 1N34Q 1WI5A 4QJFA 1YHBA 4B3RL 3HKSA 1B7YB 1K0RA 1M90C 1VQJA 2YTXA 1XNQQ 1M1KC 1QYBA 4A75A 2Q2UA 4BY1H 4RMFA 1EIYB 4GLVB 2DSXA 1L1OA 2OQKA 4UPAA 4LFCQ 4KHPL 3M4OH 1JJ2A 4PMWA 4A3LH 4C2MH 3PUXA 3NBHB 3EBEA 4AR3A 1V43A 3PGZA 4X64Q 4L5SA 3TQYA 1T9QA 2K4KA 3TS0A 2JA6G 1V9PA 4X65Q 4DUZL 4TQUS 1JJGA 1FL0A 2NVYH 1B13A 3CPFA 4LUZA 5ELOA 5FLXc 2ZJRA 3PZAA 1Y14B 1IBLQ 4JI0Q 5C0XG 4GKJL 4DR4L 4OO1I 1CKMA 2I5HA 5FLMG 2NVQH 4DAMA 2IHFA 3A74A 4C3IH 5LMNW 1NMGA 4LF7Q 3UE0A 1L1OB 1H7VA 2K50A 3G6EA 4LUOA 1YJWA 2UXCQ 4QY7A 3RZ6A 5IY0A 1P8LA 4YCWA 2JA5H 1BVSA 1X65A 2UUCQ 1Q8KA 5IWAL 3NENA 4DV6L 2NZHA 4GN4B 4L5TA 4DV4L 2R93G 2L15A 1QVFA 1IROA 2R93H 3M4QA 1YK5A 3CD6A 3GTQH 2HQLA 3QVDA 4YHHL 1PH9A 3F2DA 4JI5L 2R92G 4JV5Q 1FHMA 3T1HL 1AE3A 1Q46A 2E5LL 1KL9A 4JC0A 5LMUL 2UUBQ 4LF5Q 4BBSG 4A93H 4A3KG 1O7IA 2OCEA 3UDIA 2WAQG 2FXQA 4GS3A 4JI1Q 1K8AC 1DGSA 1VQAA 3PF5A 1QCVA 1HNZL 4JCVE 2A19A 1HR0W 3BU2A 1X3GA 1TWGH 3JC63 2AKWB 1UEBA 1IRNA 2R6GA 2GVBA 1T9PA 1Q7YC 3HOYH 4AIMA 4A3MH 1YHQA 3WWVA 2CWAA 2N3SA 1LKPA 1WJJA 3CQZH 4LF8L 2AMCB 1RB9A 1SR3A 4OWWB 2HIVA 2IT1A 5AJ3Q 4JG2A 4A3BH 3I7FA 1GVPA 4P74A 2B63H 1UE6A 1Y1VG 2GN5A 4A93G 2PYAA 4R4IA 4LF6L 5J3BA 3ER0A 3CP0A 4QGUA 1N33L 1KXLA 1PH4A 3CF5A 4JBJA 1S30A 1PH2A 3RN5A 1VCIA 1HR0Q 4GNXA 4RXNA 3CCQA 4IFDG 4IOCA 2H5XA 3CCLA 3J7A5 3S14H 5BR8Q 2UUAQ 1WYDA 1E1OA 2F52A 3GO5A 4JI2Q 4B3TL 5M3MH 5C3EH 4GLXA 1MKHA 1QUQA 3I4OA 1Z9FA 4DPGA 3UDXA 1X56A 5JEAJ 3EN2A 5GAEC 1PHJA 3DLLA 2LXJA 1FVIA 2VZAA 3CCSA 2VQFL 4A3MG 3HOXG 1Y1WG 3I4NG 1QVCA 2E2JH 2HT1A 1Q1EA 2VQEQ 1HNXL 1XPRA 4GNXB 2MQHA 4DR6Q 5LMNL 1KAWA 4IPHA 5HGQA 2R7FA 5GAGC 3F2CA 2EXDA 1QUQB 1B2OA 1MJCA 5M3FH 1N36Q 4A3GH 1IBKL 3UDGA 1K73C 2D62A 1JB7A 3KF8B 2ZM6L 1E24A 2F4VL 4UP7A 4Y7NH 3CCMA 4DV2L 4HJ9A 1YBYA 3S1NH 3GDEA 4P73A 5GADC 3U58A 1YJNA 1E1TA 4AQYQ 3T1YL 5M3MG 3PIPA 5C3EG 4HJ5A 1HNWL 1VCXA 1W2BA 4IOAA 2KENA 2N78A 3F2BA 3BZKA 3S1RH 1PYBA 1RIPA 3ULLA 1XNRQ 2KCMA 1A0IA 1E7ZA 4X66Q 4X62Q 2ZJQA 1KRTA 3FHWA 2ALYB 3KF6A 1BRFA 3F1ZA 4IJLA 5M5WH 2MNAA 2ZTCA 1XMQQ 3S1QH 3GTJH 4LFBQ 1UE1A 1NBWA 2HHHQ 4A3CH 4LF9Q 3PUVA 4O2DA 4DKAC 4LF4L 2GVAA 2MFIA 1VQMA 3PO3H 1EWIA 3H0GG 1KIXA 5M3FG 3J81j 1JJCB 3RLNA 1WCMH 4EQ5A 2JEAI 4O0AA 4A3GG 4FDBA 1MIUA 4ME3A 1OXUA 1Q1BA 2BA1A 5IYCH 3OTOQ 1OTCA 2UU9L 1J5EL 1S24A 1R0IA 4GNXC 2RHQB 1HZCA 4DR5Q 3CC4A 3S2DH 4DV1Q 4DR2L 3HOWG 2HR5A 4JI8L 1YJ9A 3KF6B 1EFWA 2LXKA 1R0GA 3G71A 2XGTA 1EIFA 1S40A 2JA7H 4JYAQ 4DV3Q 4A3EH 4DNIA 5C0XI 1SRUA 4DV3L 1Q81C 1I94L 4K0KL 1EQRA 1PFSA 3PUYA 1PVOA 3I55A 2CQOA 4JI7Q 4X6AH 4DV5Q 3GTGH 4POGA 1B71A 2Z0SA 2R7ZG 4JBMA 2VUMH 1V1QA 1PH5A 4C3JH 5IT9c 1XMOQ 2PI2E 4WJ4A 5M5YH 4GKKQ 3W1BA 3CXCA 4OWTB 1PV4A 4UY8C 2Y0SE 4DR1L 3FKIH 3A0JA 5IYDG 2IX1A 3PO3G 3FP9A 3MPSA 1BBWA 2UXBQ 5ELNA 1WCMG 3W1GA 1NY4A 1CSQA 1X3FA 3K0XA 3TEHB 1PH1A 1YUXA 1K9MC 1E22A 6RXNA 4MZ9A 1FJGQ 4PZ8A 5IP9H 2NVTH 4KLKA 1PH8A 4JI3L 1PH6A 4BY1G 2RDVA 1I3QH 2YTVA 3GTPH 1Q82C 4OONA 3ERSX 3SS2A 3K8AA 4DR3L 4A3LG 3KFUA 1IBMQ 2AHOB 3GTLH 3E9HA 4GN5A 5GAHC 1VQOA 4EX5A 1Q86C 4YWLA 4HIOA 4JI4L 1RYTA 1VQ5A 4DR7Q 3PV0A 4JBWA 2K5NA 1SMWA 4LFAQ 2PVEA 1NE3A 3DM3A 4BA1I 3G4SA 2DUDA 5EAYA 3GTOH 2K5VA 3KYHC 3HKZG 5C4JH 4DV0Q 4BY7H 4K9FA 1N34L 4NB3A 4OO1G 2IY5B 4YY3Q 1IXRA 3CCRA 1VQ6A 1FHHA 1XNQL 2EQSA 1I5FA 2VY3A 1HZAA 1QVGA 4C3HH 4TPUA 3KJOA 3PIOA 3KJPA 2JA5G 5JJIA 4LFCL 4R4QA 5E7NA 3OW2A 4UP9A 1D7QA 2I5LX 1U0LA 4LW1A 4AR6A 3D0FA 3UDFA 2M4YA 2ES2A 1L1OC 1P16A 4X64L 4JI6Q 3K81C 1VQ4A 1ZRPA 1S2ZA 1HZ9A 1Q12A 1HJPA 1YVCA 5HY6A 4X65L 2K5HA 2AWOA 2V1CC 3K7UC 4OWXB 2PQAA 2ATWA 4R4CA 2WB1G 3KDFA 1EQQA 4JI0L 1A62A 2XTIA 1R9TH 1IBLL 1IU5A 4NXNQ 1CADA 2OQ0A 5GROA 4BBRH 4HIDA 4A3FH 3H3VI 1TWAH 2B3GA 3KYWA 5AI2A 2E2IH 1H95A 4LF7L 2KHIA 4DK3C 1XJVA 2OWOA 3S17H 1X54A 1OXXK 2CKZB 3G48A 4AR5A 1VQKA 8RXNA 4B3MQ 4BY7G 1TWFH 2JE6I 2QA4A 1UE5A 1RL2A 3HFZB 4GN3B 4TVAB 1EOVA 2E8GA 4GOPA 4AR4A 2UUCL 2PQAB 3RR5A 3KDFB 3GTMH 2B29A 3HOVH 3A5UA 4HJAA 2E2HH 2WAQE 3HOYG 1CSPA 4APVA 3S15H 1BKBA 1XTDA 1XPUA 5K36G 5IYBH 4DV7Q 3ULPA 2UUBL 2K2DA 4LF5L 1N32L 2YYZA 1KD1C 4A3BG 1K3RA 2JA8H 3B6YA 4DUYQ 2VS1A 1LKMA 4GOPB 4DR7L 4JI1L 4B3RQ 2B63G 4RG1A 3L2PA 3PO2G 4DK6C 2AWNA 4AYBG 4A3FG 2BH2A 1PYSB 3NEMA 3J80i 2ZJPA 4MNOA 4DV0L 2JK8A 4Y52H 1E3PA 3CCVA 1GD7A 2NN6G 3L0OA 3JC62 4OX9Q 4BA2I 4KHZA 2IX0A 1FGUA 4DUZQ 1LUZA 4IJHA 3J7ZC 3S16H 3KYVA 5H1SE 1N9WA 5RXNA 4LWCA 5IP7H 1G6PA 4GKJQ 4UP8A 3KYUA 4DR4Q 4KI0A 5AJ3L 1UE7A 1KC8C 3RN2A 3I4MH 2DGYA 1I50H 3TRZA 3IRBA 3A44A 5IYBG 1IYJB 2A8VA 2QGQA 4AH6A 5FJ8H 1SMMA 1K8GA 2GMGA 5JEAG 1G291 4IFDI 1LTLA 1R0FA 3KLWA 3CC2A 3LGJA 3J81i 3PF4A 2D0PA 1X9NA 1HR0L 3AFPA 5C0XJ 3STBC 5IWAQ 2LCQA 4GLAC 4DV6Q 1LM0A 1WFQA 4L5QA 5BR8L 4DV4Q 1EUJA 2UUAL 4A3IH 4JI2L 2F3IA 3GD7A 2N49A 1BE7A 4H02A 4PG3A 4YHHQ 4POFA 1KHIA 4JI5Q 1KRSA 4GOPC 1NTGA 3RZTA 3I2ZA 3T1HQ 1VQ9A 2E5LQ 2NVXH 4P71A 5LMUQ 3D31A 3RLOA 3JC66 5FLMH 4HJ8A 1YV1A 5DLQE 1DX8A 1TWHH 2Z6KA 5C44H 2VQEL 1SN8A 1SMUA 1NNQA 1T9OA 4DR6L 1OXTA 2RF4A 1QZHA 1N32Q 4IPCA 2BH8A 1YI2A 1HH2P 3GTKH 1Z47A 2WFWA 1HNZQ 4IO9A 1D8LA 4YCVA 5FJ8G 3PSIA 1U5KA 1C7YA 4A4IA 1N36L 4A3CG 3K7AH 1VQLA 3BZCA 3CW2C 3RYGA 1BFYA 2C35B 4MTNA 1VQGA 2R92H 1SMXA 4OX9L 5IYCG 3MEFA 4J15A 4AQYL 4A3IG 2IHEA 1OXSC 4LF8Q 3RNUA 4BBSH 3E0EA 3K80C 1LYLA 3U50C 4HJ7A 2RHSB 4A3KH 4LNQA 2QL0A 2CFMA 2D0OA 2CCZA 2JA7G 1XNRL 1A63A 1DVBA 1S3OA 4X66L 1B8AA 4YCUA 3UE1A 4X62L 1TXYA 3F8TA 3JAMc 3I56A 4A3EG 5C44G 4LF6Q 1N33Q 4BXXH 1PH3A 1CAAA 1XMQL 4LFBL 2ASBA 1IZ6A 2HHHL
chains in the Genus database with same CATH superfamily
4ABNA 1JE5A 1EL0A 5J39A 3C2PA 3TN2A 4F88A 1SAPA 3R3OA 3URYA 3LNLA 4QUFA 1IHZA 4DR5L 4DV1L 4PZ7A 4ZLTF 1JORA 1Y1VH 3KYYA 5C4XH 4JYAL 5LMNQ 1AN8A 4QB4A 2KHJA 3J80c 3Q24A 4FXDA 1SFOH 4A3BB 3H3VH 1O7ZA 3ZYYX 1W3SA 1SNQA 2Z6KC 2JI2A 1YUZA 3V96A 2I0QA 3CC7A 5AN9H 5DM61 4I7ZC 5H1Sc 3S24A 3MXNA 1QE6A 5FLML 3LPEB 3JAMi 4EQOA 4OXPA 3S2HH 1NMFA 2JJQA 5IODA 4NXMQ 4JOIA 1CUKA 1E8JA 1FJGL 3GTMB 2PI2A 5IT9E 4CJ0B 3CRLC 5M5XH 5GAGc 3KYXA 2F0VA 2E2JB 3VDYA 4N9PA 1IBML 2MJ8A 3HKZE 4QIWE 4QF4A 3HOUG 1SLJA 3JAML 5GADc 1GUSA 4FXKC 3PWFA 2ICIA 1BQ8A 4DR2Q 1CHQD 4YY3L 2NZOA 1FD7D 1RWDA 1B1ZA 1HQMC 2KKDA 1CI3M 2CWPA 2PSMC 1F9QA 5C4ZA 4TVMA 1I94Q 3K57A 1L0WA 3HOVG 1A3UA 3FDTA 3VR5A 1ICFB 4XQQA 1JCKB 1JYBA 5FO7B 2VL6A 3RZDH 4AI1A 5C5LA 4L63B 2OTLA 2VNUD 3U4ZA 1U4PA 1CKOA 4DR1Q 2JA8G 1TQOA 3BDLA 2OEOA 3HOUL 1VQPA 2HD3A 4B3ML 1HFNA 4QL5A 4A3IB 4A3JG 1BCPC 5IIFA 1GO3E 2JA6H 2Y0SG 4DR3Q 1STEA 1VQNA 4JOIC 1R0JA 3BVMA 3BS1A 3SE0A 1F9RA 1TWHB 3FPUB 3RZOH 3ICEA 3TREA 3J81L 4DV7L 3NBHA 5IP7G 2Z1CA 4B3SL 1VZIA 1I4QA 4R8IA 3S1MH 1R0HA 3GTKB 1J9OA 1SNOA 1X32A 1B44D 2ZTEA 3I4MG 1N34Q 1B7YB 4BWGB 1M90C 1VQJA 1JWMD 1M1KC 2Q2UA 2CR8A 5MLC3 2OQKA 4UPAA 4LFCQ 3I70A 5EGTA 3PGZA 1IKLA 1Q3LA 4X65Q 3CPFA 1B13A 5JVG3 3GTLB 4A3JL 2X6GA 2ZJRA 2O4XA 1CKMA 5KYIA 4DAMA 2IHFA 1NMGA 4G7ZC 5I9OA 2V0EA 2K50A 3G6EA 4FO2A 1RODA 3MHBA 5C4JB 1B4OA 1Y8PB 1X65A 2UUCQ 1NXEA 4GZYC 4DV4L 3NE5B 1F2YA 1IROA 3M4QA 4KK7A 2K5WA 1L0XB 1PTOC 2HQLA 4YHHL 4JI5L 1VZGA 3NSWA 2CH4W 1AE3A 2UUBQ 3R2TA 4A93H 1O7LA 1O7IA 2FXQA 1JR0D 5DM71 2TSSA 1GUGA 4BBRB 5C3XA 4PNYA 3V2TA 4JCVE 3MXGA 2XJRA 1X3GA 4A3DB 2L0ZA 1WTWA 3HOXB 4WORA 4AIMA 3I4NB 4AI2A 3M3YB 5IYDL 5K36H 2JXMB 3HAXC 2AMCB 1SR3A 2KA7A 1DD2A 2HIVA 2IT1A 4A3BH 3S15B 1QWYA 3NWSA 1Y1VG 2GN5A 3IL8A 2EYPA 3CP0A 3NPPA 1D1IA 1KXLA 1EU4A 2QDLA 3RN5A 3CCQA 3J7A5 1WYDA 4B3TL 3IKJA 4NDXA 5M3MH 2AQ1B 5C3EH 4GLXA 1MKHA 1QUQA 1D5XC 3HOZB 2NVQL 1Z9FA 3KLSX 1X56A 5JEAJ 3B0AB 2VZAA 4K6DA 5EIOC 2B2VA 2Y0SP 4A3MG 5T1GA 1ZYRC 1QVCA 2E2JH 5ELCA 3VYRA 2JA5L 3VYTA 5FKAC 1EOTA 1KAWA 4IPHA 2R7FA 1D6EC 4NMZA 4ZQ3A 5GAGC 1IKMA 2EXDA 1FNUA 5D3DA 1C8CA 3GTQL 3AB9A 2CQAA 3UDGA 2D62A 1JB7A 1T5XD 2F4VL 3A7LA 2F0IA 1KLGD 4HJ9A 1YBYA 3IFDA 3MEHA 4P73A 5GADC 1E1TA 2EVBA 1PRTC 4AHYA 2N78A 1S5BD 2F0SA 3F2BA 5DEHA 1PYBA 1RIPA 3OWFA 3ULLA 2KCMA 2XRQD 5C4HA 1A0IA 4X66Q 1BRFA 4ZN3B 2ENBA 4IUTA 2L9HA 4MHEA 3NTIA 2YU9B 4A3ML 1NBWA 4RGNA 3HZXA 3CQZL 1VQMA 1EWIA 1LO5D 4O42A 2H4OA 1JJCB 4A3GG 1MIUA 1OTCA 2UU9L 4AI0A 1R0IA 2RHQB 1HZCA 4DR5Q 3CC4A 4DV1Q 1YJ9A 3KF6B 3M4OB 3TMEA 2O5JC 1R0GA 1LTRD 1KTKA 2C6AA 2K05A 4JYAQ 1DCZA 4DV3Q 1LACA 4K0KL 2NVYB 2BDNA 2B2VC 2JYOA 4POGA 1V1QA 2N88A 5CBAE 2R61A 4C3JH 5EJWA 4KD3A 3QB3A 1BO0A 4RAUC 3W2DA 3A0JA 3LWPB 3J7YW 2PPBC 1STNA 1UAPA 1WCMG 1PH1A 1FJGQ 1YUXA 6RXNA 2A5HA 3H91A 1PH8A 3T56B 1PH6A 2SNSA 2RDVA 4QUCA 4A3GL 5KEEA 4LMQD 3K8AA 3SS2A 4OONA 2KVMA 1IBMQ 2XJVA 4TKOB 1S5DD 3GTLH 1ESFA 3QOJA 4EX5A 1CA5A 4JI4L 1HFGA 4MIUA 4DR7Q 4JBWA 2K5NA 1NXGA 1EWHA 2RVLA 5I2XA 3NBIA 2PMZB 5BN3A 5C4JH 3HP3A 4DV0Q 3BDCA 2ZT9C 4YY3Q 3J7Y1 1TWGB 3M7GA 2F0UA 3EA6A 1QVGA 4FNFA 3KJOA 5JJIA 2M4VA 3PIOA 2X69A 4A3CL 4K5XA 1D7QA 4R4QA 5C5MA 2I5LX 1PZXA 5HURA 3K81C 1WCML 1Q12A 5HY6A 5IYCL 2EYLA 5I6YA 2B63B 4JI0L 1IBLL 3H3VI 1IU5A 3DHQA 4BBRH 4AYBB 4A3FH 1EY7A 5AI2A 2KEEA 1XJVA 2B2UA 2Z8LA 2F0TA 1XYIA 2RDFA 2A74C 4AR5A 5NUCA 3P75A 2A73B 3S14B 4B3MQ 4XT1B 1QNUA 4H13C 1PVOA 2KHSA 2E8GA 3GTGL 1MI2A 2VUML 1U4LA 3R2IA 2E2HH 5M5YL 1STAA 1CSPA 3LWOB 1J8IA 3S15H 2IWHA 1XTDA 5K36G 4DV7Q 1N32L 4A3BG 5IP9L 1I3QL 3GTPL 5M3FB 4DK6C 2AWNA 5KNBA 2BH2A 3NEMA 4MNOA 3VA5A 1E3PA 4CGYB 3CCVA 3S1NB 1SE3A 2NN6G 3BVGA 4OX9Q 5COYA 4BA2I 4KHZA 4UDUC 2Q8TA 2IX0A 3GTOL 1RJTA 3A8KE 1PMRA 4CKBA 2NB0A 5RXNA 3L9AX 4RGMA 1LT3D 4G7HC 5AJ3L 1UE7A 1KC8C 4PQXA 3RN2A 2PPTA 1TU2B 2DGYA 3TRZA 1Z6HA 3S1QB 3GTJB 1PZID 4FXGC 1SMMA 1BNZA 3DWAA 3NTKA 1K8GA 1LTLA 4TRDA 2D0PA 1HR0L 5A35A 1E2ZA 1ZKOA 2F0PA 2HUGA 4ZRZA 4DV4Q 3S2DB 2IJ0A 4YHHQ 2SDFA 4JI5Q 3S17L 3I2ZA 5C0XH 4P71A 3K59A 1F9PA 1LTGD 2MGSA 3D31A 2DN8A 4X3KA 5FLMH 1PFWA 2M2LA 5K2ME 3LNNA 4O1NA 5C6AA 1T9OA 2F0HA 1LTID 3GTML 3J7AF 1HH2P 3HKZB 2N55A 5ELFA 4QIWB 4I65A 5FJ8G 1U5KA 1N36L 1VQLA 1U4MA 3RYGA 2JA5B 4FF4A 4MTNA 1VQGA 3QJYA 2L0CA 3A56A 4A3IG 2CH4A 3RNUA 1LYLA 3U50C 2EY1A 2RHSB 4MTKA 2CFMA 2D0OA 1G2SA 1QCBD 4X62L 3JAMc 1SJHD 2KOLA 3C1EA 3ZG6A 2ASBA 2HHHL 1VS0A 4KJOA 3G7LA 4B3TQ 1RDVA 4Q5VA 4BY7B 1MHWC 1A3VA 3I72A 3PQIA 1HHVA 2D5DA 5FJ8L 4ALPA 1VQ7A 3D4WA 1C9OA 1J6QA 3DUZA 2VW9A 3HOUH 3DMUA 2PNHA 4A3IL 1VQFA 3J7AV 2Q2HA 3SGIA 1R9TB 3M7NA 4JI7L 3RD4A 1VQDA 2F4VQ 1JE4A 1HQRD 3AYHB 1SNPA 4GKKL 4IPGA 1GUOA 1TWHL 2F0OA 3M85A 2ZIXA 3E9IA 2UXBL 2F4IA 1PA6A 1PFNA 2QEXA 1U4RA 1RTNA 2F0WA 4QQBX 3GTKL 1YNNC 3I4LA 3EIVA 4K8IA 3WDNA 5JJLA 4V0BA 1ET6A 3BVZA 4IPDA 4JBKA 4XXBB 3J81c 3Q8DA 3CPWA 3STBD 2F0QA 1BXTA 3A5ZB 1AZPA 3OPOA 3CAMA 3BYTB 3CMAA 1HCZA 3AFQA 1ASZA 4BBSL 5ELEA 5EBCA 2ID0A 3AQQA 4BBRG 1I4PA 1EZ6A 2JEBI 2NN6I 2UU9Q 4A3JH 3VR2A 2Q2IA 1CKNA 1B70B 1S5CD 1VQEA 4A3DG 2MO0A 3AU7A 4I7AA 3VYSA 3CMEA 1WJVA 1NR2A 2EY2A 1YZ6A 4IN3A 5E4XA 1ICWA 5IGGA 4IFDJ 4K0KQ 1CM9A 3NELA 3CCJA 4JI6L 2WACA 4LHNA 1G91A 2Z3RB 4XGHA 1WOCA 3KBGA 2IL8A 1VQIA 2K14A 4DAYB 5JAVA 2PMZE 2DNEA 1QQTA 2EDGA 1JT8A 1EY5A 3WWLA 4R4OA 2KBNA 1F2MA 2JQOA 3PUWA 1DM0B 1NSNS 2F3WA 5AI3A 4ZKCB 4DAPA 3HOZG 3X3MA 4P2CB 1UWVA 4XXEA 1X3EA 1KAAA 4HMJA 4K2LA 5JVH3 4A3DL 4JI4Q 1HA5A 5C44B 1Q90A 2PCFB 4AYBE 1YEZA 4RH6A 3DWQA 1BQQT 3HOXL 3I4NL 3M3YL 1DOKA 3TSSA 2VUMB 5IYDH 1TKWB 4DN4M 1WI5A 4B3RL 1YHBA 5CYUA 1VF7A 3HKSA 5M5YB 3K7AB 4R8NA 3V05A 2DSXA 1L1OA 4KHPL 3CRKC 1QOHA 4HN7A 4L5SA 1T9QA 2CW0C 2K4KA 5DNFA 3TP5A 4DUZL 4A3KB 1JJGA 1RTOA 2RSOA 5ELOA 4JI0Q 3HEJA 1WTXA 1IBLQ 5C0XG 3HOZL 3GV3A 3OWEB 5DM63 5FLMG 2NVQH 4U68A 3FPPA 3A74A 5JVH1 5LMNW 1H7VA 2XWBB 1YJWA 2B39A 3GTOB 4HR7B 3K5LA 2EJFC 2JA5H 4YCWA 2NZHA 4L5TA 5ISRA 2NTTA 2VXWA 1YK5A 1HTPA 3GTQH 1B3AA 4IUQA 1PH9A 3QVDA 4KY7A 3NP8A 1G8ZD 5CV9A 1N32Q 3HOWL 2E5LL 1KL9A 2A6HC 2OCEA 3T16A 3UDIA 1VMCA 2NTSA 1TR5A 1K8AC 2BOSA 1DGSA 1RF2D 2OF1A 1VQAA 4DU9A 1HNZL 3S17B 2A19A 1HR0W 2R7ZL 3BU2A 4PV1C 5CMDA 5LL6S 3PIO3 4OEMB 2YU9L 1Q7YC 1I6HB 4A3MH 1YHQA 1Y1WB 3WWVA 1B9NA 2CWAA 2N3SA 4RHSA 3OMGA 1LKPA 3CQZH 4LAAA 3SDZA 4LF8L 3NFPI 1F4LA 4OWWB 5AJ3Q 4JG2A 3H3VM 4CDCC 3IU3I 3KLRA 4BY1L 2F0DA 4U671 1PZKD 3M4OL 2PYAA 1A2UA 5J3BA 4QGUA 2KQ3A 4OIJA 4JBJA 1S30A 1HR0Q 1VCIA 4GNXA 4RXNA 2KCCA 4IOCA 2NVYL 1CK1A 1E1OA 1TS2A 4J1MA 3I4OA 3FDJA 1EEFD 3UDXA 5GAEC 4C3IL 1PHJA 3VR3A 2LXJA 4TSSA 3CCSA 2VQFL 3PIO1 3MWYW 1NCVA 1Y69U 2HT1A 2K5QA 2MQHA 1E0BA 4F87A 1CQFA 3F2CA 2E2IB 2R93L 3H0GB 1MJCA 2XRSD 1A2TA 4OGQC 1N36Q 1IBKL 4A3GH 5FK9C 2SOBA 3KF8B 2ZM6L 4IALA 4DV2L 3IFTA 3J80E 3GDEA 3LWQB 2RA4A 2KCNA 3T1YL 1TWCB 2QKIC 1ONLA 4JAEA 2E76C 1W2BA 2KENA 1Z7TA 4L8JA 5E1FA 3K5MA 3EQLC 1E7ZA 1TWGL 1V1PA 4X62Q 1KRTA 1GUNA 2ALYB 2A6EC 3F1ZA 4IJLA 4WJWA 4Q0FA 3HOYL 4YIJA 1UE1A 3CU7A 2HHHQ 1IL8A 1SYFA 4A3CH 3PUVA 4DKAC 1K83B 5M3FG 4K5WA 3J81j 1VDZA 1WCMH 2JEAI 4O0AA 5IYCH 4ME3A 1MSHA 1OXUA 1J5EL 4GNXC 2B63L 4V190 2KJXA 2XSCA 4JI8L 1I4HA 1ILPA 4KKUA 1S40A 2VB3X 1AZQA 2M9VA 4BBSB 3S14L 4DNIA 5C0XI 1SRUA 2C9OA 5DM73 3PUYA 1DYQA 4JI7Q 2EJGC 3GTGH 1B71A 2VUMH 5MGNA 1PH5A 4WJ4A 3SK6A 4WRDA 5M5YH 4GKKQ 4OWTB 5IYDG 1DJRD 2DNCA 3MPSA 1BBWA 2UXBQ 1NY4A 1X3FA 3VA7A 5IP9H 4JI3L 5M3FL 1I3QH 1RKNA 2Z4IA 5EKKA 3GTPH 3QQCE 3OSOA 3E9HA 1YNJC 3S1NL 4CDEC 2KECA 3LX0A 4HSVA 3H09A 5J22A 1RYTA 1VQ5A 2K04A 3MVVA 3PV0A 1SMWA 4RA8A 3GTOH 1SJED 2EY6A 1LT5D 3S1RL 3SHLA 3HKZG 1FNVA 1JC7A 3CCRA 1IXRA 2EZVA 1VQ6A 3I90A 2PMZP 2AUSB 3S1QL 3GTJL 2FHTA 2JA5G 3OW2A 5E7NA 4LW1A 3B08B 1K0SA 1JOOA 4AR6A 2A69C 3UDFA 2M4YA 4FVMA 4JI6Q 4JV5L 1VQ4A 1ZRPA 1Q8IA 2V1CC 3K7UC 4OWXB 2ATWA 3S2DL 3KDFA 1G2TA 1A62A 2XTIA 4HIDA 3BZDB 2M6OA 2JA7L 4DK3C 3S17H 2CKZB 1X54A 1OXXK 1KLUD 1VQKA 1GHJA 4AYBP 5IT9L 1H9MA 2NN6H 1WTQA 3NWTA 4BY7G 5MFPA 1M4VA 2QA4A 4TVAB 1RL2A 4GOPA 4X6AL 1MGSA 1R4QB 2PQAB 2AQ3B 3VPBE 1G6ZA 3H3VC 3GTMH 3H6MA 1OO9B 2RDGA 3A5UA 2WAQE 1EWCA 3OOCA 4JK1C 3FKIL 1BKBA 2PW7A 1XPUA 1SNDA 4FP5D 3ULPA 1BF4A 2K2DA 1NAPA 4RCOA 1KD1C 2WINB 4C1NK 5MFZA 4JI1L 4B3RQ 2LY7A 1PYSB 3J80i 2OXPA 4EGVA 4Y7NB 2BE5D 2RSNA 1B9MA 1GD7A 4F8MA 3HOWB 3JC62 5KNDA 1B50A 3FVQA 3E0JA 3MSUA 2MP1A 3PKIA 5C3WA 4DUZQ 4FF2A 4ZK9B 3MZ5A 4BY7L 1II3A 3J7ZC 1JOQA 4OHJA 2K6AA 1G6PA 2Z3QB 3KYUA 4KI0A 2R7ZB 1V8QA 3J80L 2D9UA 4B8CD 1K8OA 3IRBA 2L55A 2K5DA 5G3LD 5FJ8H 3D3RA 2GMGA 2NWGA 5JEAG 1R0FA 3PO3B 5G3LF 1KABA 3STBC 2HCCA 2VB2X 4GLAC 2Z4HA 5BR8L 2UUAL 4JI2L 4A3IH 1R9TL 3GD7A 4OELB 4UAIA 4BY1B 1CZWA 2F0LA 1KHIA 5KIXA 4GOPC 4HCSA 3RZTA 4C2MB 5IGDA 4PMCA 1VQ9A 2E5LQ 4ID6A 5BN4A 5E3FA 4A3EB 4JAGA 1TWHH 2VQEL 1ZEQX 1SMUA 1NNQA 2AQCA 2QF7A 1JB3A 5EPKA 3T51B 4DR6L 3TP6A 1H9SA 2LFNA 1QZHA 1KDBA 1EQTA 2BH8A 1YI2A 3GTKH 2EPBA 2WFWA 4C3IB 1HNZQ 4HAEA 3PSIA 4A4IA 4A3CG 2PQEA 1LT4D 2JI1A 3C1FA 3HKZP 4QIWP 1BFYA 2C35B 3D6WA 1EYDA 1EY4A 1O7YA 5IYCG 5GAHc 2A68C 2NVTB 3MEFA 2GA4B 1PFMA 4J15A 5IGBA 1OXSC 3S9WA 4AQYL 4LF8Q 2R93B 4BBSH 3K80C 2EXZA 2QL0A 1HPCA 4Y52L 2CCZA 1D5MC 1XNRL 5KNCA 1A63A 1B8AA 4YCUA 3UE1A 1TXYA 3F8TA 4RCNA 5C44G 3R93A 1PH3A 4RGTA 1IZ6A 3PL5A 3S16L 2VUMG 3T53B 2V0FA 3OYYA 3TS2A 2HIXA 3ULJA 1IYUA 4C3HB 2DY7A 1E2VA 1EIGA 2HCIA 4XTCS 3HOYB 2VQFQ 2G5DA 1FNWA 1EEID 4YWMA 2TMPA 5IP9G 5CR3A 3AMUA 1GXDC 1EY0A 1EY6A 3CCEA 1BBUA 4FYDA 3PO2B 4DV5L 1IBKQ 1TWAB 2ZM6Q 4BXXG 2NVXL 4DV2Q 4XT3B 1PH7A 4R1JA 3BJUA 1STGA 2JA9A 1SE8A 4DK1A 4A3DH 5C44L 1TWFB 3T1YQ 1VF5C 1S72A 5FLXE 4IQZA 1EQVA 5DAUA 3HOXH 1NR4A 3I4NH 3M3YH 3P8BA 1VQBA 1OWBA 2MHVA 3HOVB 4KTAA 2G9HD 3K7AL 3MXNB 1BCPB 1IU6A 4B3SQ 2R92L 4KV6A 1WD1A 2JA8B 1CFMA 2LKVA 4R4TA 5IOCA 4LFAL 4A3KL 1BCPF 3HG9A 4WJ3M 4P72A 1J5EQ 4NPSA 4XIGS 3SXHA 4A76A 4JI8Q 3HOZH 3BYYB 3W5OA 4BXXL 1SMYD 3NK9A 3A8JE 2WB1E 3K0YA 2ZTDA 4G4KA 2KEDA 3S1RB 3I73A 3L7ZC 1ENCA 3I4MB 1JOKA 2D2CC 2K1BA 3P1HA 1BR9A 5GQOA 3H15A 4IFDH 1PFBA 1QNKA 2EIFA 1B2JA 1AE2A 1EYGA 2OTJA 1AH9A 5JJZA 2F0JA 3AEVA 4HIKA 2G9DA 2WP8J 3HOWH 2F3VA 1K3BC 2ICEC 2LSSA 3R8BA 2B2UC 1KQSA 1NJIC 4JI3Q 3ZJYC 1Y8OB 2PNRC 2YTYA 4NXML 4YWKA 3DEOA 3PCOB 2BCOA 3KBXA 1I4XA 2BA0A 1GUTA 3HRZC 2JA7B 2Q2TA 1A15A 3M4PA 1EY9A 4DGZA 2R7ZH 3U4VA 2PVXA 3SK8A 1R4PB 1I6HL 1YITA 2YU9H 4FF3A 1Y1WL 4R9WA 2H12A 3K5OA 2V3BB 1PTOB 4P75A 5JJKA 4LUVA 4L5RC 1PTOD 1IL2A 3LWRB 1I4RA 4QJFA 2J9UB 1WTOA 2B2WA 3LWEA 1CA6A 2YTXA 1PTOF 3FKIB 4A75A 4RWSC 4BY1H 1EIYB 1F77A 4GLVB 4FF1A 3M4OH 4C2MH 3NBHB 4JV5Q 1UNSA 3TQYA 1DONA 3TS0A 1TS5A 1F2ZA 1FL0A 2NVYH 4LUZA 3PZAA 1Y14B 4GKJL 1DZ1A 4RFBA 5IGFA 1WTPA 4C3IH 1IW7D 1P7PA 1SEBD 2FFKB 2CKCA 3ND8A 2M6PA 3RZ6A 1AFPA 2RQXA 1SSOA 3MXUA 1S5ED 4HTHA 4GN4B 4DV6L 2E2IL 4CJ1B 2L15A 3H0GL 1QVFA 2R93H 5T1IA 2APOB 3CD6A 5D14A 4AHXA 4OIKA 4ZYSA 1FHMA 4N8FA 3T1HL 1Q46A 1HTLD 1Y1VB 4JC0A 5C4XB 4BBSG 1PXUA 1SFOB 4G6BA 1TWCL 1I4GA 4JI1Q 5EKIA 5EINC 1QCVA 2JN4A 1ZYRD 3TDQA 1TWGH 2XN9C 3JC63 1H9JA 2AKWB 2QEJC 1CQVA 1IRNA 1UEBA 2R6GA 2B2WC 3WOEA 3HOYH 2HQEA 2H1EA 2RDHA 5FOBB 1K83L 1WJJA 1ENAA 1RB9A 5M5XB 4DK0A 3I7FA 1GJXA 4P74A 4CHTB 1FGBD 1VMPA 3K5NA 4EQPA 2B63H 1PRTB 1UE6A 2Q8RE 5FLXL 3FRPB 4A3LL 4R4IA 1PRTD 4AHZA 4LF6L 1WTRA 1N33L 5A2QE 2SNMA 1PH4A 1PRTF 2H5XA 3CCLA 3S14H 5BR8Q 2UUAQ 4JI2Q 3GO5A 2LS01 3NTHA 3PMFA 4DPGA 3DLLA 4HMIA 3T13A 2FMCA 2JP1A 3J7Z1 3HOXG 3I4NG 5CV4A 4NP5A 3SVMA 2VQEQ 1HNXL 2QILA 3MXPA 1XPRA 3S16B 2EYOA 4M8AA 5EKLA 4DR6Q 5HGQA 2I46A 5ELDA 1QUQB 3U9SA 1B2OA 3RZDB 2O5JD 4HEDA 3VR6A 5M3FH 1K73C 4WFN3 4CDDC 2K32A 3CCMA 4E6YA 3SK4A 3VR4A 5I4DA 2AQ2B 3S1NH 3K6OA 3H97A 3BG3A 3U58A 1YJNA 1A6XA 4OL7A 4AQYQ 2K28A 3PIPA 3QWNA 1HNWL 4B9WA 2JA6B 4IOAA 1EY8A 1VZHA 3BZKA 3S1RH 1UEAB 4KMUC 1XNRQ 2NVXB 3E6ZX 5CC4A 1HXYD 1HUMA 1PZJD 1XXGA 5JOBA 3FHWA 1L0YB 3KF6A 2ZTCA 3S1QH 3GTJH 5TSSA 4LF4L 3S1MB 3HS0C 2ZXOA 1EU3A 4KJNA 3RLNA 4IFDG 4FDBA 1Q1BA 2BA1A 1GOZA 4HCEA 3VYUA 1S24A 3S2DH 1C48A 1HUNA 4CKEA 4WFN1 2NYDA 3HOWG 2HR5A 2K7VA 1KDCA 2R92B 2LXKA 2F0KA 3A7AB 4DAVA 2XWJB 2JA7H 3OMCA 5AFWA 4K8JA 2WAQB 1UUPA 4K5VA 4X6AH 4DV5Q 3TBIB 2Z0SA 2R7ZG 2J7ZA 5IT9c 2PI2E 3HGBA 3W1BA 1H9RA 3CXCA 1TS3A 1PV4A 2RCFA 4UY8C 2L12A 3HJWB 2Y0SE 3FKIH 1F9SA 2UXDL 3PO3G 5ELNA 3W1GA 1CSQA 3K0XA 1LTTD 1E22A 2AUJD 1LTBD 4BY1G 3QOLA 1TVXA 3E5SA 5L37A 3ONAB 4U673 3U9OA 3LWUA 2EYHA 4X3SA 4Y7NL 1VQOA 4DFAA 4A93B 4KY5A 4YWLA 3TZDA 2EY5A 4AHWA 4LFAQ 5IGCA 1NE3A 4LJZC 4BA1I 3G4SA 3F2UA 2K5VA 2RBMA 1PLFA 2V4DA 4C3IG 4BY7H 2B8GA 2DJGC 2IY5B 3A54A 4DNTB 1FHHA 4AI3A 5M5WL 1XNQL 1HZAA 2AYJA 1BDOA 2RKSA 3MTSA 1U0LA 3K35A 1STBA 3PO3L 4CKCA 2ES2A 1L1OC 1P16A 4X64L 2R93G 1SYCA 1HZ9A 2CVRA 4DV3L 1HJPA 2K5HA 2AWOA 2XIWA 2Z6BA 4R4CA 1EQQA 1R9TH 1DOMA 1I6VC 4V196 1CADA 2OQ0A 5GROA 2J0TD 3H94A 2XJSA 2I07B 2L11A 4LF7L 2OWOA 3G48A 1RCVD 3QIAA 4JAFA 4A3EL 8RXNA 2IPKD 2JE6I 5M3MB 3KK7A 5C3EB 1TY0A 1EOVA 3RR5A 3NXWA 1ENFA 3NUCA 4C3HG 1H9KA 4HJAA 1SYEA 3HOYG 5A2QL 3T4AC 1DXMA 3OIQA 1LV9A 3LWVB 4LF5L 2YYZA 3P7JA 2F0NA 1EFID 5JEAH 2NVTL 4DR7L 2VS1A 1LKMA 4S3SA 2O5IC 3JR7A 2B63G 4RG1A 2O2LD 3L2PA 2M00A 3PO2G 4ODGA 4AYBG 2PO4A 4MN3A 4DV0L 2JK8A 4JPBW 4Y52H 1JQYD 4CJ2C 1OWCA 2HDLA 5M9OA 1EZ8A 2AUKA 5CV7A 4J8QA 4KY6A 5JPNC 3KYVA 4K14A 3S16H 5H1SE 3Q0AA 4GKJQ 2PZUA 2MPMA 4IUVA 4C3HL 1CT1D 4IZ8A 1RYQA 1T5EA 5ELBA 3X3NA 5IYBG 2QGQA 1O78A 5JPMC 1G291 3SR1A 4IFDI 3PF4A 3KLWA 3CC2A 3J81i 3TP7A 1BUVT 4DV6Q 1LM0A 4EQNA 1EUJA 3IAYA 2L5TA 2F3IA 1HRJA 2N49A 3PO2L 4F7XA 4H02A 1TWAL 4PG3A 1KRSA 1SE2A 3T1HQ 4N9TA 2NVXH 3DXJC 3RLOA 3JC66 1YV1A 1DX8A 3Q22A 1TWFL 5C44H 2ERSA 1SMYC 2NUCA 1OXTA 2RF4A 1TY2A 3HOVL 1Z47A 4C3JB 2EYJA 1SNMA 1D8LA 2K01A 4YCVA 3K7AH 5CV5A 4ZAIA 3BZCA 3H9CA 1ESRA 2EY4E 5IYBL 5KRUA 2R92H 2EOTA 4OX9L 2JA8L 2IHEA 3E0EA 4A3KH 1SYGA 2DJFC 2WB1B 5LHY1 2CKAA 1SXTA 2JA7G 1S3OA 4LF6Q 1LTSD 3I56A 1W6KA 4BXXH 3GV6A 1N33Q 1XMQL 4LFBL 4OO1G 1YNND 4LF9L 4ZN1B 1AW7A 1L2FA 5IP7L 2MO1A 5MF6A 2KCTA 1C0AA 3OTOL 3I4ML 3HJYB 1I50L 3FKIG 1QZGA 4LHLA 1SYDA 1YK4A 1N8RC 1RD9D 5HGTA 2YV5A 1JMCA 1HNXQ 1S4ZA 2RCNA 5EBDA 4XDXA 3I3CA 3TP8A 4HSPA 2KN9A 1FYCA 2K75A 1KNAA 2HDMA 2L4NA 2R7DA 2A1AA 5JVG1 4A3FB 1STYA 1VQCA 1JICA 1SROA 1PFYA 3RMHA 2MS3A 1XMOL 1GKHA 2X6LA 1A8VA 1XWEA 1Z92B 2I5MX 3NQTA 1JWUD 1HNWQ 1IW7C 1I6HH 1Y1WH 1D1KA 3CCUA 1T9HA 4IUUA 2IX3A 3D8GA 4HIMA 1BQ9A 2E2HB 2XJPA 2B2TA 4CBVA 4JADA 1RDGA 2E75C 4ME5A 1C09A 5C4XG 3PKJA 4LF4Q 1LKOA 1SBBB 3RLFA 4KHVA 2K52A 4ZUIA 3E3XA 2ZXPA 2F0GA 3BDOA 1G51A 1LABA 3GQBA 4DAYA 5I6WA 2RFKB 1HZBA 1X6OA 4KHPQ 4ILWA 4PZ6A 1GM5A 4RKLA 3ERQA 1TIID 1VQHA 4ULLA 1YHAA 2N8NA 1K8MA 5IE8A 4XQNA 1ASYA 4UHVA 1CKNB 5M5WB 2E2IH 3H0GH 4NXNL 2UXCL 3M9BA 1YNXA 4XQJA 3P2AA 4N8X1 2NZ1D 2CW0D 2UXDQ 3TZUA 1Y1VL 2E74C 5C4XL 2F0MA 1SFOL 2B2YA 1IYVA 1MJEA 1VQ8A 3PIP3 2B5ID 1TWCH 3QG1A 1OXVA 1XPOA 1YIJA 2EE1A 3QR8A 1Y8NB 1RHPA 2DY8A 2WV6D 1X55A 3PUZA 4KD4A 4IUNA 4KKSA 2FMMA 1EYAA 1WTHA 2B2TC 1TS4A 3S2HL 1KNEA 4NW2A 1NNXA 2QDBA 7RXNA 3KOJA 1ML0D 1K83H 2K33A 4DUYL 5M5XL 4H7BA 2C5CA 1K0RA 4UY81 3MA2B 1XNQQ 1QYBA 2A6HD 4B08A 4RMFA 1C4QA 2ZXRA 3A8IE 1JJ2A 4PMWA 4A3LH 3PUXA 5K5PA 3EBEA 4AR3A 1V43A 4X64Q 2JA6G 3PIP1 1ET9A 1V9PA 3OHXC 4TQUS 3NHHA 3KLSA 4KKTA 5CV6A 5FLXc 5LL6X 4DR4L 4OO1I 4ZCKA 1V1OA 2EYMA 2I5HA 4C56C 1CHPD 1WD0A 4LF7Q 1QB5D 3UE0A 1L1OB 3FMCA 5BN5A 4C2M1 1M8AA 4LUOA 4QY7A 3L3OC 5IY0A 1P8LA 1BVSA 5I9PA 1Q8KA 5IWAL 1F2LA 3NENA 3RZDL 3EFXD 2B2YC 2EJMA 3ND9A 1BBXC 4B9XA 3DM1A 4GS7D 3F2DA 2R92G 1PYWD 3EROA 4LF5Q 5LMUL 4A3KG 3HOUB 1QJOA 2WAQG 4GS3A 2JA6L 3MAQA 4ZUJA 3SK5A 3PF5A 1NUCA 2Q8IB 1QILA 3RZOL 2GVBA 1LLRD 1T9PA 4QMGA 3S1ML 4XYOA 3MQKB 4DXFA 2FJ2A 4DA2A 1PFVA 1GVPA 3UI2A 3O13A 4K2KA 4A93G 3ER0A 1BCPD 1SDFA 3CHBD 5E4WC 3CF5A 1PH2A 3RUZA 1KDAA 2P5ZX 2OT2A 2F52A 2PYKA 1MSGA 4A3JB 1MBYA 2A6ED 2Y0SB 2XJQA 3EN2A 4X3UA 3SEBA 3KF8A 1FVIA 3CKIB 3D6CA 3C3LA 1Y1WG 2CHBD 1Q1EA 4DF7A 2F0FA 4GNXB 1ZXTA 2C6BA 5LMNL 3WWNB 1I50B 2ERJA 3DWPA 1E24A 3OW7A 4UP7A 4Y7NH 4A93L 2JSOA 4NKLA 1X3QA 1D2BA 5M3MG 1S5FD 2Z9HA 3DEPA 5C3EG 4HJ5A 1GHKA 1VCXA 2XNAC 5EPJA 3KUPA 4J6HA 2ZJQA 1D5ZC 1XX8A 5M5WH 2MNAA 1XMQQ 4LFBQ 2LMCB 4LF9Q 4O2DA 2PZTA 2F0EA 5D65A 5CGKA 2GVAA 2MFIA 1B3QA 5IGEA 1KIXA 3H0GG 3PO3H 2HVYC 2NYZD 1FR3A 1LTAD 4EQ5A 4A3BL 1YNJD 3OTOQ 4RKBA 4DR2L 1V1PB 4M1UB 5KYLA 1EFWA 3G71A 2XGTA 1EIFA 1U9RA 4CDFC 4A3EH 1I94L 1Q81C 2K03A 1EQRA 1PFSA 5M3ML 4G57A 5C3EL 1TT2A 3I55A 2CQOA 2NVQB 2JI3A 4JBMA 2WAQP 4IUPA 1XMOQ 2XJUA 2F1MA 4JVZA 2A69D 2E2JL 4QCLA 4DR1L 2IX1A 3FP9A 3GP7A 3G6JB 1ODHA 5EQ0A 3TEHB 4K6LA 1K9MC 4MZ9A 4PZ8A 2NVTH 4KLKA 2YTVA 3GTQB 1Q82C 3ERSX 4DR3L 4A3LG 3KFUA 1AP0A 2AHOB 1XTCD 4GN5A 5GAHC 1JWSD 1DOLA 1Q86C 4HIOA 4RGOS 3H9BA 3D4RA 1LT6D 2PVEA 3DM3A 2B8FA 2DUDA 2R3ZA 5EAYA 1WTVA 3P20A 3KYHC 4C3JG 1QG7A 4K9FA 1EYCA 1N34L 4NB3A 2IW3A 3WOFA 2EQSA 1I5FA 2VY3A 4C3HH 4TPUA 3S2HB 3KJPA 1B53A 4XYQA 5I2YA 4A3MB 4LFCL 3NQIA 4UP9A 3D0FA 3CQZB 2E2DC 1S2ZA 1YVCA 4X65L 4PMBA 3K58A 2PQAA 2WB1G 2KUMA 4NXNQ 2UXCQ 1CZGA 5FO9B 3PO2H 1H95A 3KYWA 1TWAH 2B3GA 1W6JA 2KHIA 2EYFA 5GAEc 4IURA 4E6IA 2FINB 4C1NI 4BS9A 1TWFH 3A55A 2PW5A 1UE5A 3HFZB 4GN3B 2J4XA 4AR4A 2UUCL 3MC0B 1O80A 3JAME 2SEBD 3KDFB 4C3JL 2B29A 3HOVH 3I8ZA 3M4YA 5EPLA 4APVA 3EJIA 1SNCA 3OIPA 3QO2A 4H44C 5IYBH 2UUBL 1K3RA 2JA8H 3B6YA 3Q6SA 4DUYQ 4GOPB 1EIHA 4A3GB 4A3FG 1ILQA 1CTMA 4DXGA 2ZJPA 4RHRA 3GTLL 5CORA 5D3IB 4L6TB 5FO8B 1HA6A 3L0OA 3MFYA 4G7OC 4H0LC 1FGUA 1LUZA 4IJHA 5C4JL 3I91A 2XJTA 1N9WA 4LWCA 5IP7H 1PFUA 2XVSA 4UP8A 4DR4Q 5CBEE 1RDPD 3I4MH 5J1ZA 1I50H 2BDOA 3A44A 1PDQA 3RZOB 1IYJB 1SYBA 2A68D 4AH6A 4EVOA 5CV8A 2A8VA 3EVQA 2PZWA 2WKDA 3LGJA 4LK1C 1X9NA 3AFPA 1WCMB 5C0XJ 5IWAQ 2LCQA 1SE4A 2NBFA 3D4DA 4Z9CB 5F2DA 1WFQA 4L5QA 3J81E 1STHA 1BOSA 1BE7A 4BBRL 4A3FL 2F03A 4POFA 1NTGA 1A3TA 5LMUQ 1E2WA 4DNRB 3C46A 4HJ8A 2BE5C 5DLQE 2Z6KA 1SN8A 1B2TA 4JW0A 4OO1H 2WKCA 1MD2D 3GTGB 1PTOH 4IPCA 3W3AA 4KN7C 3Q23A 4IO9A 2E2HL 1C7YA 1GUWA 4KN4C 3S15L 2MUYA 3CW2C 1K28A 3N52A 4X3TA 1SMXA 5KGUA 2WIIB 2QCPX 3MFGA 2QW7A 1I3QB 3GTPB 1H9SB 2L1BA 4HJ7A 4LNQA 1X3PA 1AEXA 3FEWX 1DVBA 4ZKBB 4X66L 4A3EG 3H99A 3ITPA 1WVLA 2WB1P 1CAAA 3N6RA
chains in the Genus database with same CATH topology
1JE5A 3LNLA 4DR5L 4DV1L 4PZ7A 1Y1VH 3KYYA 5C4XH 4JYAL 5LMNQ 3J80c 2KHJA 1SFOH 3H3VH 1W3SA 2Z6KC 2JI2A 1YUZA 2I0QA 3CC7A 5AN9H 5DM61 5H1Sc 3S24A 3LPEB 3JAMi 3S2HH 4OXPA 1NMFA 2JJQA 4NXMQ 4JOIA 1CUKA 1E8JA 1FJGL 2PI2A 5M5XH 5GAGc 3KYXA 3VDYA 1IBML 3HKZE 4QIWE 3HOUG 1SLJA 5GADc 3PWFA 1BQ8A 4DR2Q 4YY3L 2NZOA 1RWDA 2KKDA 2CWPA 2PSMC 4TVMA 1I94Q 1L0WA 3HOVG 1JYBA 2VL6A 3RZDH 4AI1A 2OTLA 2VNUD 3U4ZA 1CKOA 4DR1Q 2JA8G 1VQPA 4B3ML 4QL5A 4A3JG 1GO3E 2JA6H 2Y0SG 4DR3Q 1VQNA 4JOIC 1R0JA 3RZOH 3ICEA 3TREA 4DV7L 4B3SL 5IP7G 1VZIA 3S1MH 1R0HA 3I4MG 2ZTEA 1N34Q 1B7YB 1M90C 1VQJA 1M1KC 2Q2UA 2CR8A 5MLC3 2OQKA 4UPAA 4LFCQ 3PGZA 4X65Q 3CPFA 1B13A 2ZJRA 1CKMA 4DAMA 2IHFA 1NMGA 2V0EA 2K50A 3G6EA 1X65A 2UUCQ 1NXEA 4DV4L 1IROA 3M4QA 2HQLA 4YHHL 4JI5L 1VZGA 1AE3A 2UUBQ 4A93H 1O7IA 2FXQA 5DM71 4JCVE 2XJRA 1X3GA 2L0ZA 4AIMA 4AI2A 2AMCB 1SR3A 2HIVA 2IT1A 4A3BH 1Y1VG 2GN5A 3CP0A 1KXLA 3RN5A 3CCQA 3J7A5 1WYDA 4B3TL 5M3MH 5C3EH 4GLXA 1MKHA 1QUQA 1Z9FA 1X56A 5JEAJ 3B0AB 2VZAA 5EIOC 4A3MG 1QVCA 2E2JH 1KAWA 4IPHA 2R7FA 5GAGC 2EXDA 3UDGA 2D62A 1JB7A 2F4VL 4HJ9A 1YBYA 4P73A 5GADC 1E1TA 4AHYA 2N78A 3F2BA 1PYBA 1RIPA 3ULLA 2KCMA 1A0IA 4X66Q 1BRFA 4ZN3B 1NBWA 1VQMA 1EWIA 1JJCB 4A3GG 1MIUA 1OTCA 2UU9L 4AI0A 1R0IA 2RHQB 1HZCA 4DR5Q 3CC4A 4DV1Q 1YJ9A 3KF6B 1R0GA 2C6AA 4JYAQ 4DV3Q 4K0KL 4POGA 1V1QA 4C3JH 3A0JA 1WCMG 1PH1A 1FJGQ 1YUXA 6RXNA 1PH8A 1PH6A 2RDVA 4OONA 3K8AA 3SS2A 1IBMQ 2XJVA 3GTLH 4EX5A 4JI4L 4DR7Q 4JBWA 2K5NA 1NXGA 5C4JH 4DV0Q 4YY3Q 3J7Y1 1QVGA 3KJOA 5JJIA 2M4VA 3PIOA 1D7QA 4R4QA 2I5LX 3K81C 1Q12A 5HY6A 4JI0L 1IBLL 3H3VI 1IU5A 4BBRH 4A3FH 5AI2A 1XJVA 4AR5A 4B3MQ 1PVOA 2E8GA 2E2HH 1CSPA 3S15H 1XTDA 5K36G 4DV7Q 1N32L 4A3BG 4DK6C 2AWNA 2BH2A 3NEMA 4MNOA 1E3PA 3CCVA 2NN6G 4OX9Q 4BA2I 4KHZA 2IX0A 5RXNA 5AJ3L 1UE7A 1KC8C 3RN2A 2PPTA 2DGYA 3TRZA 1SMMA 1K8GA 1LTLA 2D0PA 1HR0L 4DV4Q 4YHHQ 4JI5Q 3I2ZA 4P71A 3D31A 5FLMH 5K2ME 1T9OA 1HH2P 5FJ8G 1U5KA 1N36L 1VQLA 3RYGA 4MTNA 1VQGA 4A3IG 3RNUA 1LYLA 3U50C 2RHSB 2CFMA 2D0OA 4X62L 3JAMc 3ZG6A 2ASBA 2HHHL 1VS0A 4B3TQ 1RDVA 4ALPA 1VQ7A 1C9OA 1J6QA 2VW9A 3HOUH 2PNHA 1VQFA 2Q2HA 3SGIA 3M7NA 4JI7L 1VQDA 2F4VQ 3AYHB 4GKKL 4IPGA 3M85A 2ZIXA 3E9IA 2UXBL 1PA6A 2QEXA 4QQBX 3EIVA 5JJLA 4IPDA 4JBKA 4XXBB 3J81c 3Q8DA 3CPWA 3STBD 3A5ZB 3CAMA 3CMAA 3AFQA 1ASZA 2ID0A 3AQQA 4BBRG 2JEBI 2NN6I 2UU9Q 4A3JH 2Q2IA 1CKNA 1B70B 1VQEA 4A3DG 2MO0A 3CMEA 1WJVA 1YZ6A 4IFDJ 4K0KQ 3NELA 3CCJA 4JI6L 4LHNA 2Z3RB 4XGHA 1WOCA 1VQIA 2K14A 4DAYB 2PMZE 1JT8A 3WWLA 4R4OA 2KBNA 2JQOA 3PUWA 5AI3A 3HOZG 1UWVA 1X3EA 4JI4Q 4AYBE 1YEZA 5IYDH 1WI5A 4B3RL 1YHBA 3HKSA 2DSXA 1L1OA 4KHPL 4L5SA 1T9QA 2K4KA 4DUZL 1JJGA 5ELOA 4JI0Q 1IBLQ 5C0XG 5FLMG 2NVQH 5LMNW 3A74A 5JVH1 1H7VA 1YJWA 2JA5H 4YCWA 2NZHA 4L5TA 1YK5A 3GTQH 1PH9A 3QVDA 1N32Q 2E5LL 1KL9A 2OCEA 3UDIA 1K8AC 1DGSA 1VQAA 1HNZL 2A19A 1HR0W 3BU2A 1Q7YC 4A3MH 1YHQA 3WWVA 2CWAA 2N3SA 1LKPA 3CQZH 4LF8L 3NFPI 4OWWB 5AJ3Q 4JG2A 3IU3I 4U671 2PYAA 5J3BA 4QGUA 4JBJA 1S30A 1HR0Q 1VCIA 4GNXA 4RXNA 4IOCA 1E1OA 3I4OA 3UDXA 5GAEC 1PHJA 2LXJA 3CCSA 2VQFL 3PIO1 2HT1A 2MQHA 3F2CA 1MJCA 1N36Q 4A3GH 1IBKL 3KF8B 2ZM6L 4DV2L 3GDEA 3T1YL 4JAEA 1W2BA 2KENA 1E7ZA 4X62Q 1KRTA 2ALYB 4IJLA 3F1ZA 1UE1A 2HHHQ 4A3CH 3PUVA 4DKAC 5M3FG 3J81j 2JEAI 1WCMH 4O0AA 5IYCH 4ME3A 1OXUA 1J5EL 4GNXC 4JI8L 1S40A 4DNIA 5C0XI 1SRUA 3PUYA 4JI7Q 3GTGH 1B71A 2VUMH 5MGNA 1PH5A 4WJ4A 5M5YH 4GKKQ 4OWTB 5IYDG 3MPSA 1BBWA 2UXBQ 1NY4A 1X3FA 5IP9H 4JI3L 1I3QH 3GTPH 3QQCE 3E9HA 1RYTA 1VQ5A 3PV0A 1SMWA 3GTOH 3HKZG 3CCRA 1IXRA 1VQ6A 2JA5G 3OW2A 5E7NA 4LW1A 3B08B 4AR6A 3UDFA 2M4YA 4JI6Q 4JV5L 1VQ4A 1ZRPA 2V1CC 3K7UC 4OWXB 2ATWA 3KDFA 1A62A 2XTIA 4HIDA 2M6OA 4DK3C 3S17H 1X54A 1OXXK 2CKZB 1VQKA 4BY7G 5MFPA 2QA4A 4TVAB 1RL2A 4GOPA 2PQAB 3VPBE 3GTMH 3A5UA 2WAQE 1BKBA 1XPUA 3ULPA 2K2DA 1KD1C 5MFZA 4JI1L 4B3RQ 1PYSB 3J80i 2BE5D 1GD7A 3JC62 3MSUA 3PKIA 4DUZQ 3J7ZC 1G6PA 2Z3QB 3KYUA 4KI0A 4B8CD 3IRBA 5FJ8H 2GMGA 5JEAG 1R0FA 3STBC 4GLAC 5BR8L 2UUAL 4JI2L 4A3IH 3GD7A 1KHIA 4GOPC 3RZTA 1VQ9A 2E5LQ 4JAGA 1TWHH 2VQEL 1SMUA 1NNQA 4DR6L 1QZHA 2BH8A 1YI2A 3GTKH 2WFWA 1HNZQ 3PSIA 4A4IA 4A3CG 2JI1A 1BFYA 2C35B 5IYCG 5GAHc 3MEFA 4J15A 4AQYL 1OXSC 4LF8Q 4BBSH 3K80C 2QL0A 2CCZA 1XNRL 1A63A 1B8AA 4YCUA 3UE1A 1TXYA 3F8TA 5C44G 1PH3A 1IZ6A 2VUMG 2V0FA 3OYYA 3TS2A 2HIXA 3ULJA 4XTCS 2VQFQ 4YWMA 5IP9G 3CCEA 1BBUA 4DV5L 1IBKQ 2ZM6Q 4BXXG 4DV2Q 1PH7A 4R1JA 3BJUA 1SE8A 2JA9A 4A3DH 3T1YQ 1S72A 3HOXH 3I4NH 3M3YH 3P8BA 1VQBA 1OWBA 3MXNB 4B3SQ 1IU6A 4R4TA 4LFAL 4WJ3M 4P72A 1J5EQ 4NPSA 4XIGS 4A76A 4JI8Q 3HOZH 3W5OA 2WB1E 2ZTDA 3L7ZC 5GQOA 3H15A 2OTJA 2EIFA 1B2JA 1AE2A 1EYGA 1AH9A 3AEVA 4HIKA 2WP8J 3HOWH 2LSSA 1KQSA 1NJIC 4JI3Q 3ZJYC 4NXML 2YTYA 4YWKA 3PCOB 2BA0A 2Q2TA 3M4PA 2R7ZH 3U4VA 2PVXA 1YITA 2YU9H 2H12A 2V3BB 4P75A 5JJKA 4LUVA 4L5RC 1IL2A 4QJFA 2J9UB 2YTXA 4A75A 4BY1H 1EIYB 4GLVB 3M4OH 4C2MH 3NBHB 4JV5Q 3TQYA 3TS0A 1FL0A 2NVYH 4LUZA 3PZAA 1Y14B 4GKJL 4C3IH 1IW7D 2CKCA 2M6PA 3RZ6A 4DV6L 4GN4B 2L15A 1QVFA 2R93H 3CD6A 4AHXA 1FHMA 3T1HL 1Q46A 4JC0A 4BBSG 4G6BA 4JI1Q 5EINC 1QCVA 1TWGH 3JC63 2AKWB 1UEBA 1IRNA 2R6GA 3HOYH 1WJJA 1RB9A 3I7FA 4P74A 2B63H 1UE6A 4R4IA 4LF6L 4AHZA 1N33L 1PH4A 2H5XA 3CCLA 3S14H 5BR8Q 2UUAQ 4JI2Q 3GO5A 4DPGA 3DLLA 3HOXG 3J7Z1 3I4NG 2VQEQ 1HNXL 1XPRA 4DR6Q 5HGQA 1QUQB 1B2OA 2O5JD 5M3FH 1K73C 3CCMA 4E6YA 3S1NH 3U58A 1YJNA 4AQYQ 3PIPA 1HNWL 4IOAA 1VZHA 3BZKA 3S1RH 1XNRQ 3FHWA 3KF6A 2ZTCA 3S1QH 3GTJH 4LF4L 3RLNA 4IFDG 4FDBA 1Q1BA 2BA1A 1S24A 3S2DH 4WFN1 2NYDA 3HOWG 2HR5A 2LXKA 2JA7H 4X6AH 4DV5Q 2Z0SA 2R7ZG 5IT9c 2PI2E 3W1BA 3CXCA 1PV4A 4UY8C 2Y0SE 2UXDL 3FKIH 3PO3G 5ELNA 3W1GA 1CSQA 3K0XA 1E22A 4BY1G 1VQOA 4YWLA 4AHWA 4LFAQ 1NE3A 4BA1I 3G4SA 2K5VA 4BY7H 2IY5B 1FHHA 4AI3A 1XNQL 1HZAA 2AYJA 1U0LA 3K35A 2ES2A 1L1OC 1P16A 4X64L 2R93G 1HZ9A 4DV3L 1HJPA 2K5HA 2AWOA 4R4CA 1EQQA 1R9TH 4V196 1CADA 2OQ0A 5GROA 2XJSA 4LF7L 2OWOA 3G48A 4JAFA 8RXNA 2JE6I 1EOVA 3RR5A 4HJAA 3HOYG 4LF5L 2YYZA 4DR7L 2VS1A 1LKMA 2B63G 4RG1A 3L2PA 3PO2G 4AYBG 4DV0L 2JK8A 4Y52H 1OWCA 3S16H 3KYVA 5H1SE 4GKJQ 1RYQA 5IYBG 2QGQA 1G291 4IFDI 3PF4A 3KLWA 3CC2A 3J81i 4DV6Q 1LM0A 1EUJA 2F3IA 2N49A 4H02A 4PG3A 1KRSA 3T1HQ 2NVXH 3RLOA 3JC66 1YV1A 1DX8A 5C44H 2ERSA 1OXTA 2RF4A 1Z47A 1D8LA 4YCVA 3K7AH 3BZCA 2R92H 4OX9L 2IHEA 3E0EA 4A3KH 2CKAA 2JA7G 1S3OA 4LF6Q 3I56A 4BXXH 1N33Q 1XMQL 4LFBL 4OO1G 4LF9L 4ZN1B 1L2FA 2MO1A 5MF6A 2KCTA 1C0AA 3OTOL 3FKIG 1QZGA 4LHLA 1YK4A 1N8RC 2YV5A 1JMCA 1HNXQ 2RCNA 2KN9A 2K75A 2R7DA 2A1AA 5JVG1 1VQCA 1SROA 1XMOL 2MS3A 1GKHA 1A8VA 1Z92B 2I5MX 1HNWQ 1I6HH 1Y1WH 3CCUA 1T9HA 4HIMA 1BQ9A 2XJPA 4JADA 1RDGA 1C09A 5C4XG 3PKJA 4LF4Q 1LKOA 3RLFA 2K52A 1G51A 1HZBA 1X6OA 4KHPQ 4PZ6A 1GM5A 1VQHA 1YHAA 2N8NA 5IE8A 1ASYA 1CKNB 2E2IH 3H0GH 4NXNL 2UXCL 3M9BA 1YNXA 3P2AA 2UXDQ 1MJEA 1VQ8A 2B5ID 1TWCH 1OXVA 1XPOA 1YIJA 1X55A 3PUZA 7RXNA 3KOJA 1K83H 4DUYL 1K0RA 4UY81 1XNQQ 1QYBA 2A6HD 4RMFA 1JJ2A 4PMWA 4A3LH 3PUXA 3EBEA 4AR3A 1V43A 4X64Q 2JA6G 3PIP1 1V9PA 4TQUS 5FLXc 4DR4L 4OO1I 2I5HA 4LF7Q 3UE0A 1L1OB 4LUOA 4QY7A 5IY0A 1P8LA 1BVSA 1Q8KA 5IWAL 3NENA 2R92G 4GS7D 3F2DA 4LF5Q 5LMUL 4A3KG 2WAQG 4GS3A 3PF5A 2GVBA 1T9PA 1GVPA 4A93G 3ER0A 3CF5A 1PH2A 2F52A 2A6ED 2XJQA 3EN2A 1FVIA 1Y1WG 1Q1EA 4GNXB 2C6BA 5LMNL 3WWNB 2ERJA 1E24A 4UP7A 4Y7NH 5M3MG 4HJ5A 5C3EG 1VCXA 2ZJQA 5M5WH 2MNAA 1XMQQ 4LFBQ 4LF9Q 4O2DA 2GVAA 2MFIA 3PO3H 1KIXA 3H0GG 4EQ5A 3OTOQ 4DR2L 1EFWA 3G71A 2XGTA 1EIFA 4A3EH 1I94L 1Q81C 1EQRA 1PFSA 3I55A 2CQOA 2JI3A 4JBMA 1XMOQ 2XJUA 2A69D 4DR1L 2IX1A 3FP9A 1ODHA 3TEHB 1K9MC 4MZ9A 4PZ8A 2NVTH 4KLKA 2YTVA 1Q82C 3ERSX 4DR3L 4A3LG 3KFUA 2AHOB 4GN5A 5GAHC 1Q86C 4HIOA 2PVEA 3DM3A 2DUDA 5EAYA 3KYHC 4K9FA 1N34L 4NB3A 2EQSA 1I5FA 2VY3A 4C3HH 4TPUA 3KJPA 4LFCL 4UP9A 3D0FA 1S2ZA 1YVCA 4X65L 2PQAA 2WB1G 4NXNQ 2UXCQ 3PO2H 1H95A 3KYWA 1TWAH 2B3GA 2KHIA 5GAEc 1TWFH 1UE5A 3HFZB 4GN3B 4AR4A 2UUCL 3KDFB 2B29A 3HOVH 4APVA 5IYBH 2UUBL 1K3RA 2JA8H 3B6YA 4DUYQ 4GOPB 4A3FG 2ZJPA 3L0OA 1FGUA 1LUZA 4IJHA 2XJTA 1N9WA 4LWCA 5IP7H 4UP8A 4DR4Q 3I4MH 1I50H 3A44A 1IYJB 2A8VA 2A68D 4AH6A 3LGJA 1X9NA 3AFPA 5C0XJ 5IWAQ 2LCQA 1WFQA 4L5QA 1BE7A 4POFA 1NTGA 5LMUQ 4HJ8A 5DLQE 2Z6KA 1SN8A 4IPCA 4IO9A 1C7YA 3CW2C 1SMXA 4HJ7A 4LNQA 1DVBA 4X66L 4A3EG 1CAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 L;  1JE5 A;  1VS0 A;  2VUM G;  4B3T Q;  1RDV A;  3OYY A;  1L2F A;  2MO1 A;  3TS2 A;  2KCT A;  1C0A A;  2HIX A;  3ULJ A;  3OTO L;  3FKI G;  4XTC S;  1QZG A;  4DR5 L;  4DV1 L;  1YK4 A;  2VQF Q;  4PZ7 A;  4ALP A;  1N8R C;  2YV5 A;  4YWM A;  1JMC A;  5IP9 G;  2RCN A;  1HNX Q;  1C9O A;  1J6Q A;  1VQ7 A;  1Y1V H;  3KYY A;  5C4X H;  2VW9 A;  5LMN Q;  3J80 c;  4JYA L;  2KHJ A;  3CCE A;  3HOU H;  1SFO H;  2KN9 A;  2PNH A;  1VQF A;  3H3V H;  4JV5 L;  2K75 A;  1BBU A;  2Q2H A;  2R7D A;  3SGI A;  3M7N A;  2A1A A;  4JI7 L;  1W3S A;  2Z6K C;  4DV5 L;  1IBK Q;  1YUZ A;  2I0Q A;  1VQD A;  3CC7 A;  2ZM6 Q;  1VQC A;  2F4V Q;  4BXX G;  1SRO A;  1XMO L;  2MS3 A;  3S24 A;  3AYH B;  4DV2 Q;  2UXB L;  1PH7 A;  4R1J A;  1GKH A;  3BJU A;  4IPG A;  1A8V A;  1SE8 A;  2JA9 A;  4A3D H;  2I5M X;  4GKK L;  3T1Y Q;  1S72 A;  3M85 A;  3E9I A;  3JAM i;  4OXP A;  3S2H H;  1HNW Q;  1NMF A;  2JJQ A;  4NXM Q;  1PA6 A;  4JOI A;  3PO2 H;  1CUK A;  3HOX H;  1I6H H;  1E8J A;  1Y1W H;  3I4N H;  2QEX A;  1FJG L;  3M3Y H;  1VQB A;  4QQB X;  3CCU A;  2PI2 A;  1T9H A;  4HIM A;  1BQ9 A;  3EIV A;  5M5X H;  5JJL A;  4IPD A;  3KYX A;  4JBK A;  3J81 c;  3VDY A;  3Q8D A;  3CPW A;  1IBM L;  3MXN B;  1RDG A;  3STB D;  1C09 A;  4B3S Q;  1IU6 A;  5C4X G;  3HKZ E;  4QIW E;  3A5Z B;  4LF4 Q;  3HOU G;  1LKO A;  1SLJ A;  3CAM A;  3RLF A;  3CMA A;  2K52 A;  3AFQ A;  4R4T A;  1ASZ A;  4LFA L;  2UXD L;  2ID0 A;  3AQQ A;  4BBR G;  3PWF A;  2JEB I;  2NN6 I;  2UU9 Q;  4WJ3 M;  4P72 A;  1J5E Q;  4NPS A;  1BQ8 A;  1G51 A;  4A3J H;  2Q2I A;  1CKN A;  4XIG S;  4DR2 Q;  4A76 A;  1B70 B;  4JI8 Q;  4YY3 L;  3HOZ H;  1HZB A;  1VQE A;  1X6O A;  2MO0 A;  2NZO A;  1RWD A;  4PZ6 A;  3W5O A;  4A3D G;  4KHP Q;  1GM5 A;  3CME A;  2KKD A;  2CWP A;  1VQH A;  1YZ6 A;  2WB1 E;  4IFD J;  1YHA A;  2ZTD A;  1I94 Q;  2N8N A;  3NEL A;  5IE8 A;  3CCJ A;  1L0W A;  4K0K Q;  3HOV G;  4JI6 L;  1ASY A;  3L7Z C;  1WOC A;  1JYB A;  1VQI A;  1CKN B;  2K14 A;  2VL6 A;  3H0G H;  4NXN L;  5GQO A;  4DAY B;  2PMZ E;  3H15 A;  3RZD H;  2OTL A;  2UXC L;  3U4Z A;  2VNU D;  3M9B A;  1YNX A;  1B2J A;  1AE2 A;  2EIF A;  1EYG A;  2OTJ A;  1CKO A;  4DR1 Q;  2JA8 G;  2UXD Q;  1AH9 A;  1JT8 A;  3AEV A;  4HIK A;  2WP8 J;  4R4O A;  3HOW H;  2KBN A;  2JQO A;  2LSS A;  3PUW A;  1VQP A;  1MJE A;  1KQS A;  1VQ8 A;  4B3M L;  1NJI C;  5AI3 A;  4QL5 A;  4JI3 Q;  1TWC H;  3ZJY C;  4A3J G;  2YTY A;  4NXM L;  1OXV A;  1GO3 E;  4YWK A;  1XPO A;  2JA6 H;  1YIJ A;  2Y0S G;  3HOZ G;  3PCO B;  4DR3 Q;  1X55 A;  1VQN A;  3PUZ A;  2BA0 A;  4JOI C;  1UWV A;  1X3E A;  1R0J A;  2Q2T A;  3M4P A;  2R7Z H;  4JI4 Q;  3U4V A;  2PVX A;  4AYB E;  3RZO H;  1YEZ A;  3ICE A;  3TRE A;  7RXN A;  3KOJ A;  5IP7 G;  4DV7 L;  1YIT A;  2YU9 H;  4B3S L;  2V3B B;  4P75 A;  3S1M H;  5JJK A;  1R0H A;  1K83 H;  4LUV A;  4DUY L;  4L5R C;  2ZTE A;  1IL2 A;  3I4M G;  5IYD H;  1N34 Q;  1WI5 A;  4QJF A;  1YHB A;  4B3R L;  3HKS A;  1B7Y B;  1K0R A;  1M90 C;  1VQJ A;  2YTX A;  1XNQ Q;  1M1K C;  1QYB A;  4A75 A;  2Q2U A;  4BY1 H;  4RMF A;  1EIY B;  4GLV B;  2DSX A;  1L1O A;  2OQK A;  4UPA A;  4LFC Q;  4KHP L;  3M4O H;  1JJ2 A;  4PMW A;  4A3L H;  4C2M H;  3PUX A;  3NBH B;  3EBE A;  4AR3 A;  1V43 A;  3PGZ A;  4X64 Q;  4L5S A;  3TQY A;  1T9Q A;  2K4K A;  3TS0 A;  2JA6 G;  1V9P A;  4X65 Q;  4DUZ L;  4TQU S;  1JJG A;  1FL0 A;  2NVY H;  1B13 A;  3CPF A;  4LUZ A;  5ELO A;  5FLX c;  2ZJR A;  3PZA A;  1Y14 B;  1IBL Q;  4JI0 Q;  5C0X G;  4GKJ L;  4DR4 L;  4OO1 I;  1CKM A;  2I5H A;  5FLM G;  2NVQ H;  4DAM A;  2IHF A;  3A74 A;  4C3I H;  5LMN W;  1NMG A;  4LF7 Q;  3UE0 A;  1L1O B;  1H7V A;  2K50 A;  3G6E A;  4LUO A;  1YJW A;  2UXC Q;  4QY7 A;  3RZ6 A;  5IY0 A;  1P8L A;  4YCW A;  2JA5 H;  1BVS A;  1X65 A;  2UUC Q;  1Q8K A;  5IWA L;  3NEN A;  4DV6 L;  2NZH A;  4GN4 B;  4L5T A;  4DV4 L;  2R93 G;  2L15 A;  1QVF A;  1IRO A;  2R93 H;  3M4Q A;  1YK5 A;  3CD6 A;  3GTQ H;  2HQL A;  3QVD A;  4YHH L;  1PH9 A;  3F2D A;  4JI5 L;  2R92 G;  4JV5 Q;  1FHM A;  3T1H L;  1AE3 A;  1Q46 A;  2E5L L;  1KL9 A;  4JC0 A;  5LMU L;  2UUB Q;  4LF5 Q;  4BBS G;  4A93 H;  4A3K G;  1O7I A;  2OCE A;  3UDI A;  2WAQ G;  2FXQ A;  4GS3 A;  4JI1 Q;  1K8A C;  1DGS A;  1VQA A;  3PF5 A;  1QCV A;  1HNZ L;  4JCV E;  2A19 A;  1HR0 W;  3BU2 A;  1X3G A;  1TWG H;  3JC6 3;  2AKW B;  1UEB A;  1IRN A;  2R6G A;  2GVB A;  1T9P A;  1Q7Y C;  3HOY H;  4AIM A;  4A3M H;  1YHQ A;  3WWV A;  2CWA A;  2N3S A;  1LKP A;  1WJJ A;  3CQZ H;  4LF8 L;  2AMC B;  1RB9 A;  1SR3 A;  4OWW B;  2HIV A;  2IT1 A;  5AJ3 Q;  4JG2 A;  4A3B H;  3I7F A;  1GVP A;  4P74 A;  2B63 H;  1UE6 A;  1Y1V G;  2GN5 A;  4A93 G;  2PYA A;  4R4I A;  4LF6 L;  5J3B A;  3ER0 A;  3CP0 A;  4QGU A;  1N33 L;  1KXL A;  1PH4 A;  3CF5 A;  4JBJ A;  1S30 A;  1PH2 A;  3RN5 A;  1VCI A;  1HR0 Q;  4GNX A;  4RXN A;  3CCQ A;  4IFD G;  4IOC A;  2H5X A;  3CCL A;  3J7A 5;  3S14 H;  5BR8 Q;  2UUA Q;  1WYD A;  1E1O A;  2F52 A;  3GO5 A;  4JI2 Q;  4B3T L;  5M3M H;  5C3E H;  4GLX A;  1MKH A;  1QUQ A;  3I4O A;  1Z9F A;  4DPG A;  3UDX A;  1X56 A;  5JEA J;  3EN2 A;  5GAE C;  1PHJ A;  3DLL A;  2LXJ A;  1FVI A;  2VZA A;  3CCS A;  2VQF L;  4A3M G;  3HOX G;  1Y1W G;  3I4N G;  1QVC A;  2E2J H;  2HT1 A;  1Q1E A;  2VQE Q;  1HNX L;  1XPR A;  4GNX B;  2MQH A;  4DR6 Q;  5LMN L;  1KAW A;  4IPH A;  5HGQ A;  2R7F A;  5GAG C;  3F2C A;  2EXD A;  1QUQ B;  1B2O A;  1MJC A;  5M3F H;  1N36 Q;  4A3G H;  1IBK L;  3UDG A;  1K73 C;  2D62 A;  1JB7 A;  3KF8 B;  2ZM6 L;  1E24 A;  2F4V L;  4UP7 A;  4Y7N H;  3CCM A;  4DV2 L;  4HJ9 A;  1YBY A;  3S1N H;  3GDE A;  4P73 A;  5GAD C;  3U58 A;  1YJN A;  1E1T A;  4AQY Q;  3T1Y L;  5M3M G;  3PIP A;  5C3E G;  4HJ5 A;  1HNW L;  1VCX A;  1W2B A;  4IOA A;  2KEN A;  2N78 A;  3F2B A;  3BZK A;  3S1R H;  1PYB A;  1RIP A;  3ULL A;  1XNR Q;  2KCM A;  1A0I A;  1E7Z A;  4X66 Q;  4X62 Q;  2ZJQ A;  1KRT A;  3FHW A;  2ALY B;  3KF6 A;  1BRF A;  3F1Z A;  4IJL A;  5M5W H;  2MNA A;  2ZTC A;  1XMQ Q;  3S1Q H;  3GTJ H;  4LFB Q;  1UE1 A;  1NBW A;  2HHH Q;  4A3C H;  4LF9 Q;  3PUV A;  4O2D A;  4DKA C;  4LF4 L;  2GVA A;  2MFI A;  1VQM A;  3PO3 H;  1EWI A;  3H0G G;  1KIX A;  5M3F G;  3J81 j;  1JJC B;  3RLN A;  1WCM H;  4EQ5 A;  2JEA I;  4O0A A;  4A3G G;  4FDB A;  1MIU A;  4ME3 A;  1OXU A;  1Q1B A;  2BA1 A;  5IYC H;  3OTO Q;  1OTC A;  2UU9 L;  1J5E L;  1S24 A;  1R0I A;  4GNX C;  2RHQ B;  1HZC A;  4DR5 Q;  3CC4 A;  3S2D H;  4DV1 Q;  4DR2 L;  3HOW G;  2HR5 A;  4JI8 L;  1YJ9 A;  3KF6 B;  1EFW A;  2LXK A;  1R0G A;  3G71 A;  2XGT A;  1EIF A;  1S40 A;  2JA7 H;  4JYA Q;  4DV3 Q;  4A3E H;  4DNI A;  5C0X I;  1SRU A;  4DV3 L;  1Q81 C;  1I94 L;  4K0K L;  1EQR A;  1PFS A;  3PUY A;  1PVO A;  3I55 A;  2CQO A;  4JI7 Q;  4X6A H;  4DV5 Q;  3GTG H;  4POG A;  1B71 A;  2Z0S A;  2R7Z G;  4JBM A;  2VUM H;  1V1Q A;  1PH5 A;  4C3J H;  5IT9 c;  1XMO Q;  2PI2 E;  4WJ4 A;  5M5Y H;  4GKK Q;  3W1B A;  3CXC A;  4OWT B;  1PV4 A;  4UY8 C;  2Y0S E;  4DR1 L;  3FKI H;  3A0J A;  5IYD G;  2IX1 A;  3PO3 G;  3FP9 A;  3MPS A;  1BBW A;  2UXB Q;  5ELN A;  1WCM G;  3W1G A;  1NY4 A;  1CSQ A;  1X3F A;  3K0X A;  3TEH B;  1PH1 A;  1YUX A;  1K9M C;  1E22 A;  6RXN A;  4MZ9 A;  1FJG Q;  4PZ8 A;  5IP9 H;  2NVT H;  4KLK A;  1PH8 A;  4JI3 L;  1PH6 A;  4BY1 G;  2RDV A;  1I3Q H;  2YTV A;  3GTP H;  1Q82 C;  4OON A;  3ERS X;  3SS2 A;  3K8A A;  4DR3 L;  4A3L G;  3KFU A;  1IBM Q;  2AHO B;  3GTL H;  3E9H A;  4GN5 A;  5GAH C;  1VQO A;  4EX5 A;  1Q86 C;  4YWL A;  4HIO A;  4JI4 L;  1RYT A;  1VQ5 A;  4DR7 Q;  3PV0 A;  4JBW A;  2K5N A;  1SMW A;  4LFA Q;  2PVE A;  1NE3 A;  3DM3 A;  4BA1 I;  3G4S A;  2DUD A;  5EAY A;  3GTO H;  2K5V A;  3KYH C;  3HKZ G;  5C4J H;  4DV0 Q;  4BY7 H;  4K9F A;  1N34 L;  4NB3 A;  4OO1 G;  2IY5 B;  4YY3 Q;  1IXR A;  3CCR A;  1VQ6 A;  1FHH A;  1XNQ L;  2EQS A;  1I5F A;  2VY3 A;  1HZA A;  1QVG A;  4C3H H;  4TPU A;  3KJO A;  3PIO A;  3KJP A;  2JA5 G;  5JJI A;  4LFC L;  4R4Q A;  5E7N A;  3OW2 A;  4UP9 A;  1D7Q A;  2I5L X;  1U0L A;  4LW1 A;  4AR6 A;  3D0F A;  3UDF A;  2M4Y A;  2ES2 A;  1L1O C;  1P16 A;  4X64 L;  4JI6 Q;  3K81 C;  1VQ4 A;  1ZRP A;  1S2Z A;  1HZ9 A;  1Q12 A;  1HJP A;  1YVC A;  5HY6 A;  4X65 L;  2K5H A;  2AWO A;  2V1C C;  3K7U C;  4OWX B;  2PQA A;  2ATW A;  4R4C A;  2WB1 G;  3KDF A;  1EQQ A;  4JI0 L;  1A62 A;  2XTI A;  1R9T H;  1IBL L;  1IU5 A;  4NXN Q;  1CAD A;  2OQ0 A;  5GRO A;  4BBR H;  4HID A;  4A3F H;  3H3V I;  1TWA H;  2B3G A;  3KYW A;  5AI2 A;  2E2I H;  1H95 A;  4LF7 L;  2KHI A;  4DK3 C;  1XJV A;  2OWO A;  3S17 H;  1X54 A;  1OXX K;  2CKZ B;  3G48 A;  4AR5 A;  1VQK A;  8RXN A;  4B3M Q;  4BY7 G;  1TWF H;  2JE6 I;  2QA4 A;  1UE5 A;  1RL2 A;  3HFZ B;  4GN3 B;  4TVA B;  1EOV A;  2E8G A;  4GOP A;  4AR4 A;  2UUC L;  2PQA B;  3RR5 A;  3KDF B;  3GTM H;  2B29 A;  3HOV H;  3A5U A;  4HJA A;  2E2H H;  2WAQ E;  3HOY G;  1CSP A;  4APV A;  3S15 H;  1BKB A;  1XTD A;  1XPU A;  5K36 G;  5IYB H;  4DV7 Q;  3ULP A;  2UUB L;  2K2D A;  4LF5 L;  1N32 L;  2YYZ A;  1KD1 C;  4A3B G;  1K3R A;  2JA8 H;  3B6Y A;  4DUY Q;  2VS1 A;  1LKM A;  4GOP B;  4DR7 L;  4JI1 L;  4B3R Q;  2B63 G;  4RG1 A;  3L2P A;  3PO2 G;  4DK6 C;  2AWN A;  4AYB G;  4A3F G;  2BH2 A;  1PYS B;  3NEM A;  3J80 i;  2ZJP A;  4MNO A;  4DV0 L;  2JK8 A;  4Y52 H;  1E3P A;  3CCV A;  1GD7 A;  2NN6 G;  3L0O A;  3JC6 2;  4OX9 Q;  4BA2 I;  4KHZ A;  2IX0 A;  1FGU A;  4DUZ Q;  1LUZ A;  4IJH A;  3J7Z C;  3S16 H;  3KYV A;  5H1S E;  1N9W A;  5RXN A;  4LWC A;  5IP7 H;  1G6P A;  4GKJ Q;  4UP8 A;  3KYU A;  4DR4 Q;  4KI0 A;  5AJ3 L;  1UE7 A;  1KC8 C;  3RN2 A;  3I4M H;  2DGY A;  1I50 H;  3TRZ A;  3IRB A;  3A44 A;  5IYB G;  1IYJ B;  2A8V A;  2QGQ A;  4AH6 A;  5FJ8 H;  1SMM A;  1K8G A;  2GMG A;  5JEA G;  1G29 1;  4IFD I;  1LTL A;  1R0F A;  3KLW A;  3CC2 A;  3LGJ A;  3J81 i;  3PF4 A;  2D0P A;  1X9N A;  1HR0 L;  3AFP A;  5C0X J;  3STB C;  5IWA Q;  2LCQ A;  4GLA C;  4DV6 Q;  1LM0 A;  1WFQ A;  4L5Q A;  5BR8 L;  4DV4 Q;  1EUJ A;  2UUA L;  4A3I H;  4JI2 L;  2F3I A;  3GD7 A;  2N49 A;  1BE7 A;  4H02 A;  4PG3 A;  4YHH Q;  4POF A;  1KHI A;  4JI5 Q;  1KRS A;  4GOP C;  1NTG A;  3RZT A;  3I2Z A;  3T1H Q;  1VQ9 A;  2E5L Q;  2NVX H;  4P71 A;  5LMU Q;  3D31 A;  3RLO A;  3JC6 6;  5FLM H;  4HJ8 A;  1YV1 A;  5DLQ E;  1DX8 A;  1TWH H;  2Z6K A;  5C44 H;  2VQE L;  1SN8 A;  1SMU A;  1NNQ A;  1T9O A;  4DR6 L;  1OXT A;  2RF4 A;  1QZH A;  1N32 Q;  4IPC A;  2BH8 A;  1YI2 A;  1HH2 P;  3GTK H;  1Z47 A;  2WFW A;  1HNZ Q;  4IO9 A;  1D8L A;  4YCV A;  5FJ8 G;  3PSI A;  1U5K A;  1C7Y A;  4A4I A;  1N36 L;  4A3C G;  3K7A H;  1VQL A;  3BZC A;  3CW2 C;  3RYG A;  1BFY A;  2C35 B;  4MTN A;  1VQG A;  2R92 H;  1SMX A;  4OX9 L;  5IYC G;  3MEF A;  4J15 A;  4AQY L;  4A3I G;  2IHE A;  1OXS C;  4LF8 Q;  3RNU A;  4BBS H;  3E0E A;  3K80 C;  1LYL A;  3U50 C;  4HJ7 A;  2RHS B;  4A3K H;  4LNQ A;  2QL0 A;  2CFM A;  2D0O A;  2CCZ A;  2JA7 G;  1XNR L;  1A63 A;  1DVB A;  1S3O A;  4X66 L;  1B8A A;  4YCU A;  3UE1 A;  4X62 L;  1TXY A;  3F8T A;  3JAM c;  3I56 A;  4A3E G;  5C44 G;  4LF6 Q;  1N33 Q;  4BXX H;  1PH3 A;  1CAA A;  1XMQ L;  4LFB L;  2ASB A;  1IZ6 A;  2HHH L; 
#chains in the Genus database with same CATH topology
 4ABN A;  1JE5 A;  1EL0 A;  5J39 A;  3C2P A;  3TN2 A;  4F88 A;  1SAP A;  3R3O A;  3URY A;  3LNL A;  4QUF A;  1IHZ A;  4DR5 L;  4DV1 L;  4PZ7 A;  4ZLT F;  1JOR A;  1Y1V H;  3KYY A;  5C4X H;  4JYA L;  5LMN Q;  1AN8 A;  4QB4 A;  2KHJ A;  3J80 c;  3Q24 A;  4FXD A;  1SFO H;  4A3B B;  3H3V H;  1O7Z A;  3ZYY X;  1W3S A;  1SNQ A;  2Z6K C;  2JI2 A;  1YUZ A;  3V96 A;  2I0Q A;  3CC7 A;  5AN9 H;  5DM6 1;  4I7Z C;  5H1S c;  3S24 A;  3MXN A;  1QE6 A;  5FLM L;  3LPE B;  3JAM i;  4EQO A;  4OXP A;  3S2H H;  1NMF A;  2JJQ A;  5IOD A;  4NXM Q;  4JOI A;  1CUK A;  1E8J A;  1FJG L;  3GTM B;  2PI2 A;  5IT9 E;  4CJ0 B;  3CRL C;  5M5X H;  5GAG c;  3KYX A;  2F0V A;  2E2J B;  3VDY A;  4N9P A;  1IBM L;  2MJ8 A;  3HKZ E;  4QIW E;  4QF4 A;  3HOU G;  1SLJ A;  3JAM L;  5GAD c;  1GUS A;  4FXK C;  3PWF A;  2ICI A;  1BQ8 A;  4DR2 Q;  1CHQ D;  4YY3 L;  2NZO A;  1FD7 D;  1RWD A;  1B1Z A;  1HQM C;  2KKD A;  1CI3 M;  2CWP A;  2PSM C;  1F9Q A;  5C4Z A;  4TVM A;  1I94 Q;  3K57 A;  1L0W A;  3HOV G;  1A3U A;  3FDT A;  3VR5 A;  1ICF B;  4XQQ A;  1JCK B;  1JYB A;  5FO7 B;  2VL6 A;  3RZD H;  4AI1 A;  5C5L A;  4L63 B;  2OTL A;  2VNU D;  3U4Z A;  1U4P A;  1CKO A;  4DR1 Q;  2JA8 G;  1TQO A;  3BDL A;  2OEO A;  3HOU L;  1VQP A;  2HD3 A;  4B3M L;  1HFN A;  4QL5 A;  4A3I B;  4A3J G;  1BCP C;  5IIF A;  1GO3 E;  2JA6 H;  2Y0S G;  4DR3 Q;  1STE A;  1VQN A;  4JOI C;  1R0J A;  3BVM A;  3BS1 A;  3SE0 A;  1F9R A;  1TWH B;  3FPU B;  3RZO H;  3ICE A;  3TRE A;  3J81 L;  4DV7 L;  3NBH A;  5IP7 G;  2Z1C A;  4B3S L;  1VZI A;  1I4Q A;  4R8I A;  3S1M H;  1R0H A;  3GTK B;  1J9O A;  1SNO A;  1X32 A;  1B44 D;  2ZTE A;  3I4M G;  1N34 Q;  1B7Y B;  4BWG B;  1M90 C;  1VQJ A;  1JWM D;  1M1K C;  2Q2U A;  2CR8 A;  5MLC 3;  2OQK A;  4UPA A;  4LFC Q;  3I70 A;  5EGT A;  3PGZ A;  1IKL A;  1Q3L A;  4X65 Q;  3CPF A;  1B13 A;  5JVG 3;  3GTL B;  4A3J L;  2X6G A;  2ZJR A;  2O4X A;  1CKM A;  5KYI A;  4DAM A;  2IHF A;  1NMG A;  4G7Z C;  5I9O A;  2V0E A;  2K50 A;  3G6E A;  4FO2 A;  1ROD A;  3MHB A;  5C4J B;  1B4O A;  1Y8P B;  1X65 A;  2UUC Q;  1NXE A;  4GZY C;  4DV4 L;  3NE5 B;  1F2Y A;  1IRO A;  3M4Q A;  4KK7 A;  2K5W A;  1L0X B;  1PTO C;  2HQL A;  4YHH L;  4JI5 L;  1VZG A;  3NSW A;  2CH4 W;  1AE3 A;  2UUB Q;  3R2T A;  4A93 H;  1O7L A;  1O7I A;  2FXQ A;  1JR0 D;  5DM7 1;  2TSS A;  1GUG A;  4BBR B;  5C3X A;  4PNY A;  3V2T A;  4JCV E;  3MXG A;  2XJR A;  1X3G A;  4A3D B;  2L0Z A;  1WTW A;  3HOX B;  4WOR A;  4AIM A;  3I4N B;  4AI2 A;  3M3Y B;  5IYD L;  5K36 H;  2JXM B;  3HAX C;  2AMC B;  1SR3 A;  2KA7 A;  1DD2 A;  2HIV A;  2IT1 A;  4A3B H;  3S15 B;  1QWY A;  3NWS A;  1Y1V G;  2GN5 A;  3IL8 A;  2EYP A;  3CP0 A;  3NPP A;  1D1I A;  1KXL A;  1EU4 A;  2QDL A;  3RN5 A;  3CCQ A;  3J7A 5;  1WYD A;  4B3T L;  3IKJ A;  4NDX A;  5M3M H;  2AQ1 B;  5C3E H;  4GLX A;  1MKH A;  1QUQ A;  1D5X C;  3HOZ B;  2NVQ L;  1Z9F A;  3KLS X;  1X56 A;  5JEA J;  3B0A B;  2VZA A;  4K6D A;  5EIO C;  2B2V A;  2Y0S P;  4A3M G;  5T1G A;  1ZYR C;  1QVC A;  2E2J H;  5ELC A;  3VYR A;  2JA5 L;  3VYT A;  5FKA C;  1EOT A;  1KAW A;  4IPH A;  2R7F A;  1D6E C;  4NMZ A;  4ZQ3 A;  5GAG C;  1IKM A;  2EXD A;  1FNU A;  5D3D A;  1C8C A;  3GTQ L;  3AB9 A;  2CQA A;  3UDG A;  2D62 A;  1JB7 A;  1T5X D;  2F4V L;  3A7L A;  2F0I A;  1KLG D;  4HJ9 A;  1YBY A;  3IFD A;  3MEH A;  4P73 A;  5GAD C;  1E1T A;  2EVB A;  1PRT C;  4AHY A;  2N78 A;  1S5B D;  2F0S A;  3F2B A;  5DEH A;  1PYB A;  1RIP A;  3OWF A;  3ULL A;  2KCM A;  2XRQ D;  5C4H A;  1A0I A;  4X66 Q;  1BRF A;  4ZN3 B;  2ENB A;  4IUT A;  2L9H A;  4MHE A;  3NTI A;  2YU9 B;  4A3M L;  1NBW A;  4RGN A;  3HZX A;  3CQZ L;  1VQM A;  1EWI A;  1LO5 D;  4O42 A;  2H4O A;  1JJC B;  4A3G G;  1MIU A;  1OTC A;  2UU9 L;  4AI0 A;  1R0I A;  2RHQ B;  1HZC A;  4DR5 Q;  3CC4 A;  4DV1 Q;  1YJ9 A;  3KF6 B;  3M4O B;  3TME A;  2O5J C;  1R0G A;  1LTR D;  1KTK A;  2C6A A;  2K05 A;  4JYA Q;  1DCZ A;  4DV3 Q;  1LAC A;  4K0K L;  2NVY B;  2BDN A;  2B2V C;  2JYO A;  4POG A;  1V1Q A;  2N88 A;  5CBA E;  2R61 A;  4C3J H;  5EJW A;  4KD3 A;  3QB3 A;  1BO0 A;  4RAU C;  3W2D A;  3A0J A;  3LWP B;  3J7Y W;  2PPB C;  1STN A;  1UAP A;  1WCM G;  1PH1 A;  1FJG Q;  1YUX A;  6RXN A;  2A5H A;  3H91 A;  1PH8 A;  3T56 B;  1PH6 A;  2SNS A;  2RDV A;  4QUC A;  4A3G L;  5KEE A;  4LMQ D;  3K8A A;  3SS2 A;  4OON A;  2KVM A;  1IBM Q;  2XJV A;  4TKO B;  1S5D D;  3GTL H;  1ESF A;  3QOJ A;  4EX5 A;  1CA5 A;  4JI4 L;  1HFG A;  4MIU A;  4DR7 Q;  4JBW A;  2K5N A;  1NXG A;  1EWH A;  2RVL A;  5I2X A;  3NBI A;  2PMZ B;  5BN3 A;  5C4J H;  3HP3 A;  4DV0 Q;  3BDC A;  2ZT9 C;  4YY3 Q;  3J7Y 1;  1TWG B;  3M7G A;  2F0U A;  3EA6 A;  1QVG A;  4FNF A;  3KJO A;  5JJI A;  2M4V A;  3PIO A;  2X69 A;  4A3C L;  4K5X A;  1D7Q A;  4R4Q A;  5C5M A;  2I5L X;  1PZX A;  5HUR A;  3K81 C;  1WCM L;  1Q12 A;  5HY6 A;  5IYC L;  2EYL A;  5I6Y A;  2B63 B;  4JI0 L;  1IBL L;  3H3V I;  1IU5 A;  3DHQ A;  4BBR H;  4AYB B;  4A3F H;  1EY7 A;  5AI2 A;  2KEE A;  1XJV A;  2B2U A;  2Z8L A;  2F0T A;  1XYI A;  2RDF A;  2A74 C;  4AR5 A;  5NUC A;  3P75 A;  2A73 B;  3S14 B;  4B3M Q;  4XT1 B;  1QNU A;  4H13 C;  1PVO A;  2KHS A;  2E8G A;  3GTG L;  1MI2 A;  2VUM L;  1U4L A;  3R2I A;  2E2H H;  5M5Y L;  1STA A;  1CSP A;  3LWO B;  1J8I A;  3S15 H;  2IWH A;  1XTD A;  5K36 G;  4DV7 Q;  1N32 L;  4A3B G;  5IP9 L;  1I3Q L;  3GTP L;  5M3F B;  4DK6 C;  2AWN A;  5KNB A;  2BH2 A;  3NEM A;  4MNO A;  3VA5 A;  1E3P A;  4CGY B;  3CCV A;  3S1N B;  1SE3 A;  2NN6 G;  3BVG A;  4OX9 Q;  5COY A;  4BA2 I;  4KHZ A;  4UDU C;  2Q8T A;  2IX0 A;  3GTO L;  1RJT A;  3A8K E;  1PMR A;  4CKB A;  2NB0 A;  5RXN A;  3L9A X;  4RGM A;  1LT3 D;  4G7H C;  5AJ3 L;  1UE7 A;  1KC8 C;  4PQX A;  3RN2 A;  2PPT A;  1TU2 B;  2DGY A;  3TRZ A;  1Z6H A;  3S1Q B;  3GTJ B;  1PZI D;  4FXG C;  1SMM A;  1BNZ A;  3DWA A;  3NTK A;  1K8G A;  1LTL A;  4TRD A;  2D0P A;  1HR0 L;  5A35 A;  1E2Z A;  1ZKO A;  2F0P A;  2HUG A;  4ZRZ A;  4DV4 Q;  3S2D B;  2IJ0 A;  4YHH Q;  2SDF A;  4JI5 Q;  3S17 L;  3I2Z A;  5C0X H;  4P71 A;  3K59 A;  1F9P A;  1LTG D;  2MGS A;  3D31 A;  2DN8 A;  4X3K A;  5FLM H;  1PFW A;  2M2L A;  5K2M E;  3LNN A;  4O1N A;  5C6A A;  1T9O A;  2F0H A;  1LTI D;  3GTM L;  3J7A F;  1HH2 P;  3HKZ B;  2N55 A;  5ELF A;  4QIW B;  4I65 A;  5FJ8 G;  1U5K A;  1N36 L;  1VQL A;  1U4M A;  3RYG A;  2JA5 B;  4FF4 A;  4MTN A;  1VQG A;  3QJY A;  2L0C A;  3A56 A;  4A3I G;  2CH4 A;  3RNU A;  1LYL A;  3U50 C;  2EY1 A;  2RHS B;  4MTK A;  2CFM A;  2D0O A;  1G2S A;  1QCB D;  4X62 L;  3JAM c;  1SJH D;  2KOL A;  3C1E A;  3ZG6 A;  2ASB A;  2HHH L;  1VS0 A;  4KJO A;  3G7L A;  4B3T Q;  1RDV A;  4Q5V A;  4BY7 B;  1MHW C;  1A3V A;  3I72 A;  3PQI A;  1HHV A;  2D5D A;  5FJ8 L;  4ALP A;  1VQ7 A;  3D4W A;  1C9O A;  1J6Q A;  3DUZ A;  2VW9 A;  3HOU H;  3DMU A;  2PNH A;  4A3I L;  1VQF A;  3J7A V;  2Q2H A;  3SGI A;  1R9T B;  3M7N A;  4JI7 L;  3RD4 A;  1VQD A;  2F4V Q;  1JE4 A;  1HQR D;  3AYH B;  1SNP A;  4GKK L;  4IPG A;  1GUO A;  1TWH L;  2F0O A;  3M85 A;  2ZIX A;  3E9I A;  2UXB L;  2F4I A;  1PA6 A;  1PFN A;  2QEX A;  1U4R A;  1RTN A;  2F0W A;  4QQB X;  3GTK L;  1YNN C;  3I4L A;  3EIV A;  4K8I A;  3WDN A;  5JJL A;  4V0B A;  1ET6 A;  3BVZ A;  4IPD A;  4JBK A;  4XXB B;  3J81 c;  3Q8D A;  3CPW A;  3STB D;  2F0Q A;  1BXT A;  3A5Z B;  1AZP A;  3OPO A;  3CAM A;  3BYT B;  3CMA A;  1HCZ A;  3AFQ A;  1ASZ A;  4BBS L;  5ELE A;  5EBC A;  2ID0 A;  3AQQ A;  4BBR G;  1I4P A;  1EZ6 A;  2JEB I;  2NN6 I;  2UU9 Q;  4A3J H;  3VR2 A;  2Q2I A;  1CKN A;  1B70 B;  1S5C D;  1VQE A;  4A3D G;  2MO0 A;  3AU7 A;  4I7A A;  3VYS A;  3CME A;  1WJV A;  1NR2 A;  2EY2 A;  1YZ6 A;  4IN3 A;  5E4X A;  1ICW A;  5IGG A;  4IFD J;  4K0K Q;  1CM9 A;  3NEL A;  3CCJ A;  4JI6 L;  2WAC A;  4LHN A;  1G91 A;  2Z3R B;  4XGH A;  1WOC A;  3KBG A;  2IL8 A;  1VQI A;  2K14 A;  4DAY B;  5JAV A;  2PMZ E;  2DNE A;  1QQT A;  2EDG A;  1JT8 A;  1EY5 A;  3WWL A;  4R4O A;  2KBN A;  1F2M A;  2JQO A;  3PUW A;  1DM0 B;  1NSN S;  2F3W A;  5AI3 A;  4ZKC B;  4DAP A;  3HOZ G;  3X3M A;  4P2C B;  1UWV A;  4XXE A;  1X3E A;  1KAA A;  4HMJ A;  4K2L A;  5JVH 3;  4A3D L;  4JI4 Q;  1HA5 A;  5C44 B;  1Q90 A;  2PCF B;  4AYB E;  1YEZ A;  4RH6 A;  3DWQ A;  1BQQ T;  3HOX L;  3I4N L;  3M3Y L;  1DOK A;  3TSS A;  2VUM B;  5IYD H;  1TKW B;  4DN4 M;  1WI5 A;  4B3R L;  1YHB A;  5CYU A;  1VF7 A;  3HKS A;  5M5Y B;  3K7A B;  4R8N A;  3V05 A;  2DSX A;  1L1O A;  4KHP L;  3CRK C;  1QOH A;  4HN7 A;  4L5S A;  1T9Q A;  2CW0 C;  2K4K A;  5DNF A;  3TP5 A;  4DUZ L;  4A3K B;  1JJG A;  1RTO A;  2RSO A;  5ELO A;  4JI0 Q;  3HEJ A;  1WTX A;  1IBL Q;  5C0X G;  3HOZ L;  3GV3 A;  3OWE B;  5DM6 3;  5FLM G;  2NVQ H;  4U68 A;  3FPP A;  3A74 A;  5JVH 1;  5LMN W;  1H7V A;  2XWB B;  1YJW A;  2B39 A;  3GTO B;  4HR7 B;  3K5L A;  2EJF C;  2JA5 H;  4YCW A;  2NZH A;  4L5T A;  5ISR A;  2NTT A;  2VXW A;  1YK5 A;  1HTP A;  3GTQ H;  1B3A A;  4IUQ A;  1PH9 A;  3QVD A;  4KY7 A;  3NP8 A;  1G8Z D;  5CV9 A;  1N32 Q;  3HOW L;  2E5L L;  1KL9 A;  2A6H C;  2OCE A;  3T16 A;  3UDI A;  1VMC A;  2NTS A;  1TR5 A;  1K8A C;  2BOS A;  1DGS A;  1RF2 D;  2OF1 A;  1VQA A;  4DU9 A;  1HNZ L;  3S17 B;  2A19 A;  1HR0 W;  2R7Z L;  3BU2 A;  4PV1 C;  5CMD A;  5LL6 S;  3PIO 3;  4OEM B;  2YU9 L;  1Q7Y C;  1I6H B;  4A3M H;  1YHQ A;  1Y1W B;  3WWV A;  1B9N A;  2CWA A;  2N3S A;  4RHS A;  3OMG A;  1LKP A;  3CQZ H;  4LAA A;  3SDZ A;  4LF8 L;  3NFP I;  1F4L A;  4OWW B;  5AJ3 Q;  4JG2 A;  3H3V M;  4CDC C;  3IU3 I;  3KLR A;  4BY1 L;  2F0D A;  4U67 1;  1PZK D;  3M4O L;  2PYA A;  1A2U A;  5J3B A;  4QGU A;  2KQ3 A;  4OIJ A;  4JBJ A;  1S30 A;  1HR0 Q;  1VCI A;  4GNX A;  4RXN A;  2KCC A;  4IOC A;  2NVY L;  1CK1 A;  1E1O A;  1TS2 A;  4J1M A;  3I4O A;  3FDJ A;  1EEF D;  3UDX A;  5GAE C;  4C3I L;  1PHJ A;  3VR3 A;  2LXJ A;  4TSS A;  3CCS A;  2VQF L;  3PIO 1;  3MWY W;  1NCV A;  1Y69 U;  2HT1 A;  2K5Q A;  2MQH A;  1E0B A;  4F87 A;  1CQF A;  3F2C A;  2E2I B;  2R93 L;  3H0G B;  1MJC A;  2XRS D;  1A2T A;  4OGQ C;  1N36 Q;  1IBK L;  4A3G H;  5FK9 C;  2SOB A;  3KF8 B;  2ZM6 L;  4IAL A;  4DV2 L;  3IFT A;  3J80 E;  3GDE A;  3LWQ B;  2RA4 A;  2KCN A;  3T1Y L;  1TWC B;  2QKI C;  1ONL A;  4JAE A;  2E76 C;  1W2B A;  2KEN A;  1Z7T A;  4L8J A;  5E1F A;  3K5M A;  3EQL C;  1E7Z A;  1TWG L;  1V1P A;  4X62 Q;  1KRT A;  1GUN A;  2ALY B;  2A6E C;  3F1Z A;  4IJL A;  4WJW A;  4Q0F A;  3HOY L;  4YIJ A;  1UE1 A;  3CU7 A;  2HHH Q;  1IL8 A;  1SYF A;  4A3C H;  3PUV A;  4DKA C;  1K83 B;  5M3F G;  4K5W A;  3J81 j;  1VDZ A;  1WCM H;  2JEA I;  4O0A A;  5IYC H;  4ME3 A;  1MSH A;  1OXU A;  1J5E L;  4GNX C;  2B63 L;  4V19 0;  2KJX A;  2XSC A;  4JI8 L;  1I4H A;  1ILP A;  4KKU A;  1S40 A;  2VB3 X;  1AZQ A;  2M9V A;  4BBS B;  3S14 L;  4DNI A;  5C0X I;  1SRU A;  2C9O A;  5DM7 3;  3PUY A;  1DYQ A;  4JI7 Q;  2EJG C;  3GTG H;  1B71 A;  2VUM H;  5MGN A;  1PH5 A;  4WJ4 A;  3SK6 A;  4WRD A;  5M5Y H;  4GKK Q;  4OWT B;  5IYD G;  1DJR D;  2DNC A;  3MPS A;  1BBW A;  2UXB Q;  1NY4 A;  1X3F A;  3VA7 A;  5IP9 H;  4JI3 L;  5M3F L;  1I3Q H;  1RKN A;  2Z4I A;  5EKK A;  3GTP H;  3QQC E;  3OSO A;  3E9H A;  1YNJ C;  3S1N L;  4CDE C;  2KEC A;  3LX0 A;  4HSV A;  3H09 A;  5J22 A;  1RYT A;  1VQ5 A;  2K04 A;  3MVV A;  3PV0 A;  1SMW A;  4RA8 A;  3GTO H;  1SJE D;  2EY6 A;  1LT5 D;  3S1R L;  3SHL A;  3HKZ G;  1FNV A;  1JC7 A;  3CCR A;  1IXR A;  2EZV A;  1VQ6 A;  3I90 A;  2PMZ P;  2AUS B;  3S1Q L;  3GTJ L;  2FHT A;  2JA5 G;  3OW2 A;  5E7N A;  4LW1 A;  3B08 B;  1K0S A;  1JOO A;  4AR6 A;  2A69 C;  3UDF A;  2M4Y A;  4FVM A;  4JI6 Q;  4JV5 L;  1VQ4 A;  1ZRP A;  1Q8I A;  2V1C C;  3K7U C;  4OWX B;  2ATW A;  3S2D L;  3KDF A;  1G2T A;  1A62 A;  2XTI A;  4HID A;  3BZD B;  2M6O A;  2JA7 L;  4DK3 C;  3S17 H;  2CKZ B;  1X54 A;  1OXX K;  1KLU D;  1VQK A;  1GHJ A;  4AYB P;  5IT9 L;  1H9M A;  2NN6 H;  1WTQ A;  3NWT A;  4BY7 G;  5MFP A;  1M4V A;  2QA4 A;  4TVA B;  1RL2 A;  4GOP A;  4X6A L;  1MGS A;  1R4Q B;  2PQA B;  2AQ3 B;  3VPB E;  1G6Z A;  3H3V C;  3GTM H;  3H6M A;  1OO9 B;  2RDG A;  3A5U A;  2WAQ E;  1EWC A;  3OOC A;  4JK1 C;  3FKI L;  1BKB A;  2PW7 A;  1XPU A;  1SND A;  4FP5 D;  3ULP A;  1BF4 A;  2K2D A;  1NAP A;  4RCO A;  1KD1 C;  2WIN B;  4C1N K;  5MFZ A;  4JI1 L;  4B3R Q;  2LY7 A;  1PYS B;  3J80 i;  2OXP A;  4EGV A;  4Y7N B;  2BE5 D;  2RSN A;  1B9M A;  1GD7 A;  4F8M A;  3HOW B;  3JC6 2;  5KND A;  1B50 A;  3FVQ A;  3E0J A;  3MSU A;  2MP1 A;  3PKI A;  5C3W A;  4DUZ Q;  4FF2 A;  4ZK9 B;  3MZ5 A;  4BY7 L;  1II3 A;  3J7Z C;  1JOQ A;  4OHJ A;  2K6A A;  1G6P A;  2Z3Q B;  3KYU A;  4KI0 A;  2R7Z B;  1V8Q A;  3J80 L;  2D9U A;  4B8C D;  1K8O A;  3IRB A;  2L55 A;  2K5D A;  5G3L D;  5FJ8 H;  3D3R A;  2GMG A;  2NWG A;  5JEA G;  1R0F A;  3PO3 B;  5G3L F;  1KAB A;  3STB C;  2HCC A;  2VB2 X;  4GLA C;  2Z4H A;  5BR8 L;  2UUA L;  4JI2 L;  4A3I H;  1R9T L;  3GD7 A;  4OEL B;  4UAI A;  4BY1 B;  1CZW A;  2F0L A;  1KHI A;  5KIX A;  4GOP C;  4HCS A;  3RZT A;  4C2M B;  5IGD A;  4PMC A;  1VQ9 A;  2E5L Q;  4ID6 A;  5BN4 A;  5E3F A;  4A3E B;  4JAG A;  1TWH H;  2VQE L;  1ZEQ X;  1SMU A;  1NNQ A;  2AQC A;  2QF7 A;  1JB3 A;  5EPK A;  3T51 B;  4DR6 L;  3TP6 A;  1H9S A;  2LFN A;  1QZH A;  1KDB A;  1EQT A;  2BH8 A;  1YI2 A;  3GTK H;  2EPB A;  2WFW A;  4C3I B;  1HNZ Q;  4HAE A;  3PSI A;  4A4I A;  4A3C G;  2PQE A;  1LT4 D;  2JI1 A;  3C1F A;  3HKZ P;  4QIW P;  1BFY A;  2C35 B;  3D6W A;  1EYD A;  1EY4 A;  1O7Y A;  5IYC G;  5GAH c;  2A68 C;  2NVT B;  3MEF A;  2GA4 B;  1PFM A;  4J15 A;  5IGB A;  1OXS C;  3S9W A;  4AQY L;  4LF8 Q;  2R93 B;  4BBS H;  3K80 C;  2EXZ A;  2QL0 A;  1HPC A;  4Y52 L;  2CCZ A;  1D5M C;  1XNR L;  5KNC A;  1A63 A;  1B8A A;  4YCU A;  3UE1 A;  1TXY A;  3F8T A;  4RCN A;  5C44 G;  3R93 A;  1PH3 A;  4RGT A;  1IZ6 A;  3PL5 A;  3S16 L;  2VUM G;  3T53 B;  2V0F A;  3OYY A;  3TS2 A;  2HIX A;  3ULJ A;  1IYU A;  4C3H B;  2DY7 A;  1E2V A;  1EIG A;  2HCI A;  4XTC S;  3HOY B;  2VQF Q;  2G5D A;  1FNW A;  1EEI D;  4YWM A;  2TMP A;  5IP9 G;  5CR3 A;  3AMU A;  1GXD C;  1EY0 A;  1EY6 A;  3CCE A;  1BBU A;  4FYD A;  3PO2 B;  4DV5 L;  1IBK Q;  1TWA B;  2ZM6 Q;  4BXX G;  2NVX L;  4DV2 Q;  4XT3 B;  1PH7 A;  4R1J A;  3BJU A;  1STG A;  2JA9 A;  1SE8 A;  4DK1 A;  4A3D H;  5C44 L;  1TWF B;  3T1Y Q;  1VF5 C;  1S72 A;  5FLX E;  4IQZ A;  1EQV A;  5DAU A;  3HOX H;  1NR4 A;  3I4N H;  3M3Y H;  3P8B A;  1VQB A;  1OWB A;  2MHV A;  3HOV B;  4KTA A;  2G9H D;  3K7A L;  3MXN B;  1BCP B;  1IU6 A;  4B3S Q;  2R92 L;  4KV6 A;  1WD1 A;  2JA8 B;  1CFM A;  2LKV A;  4R4T A;  5IOC A;  4LFA L;  4A3K L;  1BCP F;  3HG9 A;  4WJ3 M;  4P72 A;  1J5E Q;  4NPS A;  4XIG S;  3SXH A;  4A76 A;  4JI8 Q;  3HOZ H;  3BYY B;  3W5O A;  4BXX L;  1SMY D;  3NK9 A;  3A8J E;  2WB1 E;  3K0Y A;  2ZTD A;  4G4K A;  2KED A;  3S1R B;  3I73 A;  3L7Z C;  1ENC A;  3I4M B;  1JOK A;  2D2C C;  2K1B A;  3P1H A;  1BR9 A;  5GQO A;  3H15 A;  4IFD H;  1PFB A;  1QNK A;  2EIF A;  1B2J A;  1AE2 A;  1EYG A;  2OTJ A;  1AH9 A;  5JJZ A;  2F0J A;  3AEV A;  4HIK A;  2G9D A;  2WP8 J;  3HOW H;  2F3V A;  1K3B C;  2ICE C;  2LSS A;  3R8B A;  2B2U C;  1KQS A;  1NJI C;  4JI3 Q;  3ZJY C;  1Y8O B;  2PNR C;  2YTY A;  4NXM L;  4YWK A;  3DEO A;  3PCO B;  2BCO A;  3KBX A;  1I4X A;  2BA0 A;  1GUT A;  3HRZ C;  2JA7 B;  2Q2T A;  1A15 A;  3M4P A;  1EY9 A;  4DGZ A;  2R7Z H;  3U4V A;  2PVX A;  3SK8 A;  1R4P B;  1I6H L;  1YIT A;  2YU9 H;  4FF3 A;  1Y1W L;  4R9W A;  2H12 A;  3K5O A;  2V3B B;  1PTO B;  4P75 A;  5JJK A;  4LUV A;  4L5R C;  1PTO D;  1IL2 A;  3LWR B;  1I4R A;  4QJF A;  2J9U B;  1WTO A;  2B2W A;  3LWE A;  1CA6 A;  2YTX A;  1PTO F;  3FKI B;  4A75 A;  4RWS C;  4BY1 H;  1EIY B;  1F77 A;  4GLV B;  4FF1 A;  3M4O H;  4C2M H;  3NBH B;  4JV5 Q;  1UNS A;  3TQY A;  1DON A;  3TS0 A;  1TS5 A;  1F2Z A;  1FL0 A;  2NVY H;  4LUZ A;  3PZA A;  1Y14 B;  4GKJ L;  1DZ1 A;  4RFB A;  5IGF A;  1WTP A;  4C3I H;  1IW7 D;  1P7P A;  1SEB D;  2FFK B;  2CKC A;  3ND8 A;  2M6P A;  3RZ6 A;  1AFP A;  2RQX A;  1SSO A;  3MXU A;  1S5E D;  4HTH A;  4GN4 B;  4DV6 L;  2E2I L;  4CJ1 B;  2L15 A;  3H0G L;  1QVF A;  2R93 H;  5T1I A;  2APO B;  3CD6 A;  5D14 A;  4AHX A;  4OIK A;  4ZYS A;  1FHM A;  4N8F A;  3T1H L;  1Q46 A;  1HTL D;  1Y1V B;  4JC0 A;  5C4X B;  4BBS G;  1PXU A;  1SFO B;  4G6B A;  1TWC L;  1I4G A;  4JI1 Q;  5EKI A;  5EIN C;  1QCV A;  2JN4 A;  1ZYR D;  3TDQ A;  1TWG H;  2XN9 C;  3JC6 3;  1H9J A;  2AKW B;  2QEJ C;  1CQV A;  1IRN A;  1UEB A;  2R6G A;  2B2W C;  3WOE A;  3HOY H;  2HQE A;  2H1E A;  2RDH A;  5FOB B;  1K83 L;  1WJJ A;  1ENA A;  1RB9 A;  5M5X B;  4DK0 A;  3I7F A;  1GJX A;  4P74 A;  4CHT B;  1FGB D;  1VMP A;  3K5N A;  4EQP A;  2B63 H;  1PRT B;  1UE6 A;  2Q8R E;  5FLX L;  3FRP B;  4A3L L;  4R4I A;  1PRT D;  4AHZ A;  4LF6 L;  1WTR A;  1N33 L;  5A2Q E;  2SNM A;  1PH4 A;  1PRT F;  2H5X A;  3CCL A;  3S14 H;  5BR8 Q;  2UUA Q;  4JI2 Q;  3GO5 A;  2LS0 1;  3NTH A;  3PMF A;  4DPG A;  3DLL A;  4HMI A;  3T13 A;  2FMC A;  2JP1 A;  3J7Z 1;  3HOX G;  3I4N G;  5CV4 A;  4NP5 A;  3SVM A;  2VQE Q;  1HNX L;  2QIL A;  3MXP A;  1XPR A;  3S16 B;  2EYO A;  4M8A A;  5EKL A;  4DR6 Q;  5HGQ A;  2I46 A;  5ELD A;  1QUQ B;  3U9S A;  1B2O A;  3RZD B;  2O5J D;  4HED A;  3VR6 A;  5M3F H;  1K73 C;  4WFN 3;  4CDD C;  2K32 A;  3CCM A;  4E6Y A;  3SK4 A;  3VR4 A;  5I4D A;  2AQ2 B;  3S1N H;  3K6O A;  3H97 A;  3BG3 A;  3U58 A;  1YJN A;  1A6X A;  4OL7 A;  4AQY Q;  2K28 A;  3PIP A;  3QWN A;  1HNW L;  4B9W A;  2JA6 B;  4IOA A;  1EY8 A;  1VZH A;  3BZK A;  3S1R H;  1UEA B;  4KMU C;  1XNR Q;  2NVX B;  3E6Z X;  5CC4 A;  1HXY D;  1HUM A;  1PZJ D;  1XXG A;  5JOB A;  3FHW A;  1L0Y B;  3KF6 A;  2ZTC A;  3S1Q H;  3GTJ H;  5TSS A;  4LF4 L;  3S1M B;  3HS0 C;  2ZXO A;  1EU3 A;  4KJN A;  3RLN A;  4IFD G;  4FDB A;  1Q1B A;  2BA1 A;  1GOZ A;  4HCE A;  3VYU A;  1S24 A;  3S2D H;  1C48 A;  1HUN A;  4CKE A;  4WFN 1;  2NYD A;  3HOW G;  2HR5 A;  2K7V A;  1KDC A;  2R92 B;  2LXK A;  2F0K A;  3A7A B;  4DAV A;  2XWJ B;  2JA7 H;  3OMC A;  5AFW A;  4K8J A;  2WAQ B;  1UUP A;  4K5V A;  4X6A H;  4DV5 Q;  3TBI B;  2Z0S A;  2R7Z G;  2J7Z A;  5IT9 c;  2PI2 E;  3HGB A;  3W1B A;  1H9R A;  3CXC A;  1TS3 A;  1PV4 A;  2RCF A;  4UY8 C;  2L12 A;  3HJW B;  2Y0S E;  3FKI H;  1F9S A;  2UXD L;  3PO3 G;  5ELN A;  3W1G A;  1CSQ A;  3K0X A;  1LTT D;  1E22 A;  2AUJ D;  1LTB D;  4BY1 G;  3QOL A;  1TVX A;  3E5S A;  5L37 A;  3ONA B;  4U67 3;  3U9O A;  3LWU A;  2EYH A;  4X3S A;  4Y7N L;  1VQO A;  4DFA A;  4A93 B;  4KY5 A;  4YWL A;  3TZD A;  2EY5 A;  4AHW A;  4LFA Q;  5IGC A;  1NE3 A;  4LJZ C;  4BA1 I;  3G4S A;  3F2U A;  2K5V A;  2RBM A;  1PLF A;  2V4D A;  4C3I G;  4BY7 H;  2B8G A;  2DJG C;  2IY5 B;  3A54 A;  4DNT B;  1FHH A;  4AI3 A;  5M5W L;  1XNQ L;  1HZA A;  2AYJ A;  1BDO A;  2RKS A;  3MTS A;  1U0L A;  3K35 A;  1STB A;  3PO3 L;  4CKC A;  2ES2 A;  1L1O C;  1P16 A;  4X64 L;  2R93 G;  1SYC A;  1HZ9 A;  2CVR A;  4DV3 L;  1HJP A;  2K5H A;  2AWO A;  2XIW A;  2Z6B A;  4R4C A;  1EQQ A;  1R9T H;  1DOM A;  1I6V C;  4V19 6;  1CAD A;  2OQ0 A;  5GRO A;  2J0T D;  3H94 A;  2XJS A;  2I07 B;  2L11 A;  4LF7 L;  2OWO A;  3G48 A;  1RCV D;  3QIA A;  4JAF A;  4A3E L;  8RXN A;  2IPK D;  2JE6 I;  5M3M B;  3KK7 A;  5C3E B;  1TY0 A;  1EOV A;  3RR5 A;  3NXW A;  1ENF A;  3NUC A;  4C3H G;  1H9K A;  4HJA A;  1SYE A;  3HOY G;  5A2Q L;  3T4A C;  1DXM A;  3OIQ A;  1LV9 A;  3LWV B;  4LF5 L;  2YYZ A;  3P7J A;  2F0N A;  1EFI D;  5JEA H;  2NVT L;  4DR7 L;  2VS1 A;  1LKM A;  4S3S A;  2O5I C;  3JR7 A;  2B63 G;  4RG1 A;  2O2L D;  3L2P A;  2M00 A;  3PO2 G;  4ODG A;  4AYB G;  2PO4 A;  4MN3 A;  4DV0 L;  2JK8 A;  4JPB W;  4Y52 H;  1JQY D;  4CJ2 C;  1OWC A;  2HDL A;  5M9O A;  1EZ8 A;  2AUK A;  5CV7 A;  4J8Q A;  4KY6 A;  5JPN C;  3KYV A;  4K14 A;  3S16 H;  5H1S E;  3Q0A A;  4GKJ Q;  2PZU A;  2MPM A;  4IUV A;  4C3H L;  1CT1 D;  4IZ8 A;  1RYQ A;  1T5E A;  5ELB A;  3X3N A;  5IYB G;  2QGQ A;  1O78 A;  5JPM C;  1G29 1;  3SR1 A;  4IFD I;  3PF4 A;  3KLW A;  3CC2 A;  3J81 i;  3TP7 A;  1BUV T;  4DV6 Q;  1LM0 A;  4EQN A;  1EUJ A;  3IAY A;  2L5T A;  2F3I A;  1HRJ A;  2N49 A;  3PO2 L;  4F7X A;  4H02 A;  1TWA L;  4PG3 A;  1KRS A;  1SE2 A;  3T1H Q;  4N9T A;  2NVX H;  3DXJ C;  3RLO A;  3JC6 6;  1YV1 A;  1DX8 A;  3Q22 A;  1TWF L;  5C44 H;  2ERS A;  1SMY C;  2NUC A;  1OXT A;  2RF4 A;  1TY2 A;  3HOV L;  1Z47 A;  4C3J B;  2EYJ A;  1SNM A;  1D8L A;  2K01 A;  4YCV A;  3K7A H;  5CV5 A;  4ZAI A;  3BZC A;  3H9C A;  1ESR A;  2EY4 E;  5IYB L;  5KRU A;  2R92 H;  2EOT A;  4OX9 L;  2JA8 L;  2IHE A;  3E0E A;  4A3K H;  1SYG A;  2DJF C;  2WB1 B;  5LHY 1;  2CKA A;  1SXT A;  2JA7 G;  1S3O A;  4LF6 Q;  1LTS D;  3I56 A;  1W6K A;  4BXX H;  3GV6 A;  1N33 Q;  1XMQ L;  4LFB L;  4OO1 G;  1YNN D;  4LF9 L;  4ZN1 B;  1AW7 A;  1L2F A;  5IP7 L;  2MO1 A;  5MF6 A;  2KCT A;  1C0A A;  3OTO L;  3I4M L;  3HJY B;  1I50 L;  3FKI G;  1QZG A;  4LHL A;  1SYD A;  1YK4 A;  1N8R C;  1RD9 D;  5HGT A;  2YV5 A;  1JMC A;  1HNX Q;  1S4Z A;  2RCN A;  5EBD A;  4XDX A;  3I3C A;  3TP8 A;  4HSP A;  2KN9 A;  1FYC A;  2K75 A;  1KNA A;  2HDM A;  2L4N A;  2R7D A;  2A1A A;  5JVG 1;  4A3F B;  1STY A;  1VQC A;  1JIC A;  1SRO A;  1PFY A;  3RMH A;  2MS3 A;  1XMO L;  1GKH A;  2X6L A;  1A8V A;  1XWE A;  1Z92 B;  2I5M X;  3NQT A;  1JWU D;  1HNW Q;  1IW7 C;  1I6H H;  1Y1W H;  1D1K A;  3CCU A;  1T9H A;  4IUU A;  2IX3 A;  3D8G A;  4HIM A;  1BQ9 A;  2E2H B;  2XJP A;  2B2T A;  4CBV A;  4JAD A;  1RDG A;  2E75 C;  4ME5 A;  1C09 A;  5C4X G;  3PKJ A;  4LF4 Q;  1LKO A;  1SBB B;  3RLF A;  4KHV A;  2K52 A;  4ZUI A;  3E3X A;  2ZXP A;  2F0G A;  3BDO A;  1G51 A;  1LAB A;  3GQB A;  4DAY A;  5I6W A;  2RFK B;  1HZB A;  1X6O A;  4KHP Q;  4ILW A;  4PZ6 A;  1GM5 A;  4RKL A;  3ERQ A;  1TII D;  1VQH A;  4ULL A;  1YHA A;  2N8N A;  1K8M A;  5IE8 A;  4XQN A;  1ASY A;  4UHV A;  1CKN B;  5M5W B;  2E2I H;  3H0G H;  4NXN L;  2UXC L;  3M9B A;  1YNX A;  4XQJ A;  3P2A A;  4N8X 1;  2NZ1 D;  2CW0 D;  2UXD Q;  3TZU A;  1Y1V L;  2E74 C;  5C4X L;  2F0M A;  1SFO L;  2B2Y A;  1IYV A;  1MJE A;  1VQ8 A;  3PIP 3;  2B5I D;  1TWC H;  3QG1 A;  1OXV A;  1XPO A;  1YIJ A;  2EE1 A;  3QR8 A;  1Y8N B;  1RHP A;  2DY8 A;  2WV6 D;  1X55 A;  3PUZ A;  4KD4 A;  4IUN A;  4KKS A;  2FMM A;  1EYA A;  1WTH A;  2B2T C;  1TS4 A;  3S2H L;  1KNE A;  4NW2 A;  1NNX A;  2QDB A;  7RXN A;  3KOJ A;  1ML0 D;  1K83 H;  2K33 A;  4DUY L;  5M5X L;  4H7B A;  2C5C A;  1K0R A;  4UY8 1;  3MA2 B;  1XNQ Q;  1QYB A;  2A6H D;  4B08 A;  4RMF A;  1C4Q A;  2ZXR A;  3A8I E;  1JJ2 A;  4PMW A;  4A3L H;  3PUX A;  5K5P A;  3EBE A;  4AR3 A;  1V43 A;  4X64 Q;  2JA6 G;  3PIP 1;  1ET9 A;  1V9P A;  3OHX C;  4TQU S;  3NHH A;  3KLS A;  4KKT A;  5CV6 A;  5FLX c;  5LL6 X;  4DR4 L;  4OO1 I;  4ZCK A;  1V1O A;  2EYM A;  2I5H A;  4C56 C;  1CHP D;  1WD0 A;  4LF7 Q;  1QB5 D;  3UE0 A;  1L1O B;  3FMC A;  5BN5 A;  4C2M 1;  1M8A A;  4LUO A;  4QY7 A;  3L3O C;  5IY0 A;  1P8L A;  1BVS A;  5I9P A;  1Q8K A;  5IWA L;  1F2L A;  3NEN A;  3RZD L;  3EFX D;  2B2Y C;  2EJM A;  3ND9 A;  1BBX C;  4B9X A;  3DM1 A;  4GS7 D;  3F2D A;  2R92 G;  1PYW D;  3ERO A;  4LF5 Q;  5LMU L;  4A3K G;  3HOU B;  1QJO A;  2WAQ G;  4GS3 A;  2JA6 L;  3MAQ A;  4ZUJ A;  3SK5 A;  3PF5 A;  1NUC A;  2Q8I B;  1QIL A;  3RZO L;  2GVB A;  1LLR D;  1T9P A;  4QMG A;  3S1M L;  4XYO A;  3MQK B;  4DXF A;  2FJ2 A;  4DA2 A;  1PFV A;  1GVP A;  3UI2 A;  3O13 A;  4K2K A;  4A93 G;  3ER0 A;  1BCP D;  1SDF A;  3CHB D;  5E4W C;  3CF5 A;  1PH2 A;  3RUZ A;  1KDA A;  2P5Z X;  2OT2 A;  2F52 A;  2PYK A;  1MSG A;  4A3J B;  1MBY A;  2A6E D;  2Y0S B;  2XJQ A;  3EN2 A;  4X3U A;  3SEB A;  3KF8 A;  1FVI A;  3CKI B;  3D6C A;  3C3L A;  1Y1W G;  2CHB D;  1Q1E A;  4DF7 A;  2F0F A;  4GNX B;  1ZXT A;  2C6B A;  5LMN L;  3WWN B;  1I50 B;  2ERJ A;  3DWP A;  1E24 A;  3OW7 A;  4UP7 A;  4Y7N H;  4A93 L;  2JSO A;  4NKL A;  1X3Q A;  1D2B A;  5M3M G;  1S5F D;  2Z9H A;  3DEP A;  5C3E G;  4HJ5 A;  1GHK A;  1VCX A;  2XNA C;  5EPJ A;  3KUP A;  4J6H A;  2ZJQ A;  1D5Z C;  1XX8 A;  5M5W H;  2MNA A;  1XMQ Q;  4LFB Q;  2LMC B;  4LF9 Q;  4O2D A;  2PZT A;  2F0E A;  5D65 A;  5CGK A;  2GVA A;  2MFI A;  1B3Q A;  5IGE A;  1KIX A;  3H0G G;  3PO3 H;  2HVY C;  2NYZ D;  1FR3 A;  1LTA D;  4EQ5 A;  4A3B L;  1YNJ D;  3OTO Q;  4RKB A;  4DR2 L;  1V1P B;  4M1U B;  5KYL A;  1EFW A;  3G71 A;  2XGT A;  1EIF A;  1U9R A;  4CDF C;  4A3E H;  1I94 L;  1Q81 C;  2K03 A;  1EQR A;  1PFS A;  5M3M L;  4G57 A;  5C3E L;  1TT2 A;  3I55 A;  2CQO A;  2NVQ B;  2JI3 A;  4JBM A;  2WAQ P;  4IUP A;  1XMO Q;  2XJU A;  2F1M A;  4JVZ A;  2A69 D;  2E2J L;  4QCL A;  4DR1 L;  2IX1 A;  3FP9 A;  3GP7 A;  3G6J B;  1ODH A;  5EQ0 A;  3TEH B;  4K6L A;  1K9M C;  4MZ9 A;  4PZ8 A;  2NVT H;  4KLK A;  2YTV A;  3GTQ B;  1Q82 C;  3ERS X;  4DR3 L;  4A3L G;  3KFU A;  1AP0 A;  2AHO B;  1XTC D;  4GN5 A;  5GAH C;  1JWS D;  1DOL A;  1Q86 C;  4HIO A;  4RGO S;  3H9B A;  3D4R A;  1LT6 D;  2PVE A;  3DM3 A;  2B8F A;  2DUD A;  2R3Z A;  5EAY A;  1WTV A;  3P20 A;  3KYH C;  4C3J G;  1QG7 A;  4K9F A;  1EYC A;  1N34 L;  4NB3 A;  2IW3 A;  3WOF A;  2EQS A;  1I5F A;  2VY3 A;  4C3H H;  4TPU A;  3S2H B;  3KJP A;  1B53 A;  4XYQ A;  5I2Y A;  4A3M B;  4LFC L;  3NQI A;  4UP9 A;  3D0F A;  3CQZ B;  2E2D C;  1S2Z A;  1YVC A;  4X65 L;  4PMB A;  3K58 A;  2PQA A;  2WB1 G;  2KUM A;  4NXN Q;  2UXC Q;  1CZG A;  5FO9 B;  3PO2 H;  1H95 A;  3KYW A;  1TWA H;  2B3G A;  1W6J A;  2KHI A;  2EYF A;  5GAE c;  4IUR A;  4E6I A;  2FIN B;  4C1N I;  4BS9 A;  1TWF H;  3A55 A;  2PW5 A;  1UE5 A;  3HFZ B;  4GN3 B;  2J4X A;  4AR4 A;  2UUC L;  3MC0 B;  1O80 A;  3JAM E;  2SEB D;  3KDF B;  4C3J L;  2B29 A;  3HOV H;  3I8Z A;  3M4Y A;  5EPL A;  4APV A;  3EJI A;  1SNC A;  3OIP A;  3QO2 A;  4H44 C;  5IYB H;  2UUB L;  1K3R A;  2JA8 H;  3B6Y A;  3Q6S A;  4DUY Q;  4GOP B;  1EIH A;  4A3G B;  4A3F G;  1ILQ A;  1CTM A;  4DXG A;  2ZJP A;  4RHR A;  3GTL L;  5COR A;  5D3I B;  4L6T B;  5FO8 B;  1HA6 A;  3L0O A;  3MFY A;  4G7O C;  4H0L C;  1FGU A;  1LUZ A;  4IJH A;  5C4J L;  3I91 A;  2XJT A;  1N9W A;  4LWC A;  5IP7 H;  1PFU A;  2XVS A;  4UP8 A;  4DR4 Q;  5CBE E;  1RDP D;  3I4M H;  5J1Z A;  1I50 H;  2BDO A;  3A44 A;  1PDQ A;  3RZO B;  1IYJ B;  1SYB A;  2A68 D;  4AH6 A;  4EVO A;  5CV8 A;  2A8V A;  3EVQ A;  2PZW A;  2WKD A;  3LGJ A;  4LK1 C;  1X9N A;  3AFP A;  1WCM B;  5C0X J;  5IWA Q;  2LCQ A;  1SE4 A;  2NBF A;  3D4D A;  4Z9C B;  5F2D A;  1WFQ A;  4L5Q A;  3J81 E;  1STH A;  1BOS A;  1BE7 A;  4BBR L;  4A3F L;  2F03 A;  4POF A;  1NTG A;  1A3T A;  5LMU Q;  1E2W A;  4DNR B;  3C46 A;  4HJ8 A;  2BE5 C;  5DLQ E;  2Z6K A;  1SN8 A;  1B2T A;  4JW0 A;  4OO1 H;  2WKC A;  1MD2 D;  3GTG B;  1PTO H;  4IPC A;  3W3A A;  4KN7 C;  3Q23 A;  4IO9 A;  2E2H L;  1C7Y A;  1GUW A;  4KN4 C;  3S15 L;  2MUY A;  3CW2 C;  1K28 A;  3N52 A;  4X3T A;  1SMX A;  5KGU A;  2WII B;  2QCP X;  3MFG A;  2QW7 A;  1I3Q B;  3GTP B;  1H9S B;  2L1B A;  4HJ7 A;  4LNQ A;  1X3P A;  1AEX A;  3FEW X;  1DVB A;  4ZKB B;  4X66 L;  4A3E G;  3H99 A;  3ITP A;  1WVL A;  2WB1 P;  1CAA A;  3N6R A; 
#chains in the Genus database with same CATH homology
 1JE5 A;  3LNL A;  4DR5 L;  4DV1 L;  4PZ7 A;  1Y1V H;  3KYY A;  5C4X H;  4JYA L;  5LMN Q;  3J80 c;  2KHJ A;  1SFO H;  3H3V H;  1W3S A;  2Z6K C;  2JI2 A;  1YUZ A;  2I0Q A;  3CC7 A;  5AN9 H;  5DM6 1;  5H1S c;  3S24 A;  3LPE B;  3JAM i;  3S2H H;  4OXP A;  1NMF A;  2JJQ A;  4NXM Q;  4JOI A;  1CUK A;  1E8J A;  1FJG L;  2PI2 A;  5M5X H;  5GAG c;  3KYX A;  3VDY A;  1IBM L;  3HKZ E;  4QIW E;  3HOU G;  1SLJ A;  5GAD c;  3PWF A;  1BQ8 A;  4DR2 Q;  4YY3 L;  2NZO A;  1RWD A;  2KKD A;  2CWP A;  2PSM C;  4TVM A;  1I94 Q;  1L0W A;  3HOV G;  1JYB A;  2VL6 A;  3RZD H;  4AI1 A;  2OTL A;  2VNU D;  3U4Z A;  1CKO A;  4DR1 Q;  2JA8 G;  1VQP A;  4B3M L;  4QL5 A;  4A3J G;  1GO3 E;  2JA6 H;  2Y0S G;  4DR3 Q;  1VQN A;  4JOI C;  1R0J A;  3RZO H;  3ICE A;  3TRE A;  4DV7 L;  4B3S L;  5IP7 G;  1VZI A;  3S1M H;  1R0H A;  3I4M G;  2ZTE A;  1N34 Q;  1B7Y B;  1M90 C;  1VQJ A;  1M1K C;  2Q2U A;  2CR8 A;  5MLC 3;  2OQK A;  4UPA A;  4LFC Q;  3PGZ A;  4X65 Q;  3CPF A;  1B13 A;  2ZJR A;  1CKM A;  4DAM A;  2IHF A;  1NMG A;  2V0E A;  2K50 A;  3G6E A;  1X65 A;  2UUC Q;  1NXE A;  4DV4 L;  1IRO A;  3M4Q A;  2HQL A;  4YHH L;  4JI5 L;  1VZG A;  1AE3 A;  2UUB Q;  4A93 H;  1O7I A;  2FXQ A;  5DM7 1;  4JCV E;  2XJR A;  1X3G A;  2L0Z A;  4AIM A;  4AI2 A;  2AMC B;  1SR3 A;  2HIV A;  2IT1 A;  4A3B H;  1Y1V G;  2GN5 A;  3CP0 A;  1KXL A;  3RN5 A;  3CCQ A;  3J7A 5;  1WYD A;  4B3T L;  5M3M H;  5C3E H;  4GLX A;  1MKH A;  1QUQ A;  1Z9F A;  1X56 A;  5JEA J;  3B0A B;  2VZA A;  5EIO C;  4A3M G;  1QVC A;  2E2J H;  1KAW A;  4IPH A;  2R7F A;  5GAG C;  2EXD A;  3UDG A;  2D62 A;  1JB7 A;  2F4V L;  4HJ9 A;  1YBY A;  4P73 A;  5GAD C;  1E1T A;  4AHY A;  2N78 A;  3F2B A;  1PYB A;  1RIP A;  3ULL A;  2KCM A;  1A0I A;  4X66 Q;  1BRF A;  4ZN3 B;  1NBW A;  1VQM A;  1EWI A;  1JJC B;  4A3G G;  1MIU A;  1OTC A;  2UU9 L;  4AI0 A;  1R0I A;  2RHQ B;  1HZC A;  4DR5 Q;  3CC4 A;  4DV1 Q;  1YJ9 A;  3KF6 B;  1R0G A;  2C6A A;  4JYA Q;  4DV3 Q;  4K0K L;  4POG A;  1V1Q A;  4C3J H;  3A0J A;  1WCM G;  1PH1 A;  1FJG Q;  1YUX A;  6RXN A;  1PH8 A;  1PH6 A;  2RDV A;  4OON A;  3K8A A;  3SS2 A;  1IBM Q;  2XJV A;  3GTL H;  4EX5 A;  4JI4 L;  4DR7 Q;  4JBW A;  2K5N A;  1NXG A;  5C4J H;  4DV0 Q;  4YY3 Q;  3J7Y 1;  1QVG A;  3KJO A;  5JJI A;  2M4V A;  3PIO A;  1D7Q A;  4R4Q A;  2I5L X;  3K81 C;  1Q12 A;  5HY6 A;  4JI0 L;  1IBL L;  3H3V I;  1IU5 A;  4BBR H;  4A3F H;  5AI2 A;  1XJV A;  4AR5 A;  4B3M Q;  1PVO A;  2E8G A;  2E2H H;  1CSP A;  3S15 H;  1XTD A;  5K36 G;  4DV7 Q;  1N32 L;  4A3B G;  4DK6 C;  2AWN A;  2BH2 A;  3NEM A;  4MNO A;  1E3P A;  3CCV A;  2NN6 G;  4OX9 Q;  4BA2 I;  4KHZ A;  2IX0 A;  5RXN A;  5AJ3 L;  1UE7 A;  1KC8 C;  3RN2 A;  2PPT A;  2DGY A;  3TRZ A;  1SMM A;  1K8G A;  1LTL A;  2D0P A;  1HR0 L;  4DV4 Q;  4YHH Q;  4JI5 Q;  3I2Z A;  4P71 A;  3D31 A;  5FLM H;  5K2M E;  1T9O A;  1HH2 P;  5FJ8 G;  1U5K A;  1N36 L;  1VQL A;  3RYG A;  4MTN A;  1VQG A;  4A3I G;  3RNU A;  1LYL A;  3U50 C;  2RHS B;  2CFM A;  2D0O A;  4X62 L;  3JAM c;  3ZG6 A;  2ASB A;  2HHH L;  1VS0 A;  4B3T Q;  1RDV A;  4ALP A;  1VQ7 A;  1C9O A;  1J6Q A;  2VW9 A;  3HOU H;  2PNH A;  1VQF A;  2Q2H A;  3SGI A;  3M7N A;  4JI7 L;  1VQD A;  2F4V Q;  3AYH B;  4GKK L;  4IPG A;  3M85 A;  2ZIX A;  3E9I A;  2UXB L;  1PA6 A;  2QEX A;  4QQB X;  3EIV A;  5JJL A;  4IPD A;  4JBK A;  4XXB B;  3J81 c;  3Q8D A;  3CPW A;  3STB D;  3A5Z B;  3CAM A;  3CMA A;  3AFQ A;  1ASZ A;  2ID0 A;  3AQQ A;  4BBR G;  2JEB I;  2NN6 I;  2UU9 Q;  4A3J H;  2Q2I A;  1CKN A;  1B70 B;  1VQE A;  4A3D G;  2MO0 A;  3CME A;  1WJV A;  1YZ6 A;  4IFD J;  4K0K Q;  3NEL A;  3CCJ A;  4JI6 L;  4LHN A;  2Z3R B;  4XGH A;  1WOC A;  1VQI A;  2K14 A;  4DAY B;  2PMZ E;  1JT8 A;  3WWL A;  4R4O A;  2KBN A;  2JQO A;  3PUW A;  5AI3 A;  3HOZ G;  1UWV A;  1X3E A;  4JI4 Q;  4AYB E;  1YEZ A;  5IYD H;  1WI5 A;  4B3R L;  1YHB A;  3HKS A;  2DSX A;  1L1O A;  4KHP L;  4L5S A;  1T9Q A;  2K4K A;  4DUZ L;  1JJG A;  5ELO A;  4JI0 Q;  1IBL Q;  5C0X G;  5FLM G;  2NVQ H;  5LMN W;  3A74 A;  5JVH 1;  1H7V A;  1YJW A;  2JA5 H;  4YCW A;  2NZH A;  4L5T A;  1YK5 A;  3GTQ H;  1PH9 A;  3QVD A;  1N32 Q;  2E5L L;  1KL9 A;  2OCE A;  3UDI A;  1K8A C;  1DGS A;  1VQA A;  1HNZ L;  2A19 A;  1HR0 W;  3BU2 A;  1Q7Y C;  4A3M H;  1YHQ A;  3WWV A;  2CWA A;  2N3S A;  1LKP A;  3CQZ H;  4LF8 L;  3NFP I;  4OWW B;  5AJ3 Q;  4JG2 A;  3IU3 I;  4U67 1;  2PYA A;  5J3B A;  4QGU A;  4JBJ A;  1S30 A;  1HR0 Q;  1VCI A;  4GNX A;  4RXN A;  4IOC A;  1E1O A;  3I4O A;  3UDX A;  5GAE C;  1PHJ A;  2LXJ A;  3CCS A;  2VQF L;  3PIO 1;  2HT1 A;  2MQH A;  3F2C A;  1MJC A;  1N36 Q;  4A3G H;  1IBK L;  3KF8 B;  2ZM6 L;  4DV2 L;  3GDE A;  3T1Y L;  4JAE A;  1W2B A;  2KEN A;  1E7Z A;  4X62 Q;  1KRT A;  2ALY B;  4IJL A;  3F1Z A;  1UE1 A;  2HHH Q;  4A3C H;  3PUV A;  4DKA C;  5M3F G;  3J81 j;  2JEA I;  1WCM H;  4O0A A;  5IYC H;  4ME3 A;  1OXU A;  1J5E L;  4GNX C;  4JI8 L;  1S40 A;  4DNI A;  5C0X I;  1SRU A;  3PUY A;  4JI7 Q;  3GTG H;  1B71 A;  2VUM H;  5MGN A;  1PH5 A;  4WJ4 A;  5M5Y H;  4GKK Q;  4OWT B;  5IYD G;  3MPS A;  1BBW A;  2UXB Q;  1NY4 A;  1X3F A;  5IP9 H;  4JI3 L;  1I3Q H;  3GTP H;  3QQC E;  3E9H A;  1RYT A;  1VQ5 A;  3PV0 A;  1SMW A;  3GTO H;  3HKZ G;  3CCR A;  1IXR A;  1VQ6 A;  2JA5 G;  3OW2 A;  5E7N A;  4LW1 A;  3B08 B;  4AR6 A;  3UDF A;  2M4Y A;  4JI6 Q;  4JV5 L;  1VQ4 A;  1ZRP A;  2V1C C;  3K7U C;  4OWX B;  2ATW A;  3KDF A;  1A62 A;  2XTI A;  4HID A;  2M6O A;  4DK3 C;  3S17 H;  1X54 A;  1OXX K;  2CKZ B;  1VQK A;  4BY7 G;  5MFP A;  2QA4 A;  4TVA B;  1RL2 A;  4GOP A;  2PQA B;  3VPB E;  3GTM H;  3A5U A;  2WAQ E;  1BKB A;  1XPU A;  3ULP A;  2K2D A;  1KD1 C;  5MFZ A;  4JI1 L;  4B3R Q;  1PYS B;  3J80 i;  2BE5 D;  1GD7 A;  3JC6 2;  3MSU A;  3PKI A;  4DUZ Q;  3J7Z C;  1G6P A;  2Z3Q B;  3KYU A;  4KI0 A;  4B8C D;  3IRB A;  5FJ8 H;  2GMG A;  5JEA G;  1R0F A;  3STB C;  4GLA C;  5BR8 L;  2UUA L;  4JI2 L;  4A3I H;  3GD7 A;  1KHI A;  4GOP C;  3RZT A;  1VQ9 A;  2E5L Q;  4JAG A;  1TWH H;  2VQE L;  1SMU A;  1NNQ A;  4DR6 L;  1QZH A;  2BH8 A;  1YI2 A;  3GTK H;  2WFW A;  1HNZ Q;  3PSI A;  4A4I A;  4A3C G;  2JI1 A;  1BFY A;  2C35 B;  5IYC G;  5GAH c;  3MEF A;  4J15 A;  4AQY L;  1OXS C;  4LF8 Q;  4BBS H;  3K80 C;  2QL0 A;  2CCZ A;  1XNR L;  1A63 A;  1B8A A;  4YCU A;  3UE1 A;  1TXY A;  3F8T A;  5C44 G;  1PH3 A;  1IZ6 A;  2VUM G;  2V0F A;  3OYY A;  3TS2 A;  2HIX A;  3ULJ A;  4XTC S;  2VQF Q;  4YWM A;  5IP9 G;  3CCE A;  1BBU A;  4DV5 L;  1IBK Q;  2ZM6 Q;  4BXX G;  4DV2 Q;  1PH7 A;  4R1J A;  3BJU A;  1SE8 A;  2JA9 A;  4A3D H;  3T1Y Q;  1S72 A;  3HOX H;  3I4N H;  3M3Y H;  3P8B A;  1VQB A;  1OWB A;  3MXN B;  4B3S Q;  1IU6 A;  4R4T A;  4LFA L;  4WJ3 M;  4P72 A;  1J5E Q;  4NPS A;  4XIG S;  4A76 A;  4JI8 Q;  3HOZ H;  3W5O A;  2WB1 E;  2ZTD A;  3L7Z C;  5GQO A;  3H15 A;  2OTJ A;  2EIF A;  1B2J A;  1AE2 A;  1EYG A;  1AH9 A;  3AEV A;  4HIK A;  2WP8 J;  3HOW H;  2LSS A;  1KQS A;  1NJI C;  4JI3 Q;  3ZJY C;  4NXM L;  2YTY A;  4YWK A;  3PCO B;  2BA0 A;  2Q2T A;  3M4P A;  2R7Z H;  3U4V A;  2PVX A;  1YIT A;  2YU9 H;  2H12 A;  2V3B B;  4P75 A;  5JJK A;  4LUV A;  4L5R C;  1IL2 A;  4QJF A;  2J9U B;  2YTX A;  4A75 A;  4BY1 H;  1EIY B;  4GLV B;  3M4O H;  4C2M H;  3NBH B;  4JV5 Q;  3TQY A;  3TS0 A;  1FL0 A;  2NVY H;  4LUZ A;  3PZA A;  1Y14 B;  4GKJ L;  4C3I H;  1IW7 D;  2CKC A;  2M6P A;  3RZ6 A;  4DV6 L;  4GN4 B;  2L15 A;  1QVF A;  2R93 H;  3CD6 A;  4AHX A;  1FHM A;  3T1H L;  1Q46 A;  4JC0 A;  4BBS G;  4G6B A;  4JI1 Q;  5EIN C;  1QCV A;  1TWG H;  3JC6 3;  2AKW B;  1UEB A;  1IRN A;  2R6G A;  3HOY H;  1WJJ A;  1RB9 A;  3I7F A;  4P74 A;  2B63 H;  1UE6 A;  4R4I A;  4LF6 L;  4AHZ A;  1N33 L;  1PH4 A;  2H5X A;  3CCL A;  3S14 H;  5BR8 Q;  2UUA Q;  4JI2 Q;  3GO5 A;  4DPG A;  3DLL A;  3HOX G;  3J7Z 1;  3I4N G;  2VQE Q;  1HNX L;  1XPR A;  4DR6 Q;  5HGQ A;  1QUQ B;  1B2O A;  2O5J D;  5M3F H;  1K73 C;  3CCM A;  4E6Y A;  3S1N H;  3U58 A;  1YJN A;  4AQY Q;  3PIP A;  1HNW L;  4IOA A;  1VZH A;  3BZK A;  3S1R H;  1XNR Q;  3FHW A;  3KF6 A;  2ZTC A;  3S1Q H;  3GTJ H;  4LF4 L;  3RLN A;  4IFD G;  4FDB A;  1Q1B A;  2BA1 A;  1S24 A;  3S2D H;  4WFN 1;  2NYD A;  3HOW G;  2HR5 A;  2LXK A;  2JA7 H;  4X6A H;  4DV5 Q;  2Z0S A;  2R7Z G;  5IT9 c;  2PI2 E;  3W1B A;  3CXC A;  1PV4 A;  4UY8 C;  2Y0S E;  2UXD L;  3FKI H;  3PO3 G;  5ELN A;  3W1G A;  1CSQ A;  3K0X A;  1E22 A;  4BY1 G;  1VQO A;  4YWL A;  4AHW A;  4LFA Q;  1NE3 A;  4BA1 I;  3G4S A;  2K5V A;  4BY7 H;  2IY5 B;  1FHH A;  4AI3 A;  1XNQ L;  1HZA A;  2AYJ A;  1U0L A;  3K35 A;  2ES2 A;  1L1O C;  1P16 A;  4X64 L;  2R93 G;  1HZ9 A;  4DV3 L;  1HJP A;  2K5H A;  2AWO A;  4R4C A;  1EQQ A;  1R9T H;  4V19 6;  1CAD A;  2OQ0 A;  5GRO A;  2XJS A;  4LF7 L;  2OWO A;  3G48 A;  4JAF A;  8RXN A;  2JE6 I;  1EOV A;  3RR5 A;  4HJA A;  3HOY G;  4LF5 L;  2YYZ A;  4DR7 L;  2VS1 A;  1LKM A;  2B63 G;  4RG1 A;  3L2P A;  3PO2 G;  4AYB G;  4DV0 L;  2JK8 A;  4Y52 H;  1OWC A;  3S16 H;  3KYV A;  5H1S E;  4GKJ Q;  1RYQ A;  5IYB G;  2QGQ A;  1G29 1;  4IFD I;  3PF4 A;  3KLW A;  3CC2 A;  3J81 i;  4DV6 Q;  1LM0 A;  1EUJ A;  2F3I A;  2N49 A;  4H02 A;  4PG3 A;  1KRS A;  3T1H Q;  2NVX H;  3RLO A;  3JC6 6;  1YV1 A;  1DX8 A;  5C44 H;  2ERS A;  1OXT A;  2RF4 A;  1Z47 A;  1D8L A;  4YCV A;  3K7A H;  3BZC A;  2R92 H;  4OX9 L;  2IHE A;  3E0E A;  4A3K H;  2CKA A;  2JA7 G;  1S3O A;  4LF6 Q;  3I56 A;  4BXX H;  1N33 Q;  1XMQ L;  4LFB L;  4OO1 G;  4LF9 L;  4ZN1 B;  1L2F A;  2MO1 A;  5MF6 A;  2KCT A;  1C0A A;  3OTO L;  3FKI G;  1QZG A;  4LHL A;  1YK4 A;  1N8R C;  2YV5 A;  1JMC A;  1HNX Q;  2RCN A;  2KN9 A;  2K75 A;  2R7D A;  2A1A A;  5JVG 1;  1VQC A;  1SRO A;  1XMO L;  2MS3 A;  1GKH A;  1A8V A;  1Z92 B;  2I5M X;  1HNW Q;  1I6H H;  1Y1W H;  3CCU A;  1T9H A;  4HIM A;  1BQ9 A;  2XJP A;  4JAD A;  1RDG A;  1C09 A;  5C4X G;  3PKJ A;  4LF4 Q;  1LKO A;  3RLF A;  2K52 A;  1G51 A;  1HZB A;  1X6O A;  4KHP Q;  4PZ6 A;  1GM5 A;  1VQH A;  1YHA A;  2N8N A;  5IE8 A;  1ASY A;  1CKN B;  2E2I H;  3H0G H;  4NXN L;  2UXC L;  3M9B A;  1YNX A;  3P2A A;  2UXD Q;  1MJE A;  1VQ8 A;  2B5I D;  1TWC H;  1OXV A;  1XPO A;  1YIJ A;  1X55 A;  3PUZ A;  7RXN A;  3KOJ A;  1K83 H;  4DUY L;  1K0R A;  4UY8 1;  1XNQ Q;  1QYB A;  2A6H D;  4RMF A;  1JJ2 A;  4PMW A;  4A3L H;  3PUX A;  3EBE A;  4AR3 A;  1V43 A;  4X64 Q;  2JA6 G;  3PIP 1;  1V9P A;  4TQU S;  5FLX c;  4DR4 L;  4OO1 I;  2I5H A;  4LF7 Q;  3UE0 A;  1L1O B;  4LUO A;  4QY7 A;  5IY0 A;  1P8L A;  1BVS A;  1Q8K A;  5IWA L;  3NEN A;  2R92 G;  4GS7 D;  3F2D A;  4LF5 Q;  5LMU L;  4A3K G;  2WAQ G;  4GS3 A;  3PF5 A;  2GVB A;  1T9P A;  1GVP A;  4A93 G;  3ER0 A;  3CF5 A;  1PH2 A;  2F52 A;  2A6E D;  2XJQ A;  3EN2 A;  1FVI A;  1Y1W G;  1Q1E A;  4GNX B;  2C6B A;  5LMN L;  3WWN B;  2ERJ A;  1E24 A;  4UP7 A;  4Y7N H;  5M3M G;  4HJ5 A;  5C3E G;  1VCX A;  2ZJQ A;  5M5W H;  2MNA A;  1XMQ Q;  4LFB Q;  4LF9 Q;  4O2D A;  2GVA A;  2MFI A;  3PO3 H;  1KIX A;  3H0G G;  4EQ5 A;  3OTO Q;  4DR2 L;  1EFW A;  3G71 A;  2XGT A;  1EIF A;  4A3E H;  1I94 L;  1Q81 C;  1EQR A;  1PFS A;  3I55 A;  2CQO A;  2JI3 A;  4JBM A;  1XMO Q;  2XJU A;  2A69 D;  4DR1 L;  2IX1 A;  3FP9 A;  1ODH A;  3TEH B;  1K9M C;  4MZ9 A;  4PZ8 A;  2NVT H;  4KLK A;  2YTV A;  1Q82 C;  3ERS X;  4DR3 L;  4A3L G;  3KFU A;  2AHO B;  4GN5 A;  5GAH C;  1Q86 C;  4HIO A;  2PVE A;  3DM3 A;  2DUD A;  5EAY A;  3KYH C;  4K9F A;  1N34 L;  4NB3 A;  2EQS A;  1I5F A;  2VY3 A;  4C3H H;  4TPU A;  3KJP A;  4LFC L;  4UP9 A;  3D0F A;  1S2Z A;  1YVC A;  4X65 L;  2PQA A;  2WB1 G;  4NXN Q;  2UXC Q;  3PO2 H;  1H95 A;  3KYW A;  1TWA H;  2B3G A;  2KHI A;  5GAE c;  1TWF H;  1UE5 A;  3HFZ B;  4GN3 B;  4AR4 A;  2UUC L;  3KDF B;  2B29 A;  3HOV H;  4APV A;  5IYB H;  2UUB L;  1K3R A;  2JA8 H;  3B6Y A;  4DUY Q;  4GOP B;  4A3F G;  2ZJP A;  3L0O A;  1FGU A;  1LUZ A;  4IJH A;  2XJT A;  1N9W A;  4LWC A;  5IP7 H;  4UP8 A;  4DR4 Q;  3I4M H;  1I50 H;  3A44 A;  1IYJ B;  2A8V A;  2A68 D;  4AH6 A;  3LGJ A;  1X9N A;  3AFP A;  5C0X J;  5IWA Q;  2LCQ A;  1WFQ A;  4L5Q A;  1BE7 A;  4POF A;  1NTG A;  5LMU Q;  4HJ8 A;  5DLQ E;  2Z6K A;  1SN8 A;  4IPC A;  4IO9 A;  1C7Y A;  3CW2 C;  1SMX A;  4HJ7 A;  4LNQ A;  1DVB A;  4X66 L;  4A3E G;  1CAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...