2VL6A

Structural analysis of the sulfolobus solfataricus mcm protein n- terminal domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
259
structure length
259
Chain Sequence
QIDYRDVFIEFLTTFKGNNNQNKYIERINELVAYRKKSLIIEFSDVLSFNENLAYEIINNTKIILPILEGALYDHILQLDPTYQRDIEKVHVRIVGIPRVIELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVLEMPTICPKCGKPGQFRLIPEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPGDRVKVTGILDIKQDSPVKRGSRAVFDIYMKVSSIEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MINICHROMOSOME MAINTENANCE PROTEIN MCM
publication title Structural Analysis of the Sulfolobus Solfataricus Mcm Protein N-Terminal Domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 66
structure length 259
sequence length 259
chains with identical sequence B, C
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2vl6A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vl6A02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 2vl6A01
3CCMA 1N33L 5LMUQ 3K0XA 4OX9Q 4BA2I 3H0GH 3S1RH 1QVCA 1SROA 3ULPA 3KYVA 2K50A 2BA0A 5H1SE 2N78A 5IYDH 4JI4L 1IYJB 4A3IG 5E7NA 3EIVA 4QY7A 5JJLA 2MO0A 4JG2A 1UE6A 2NVTH 3GO5A 2CCZA 1XNQL 1X3EA 1BBUA 1XJVA 3S14H 4A3BH 1Y14B 3RN5A 1N34L 4JYAL 4R4CA 1GO3E 1E8JA 2GMGA 2ZM6L 1LKMA 4IOCA 3JAMc 4IPCA 3I4MG 2NN6G 3RR5A 2KCMA 1IRNA 1EYGA 4ALPA 3GTGH 1TWHH 1T9QA 3M3YH 3CCLA 3KYXA 4DR7L 1IBML 1I6HH 3I7FA 1GKHA 4HJAA 1E1TA 1RWDA 1BE7A 3S16H 4MNOA 5GQOA 2ZTDA 3S1NH 1PYBA 2I5HA 2Y0SE 4P71A 3D0FA 3U4VA 5M5XH 3VDYA 3HOZG 1T9OA 2A19A 1E7ZA 2R7FA 1PFSA 1N32L 1X55A 5LMNQ 3U50C 2HR5A 1QVGA 1OXVA 2WB1E 4BBRG 1N33Q 4B3SQ 2MFIA 4POFA 4RG1A 3HKZG 4JC0A 4DV2L 1P8LA 4X66L 4BY7H 1BQ9A 1NBWA 3BZKA 2YYZA 1V9PA 4GN5A 4NPSA 4JI0L 3PF5A 1N9WA 1IU5A 5JEAG 5GAHC 1VQPA 1K8AC 2HIXA 5IP7G 1VQ5A 4JI4Q 1K0RA 2E5LL 3UE1A 1AE2A 1BVSA 1HH2P 1XNQQ 3CXCA 4KHZA 3CC4A 1N34Q 4K9FA 4R4QA 1DVBA 2ZM6Q 4JI1L 2LSSA 4GKKL 4IFDG 4A3FH 1AH9A 3J7A5 1IBLL 5C4XH 3FP9A 4PZ7A 4IO9A 1XNRL 4A3JG 5IYCH 2K14A 1IBMQ 3PO3H 4QQBX 1KHIA 1VQ4A 4IJHA 2ZJRA 2E2HH 2A1AA 4KLKA 3J81i 4B3MQ 2JA5G 3PUWA 1IU6A 3HOUG 2KENA 1L1OA 2MQHA 1PV4A 5IY0A 3EN2A 3U58A 1OXTA 3U4ZA 5C4JH 1Q7YC 3KF6B 1K9MC 2E2JH 4PMWA 3TS2A 4AH6A 1S72A 3FKIG 1PA6A 2RHSB 4UP7A 3A44A 4P75A 1VQIA 1VQNA 1VQ9A 2QA4A 2Z6KA 2ALYB 2UUCL 1JE5A 4X66Q 2RCNA 2WAQE 4DV2Q 1EOVA 1UE1A 1X6OA 2BA1A 2ZTCA 1LKOA 3J81j 1R9TH 1QZGA 4JI0Q 4BBSH 1HNWQ 1YZ6A 4QL5A 4YHHL 1QUQA 2OTJA 2E5LQ 1BQ8A 1B70B 4JI8L 1PH7A 2KCTA 1MIUA 1Q1EA 3M7NA 3G6EA 1WJJA 4GNXC 4OXPA 1KC8C 4GKKQ 4JI1Q 2XGTA 1X56A 1BBWA 2AHOB 1IBLQ 4IFDJ 1HZ9A 1YBYA 4XIGS 1C7YA 1VQMA 1XNRQ 1K83H 4NXMQ 5C44G 4L5RC 3L7ZC 3F1ZA 1PH9A 2UXBQ 4X6AH 1H95A 1XPUA 4FDBA 4A3MH 2NVQH 4GKJL 1SMXA 2R92H 1A63A 4P73A 3F8TA 5LMUL 4A4IA 1JJGA 4OX9L 3RZ6A 2NVXH 3STBC 1M90C 5FLXc 1V1QA 1RIPA 4R4OA 2VZAA 3A5ZB 2JA8G 4HJ5A 1NMGA 1LKPA 2JJQA 4GLAC 4JI3L 2CKZB 2UUCQ 3PO2G 2R7DA 3PZAA 3J81c 1IBKQ 4DR1Q 2EIFA 3RZDH 1MJCA 3KOJA 3T1HL 4TVAB 4YHHQ 1B13A 1OTCA 2Q2TA 4DR3L 3RNUA 1VQJA 2K75A 1YJNA 5IP9H 4A3CG 4GOPC 3TREA 4JOIA 4A3DH 3CD6A 2BH8A 3S2DH 1YNXA 1Q46A 3UDIA 4GOPB 3PUZA 1KRSA 1JJCB 2AWNA 3H0GG 4R4TA 3AFQA 4EQ5A 1JJ2A 4A3GH 4JI7L 3M9BA 3ZJYC 4A75A 4BA1I 5IYDG 4LFAQ 3PUYA 2VQFL 2VL6A 1ASZA 3HFZB 1XMOL 1XPRA 1E3PA 1YV1A 2NN6I 2PNHA 4XTCS 1UWVA 4A76A 2YU9H 2IX1A 3CW2C 2VUMH 4A3BG 2DSXA 2OTLA 3AYHB 4DK3C 2IX0A 5C0XJ 3TEHB 4DV4Q 4B3SL 2D0OA 2YTXA 2R93H 5LMNW 4DV1L 1VS0A 2CWAA 1PH1A 4BY1H 4LWCA 4A3EG 1KQSA 1T9HA 1Y1WH 2YV5A 4JI3Q 4AR5A 3HOYH 4NXNL 5EAYA 4QGUA 4MTNA 1S3OA 1Q12A 1EWIA 1I5FA 1VCIA 3T1HQ 1YHAA 2YTYA 4BXXH 4LUOA 4DR3Q 3GTPH 3G71A 4HIKA 1CKNB 4JI2L 4DAYB 3KYHC 3CQZH 4OONA 1TWFH 3W5OA 3CC2A 3L2PA 4LF5Q 1V43A 2Q2HA 3PSIA 1A62A 1MKHA 3ERSX 4LFCL 4BY7G 5JJIA 4JI7Q 1SRUA 1N8RC 3T1YQ 1S24A 4X64L 4DV5Q 4B3ML 3GTOH 1VQEA 1YIJA 2VQFQ 4IFDI 1WCMH 3K7AH 2R7ZH 1XMOQ 3HOVH 3HOWH 3W1BA 1TWGH 4GN4B 3CCUA 3M4OH 1JB7A 1I3QH 3EBEA 4JBWA 5IYBH 1I94L 2Q2UA 2L15A 4B3RL 4HIOA 3HKZE 3CMAA 3CCEA 1VQ6A 4A3FG 1P16A 2AWOA 1CKOA 4L5TA 4AYBE 5C4XG 1NE3A 4ME3A 1YVCA 4YCVA 4AYBG 4DV1Q 3PO3G 1HNWL 2CWPA 1KRTA 3I2ZA 1UE7A 4LFBQ 1KXLA 2R6GA 3HKSA 1DX8A 3PIPA 2N3SA 5GAGC 1VQGA 4PZ6A 5FLMG 4A3KH 1VQOA 3M85A 4NXNQ 2JA6H 5K36G 3PGZA 4AR3A 3PIOA 1TXYA 2OWOA 5M3FH 2M4YA 3AFPA 1X3GA 3KYWA 3GTMH 3CC7A 4YCWA 7RXNA 4JI2Q 1KAWA 1YHQA 3F2BA 2KHJA 4KI0A 2B3GA 1VQBA 1B7YB 3NEMA 1KD1C 2ASBA 2IY5B 1YITA 4R4IA 1XTDA 4NXML 3KF6A 3S1QH 2D0PA 1EIFA 2WFWA 1E1OA 4LF6L 4LFCQ 2UXBL 1B2JA 4X64Q 2B63H 5RXNA 1X3FA 1NMFA 2N49A 4O0AA 4C3IH 4P74A 5IWAL 3UDGA 2DUDA 2HIVA 2KHIA 5IT9c 1S2ZA 2EXDA 1W2BA 3DM3A 3B6YA 3ULLA 4DPGA 1HZBA 1K8GA 5C0XG 1I94Q 4B3RQ 4HJ8A 1VQFA 3PUVA 2UXCQ 1FJGL 1LM0A 2VQEQ 3A74A 5FJ8H 1RDGA 1HZCA 1D8LA 2GVAA 4JCVE 3UE0A 4DK6C 4POGA 3KJOA 3GTJH 3KLWA 4DR1L 1IBKL 4DR6L 1Y1VH 3GDEA 1PH5A 2AMCB 3J80i 5AJ3Q 1MJEA 4Y52H 1SE8A 4DUZL 2V1CC 4IJLA 4DR2L 3TQYA 4O2DA 4YCUA 3S24A 3CCJA 2R92G 2JE6I 1HJPA 2ES2A 3M4QA 4X62L 2PYAA 4GNXB 1PVOA 1L1OC 1HNXQ 4IPGA 4DAMA 4LFAL 1NNQA 2Z0SA 4A3JH 2WP8J 1L1OB 1VQKA 1YHBA 4DKAC 4LF6Q 1R0JA 1VQHA 2I5LX 2RHQB 2H5XA 4LUVA 4TQUS 5GROA 4LF7L 3CPWA 2ZJPA 1HNZQ 3ICEA 4UY8C 1XPOA 1KIXA 1CSPA 1GD7A 5IWAQ 2JA5H 4DV4L 1QYBA 2F52A 3KJPA 2KBNA 1FGUA 4LF8Q 4A3DG 1G6PA 3LGJA 1R0GA 2UUBQ 4IOAA 4JBKA 1XMQQ 1FJGQ 1Z9FA 3NBHB 2UXDQ 4IPHA 1T9PA 4A3GG 1R0HA 4DV0Q 2OCEA 4YWLA 3IRBA 5M3MH 1NJIC 3H15A 4DR6Q 2RDVA 3HOXH 1Q82C 1NTGA 3QVDA 4B3TL 1WYDA 4DUZQ 4DUYQ 1VQ8A 2GN5A 4DR2Q 4DR4Q 1S40A 1TWCH 3SGIA 2VNUD 2VUMG 3I55A 1HR0L 1C09A 3S17H 4LF5L 1Z47A 3CF5A 1Q86C 2NVYH 3E9HA 1CAAA 1YK5A 1K73C 1VQLA 2E8GA 4HJ9A 1KL9A 4X62Q 4K0KL 1PH8A 4BY1G 3I4NH 3T1YL 1BRFA 3J80c 3F2CA 4DV5L 3CCVA 1YJWA 1JMCA 1C0AA 2K2DA 2UUAL 2JA7H 3JC62 1FL0A 2A8VA 3SS2A 4X65L 4LF7Q 4A93H 1H7VA 3L0OA 4BXXG 2PVEA 3CP0A 3RLFA 2IHEA 2VS1A 1OXXK 2VY3A 3FHWA 4GS3A 4NB3A 3ULJA 4DNIA 1A0IA 3CPFA 2PQAB 3JC66 5C3EH 4LFBL 1WOCA 5AI2A 4AR4A 2JA8H 4JI6L 1CKNA 1R0IA 3WWVA 4L5QA 4JOIC 1SMUA 2JQOA 2K52A 2ZTEA 5DLQE 4C3JH 1SR3A 3G48A 1OXSC 1N36Q 5GAEC 1EFWA 2PMZE 5J3BA 3NENA 1WCMG 4EX5A 3RZTA 1X9NA 4B3TQ 2BH2A 5ELOA 4PG3A 4DV3L 1QCVA 3HOWG 2R7ZG 4A3LH 2NZOA 2LCQA 2EQSA 4DR5L 1IXRA 1YJ9A 1HR0Q 3M4PA 2UU9L 4A3CH 3PUXA 1CKMA 1CADA 2PI2E 5AI3A 2XTIA 3S2HH 4DV6Q 4JBJA 2MS3A 2D62A 3KDFB 2F3IA 4K0KQ 1RL2A 1K3RA 5HY6A 5M5WH 3G4SA 1X54A 2QL0A 1YUXA 2JEAI 2PVXA 3RYGA 2UUAQ 1Q8KA 4A3KG 4AQYQ 2JA6G 1LYLA 4LUZA 3PCOB 4X65Q 3J7ZC 1YUZA 3RLNA 5M3FG 2F4VQ 4H02A 4P72A 4JBMA 2UXCL 2I0QA 3K80C 2VQEL 3MXNB 3PV0A 5BR8L 4LF4Q 2LXKA 5JJKA 1G291 5IYCG 1O7IA 5AJ3L 5GADC 4A3EH 4JI6Q 3OTOQ 4A3IH 4KHPQ 6RXNA 2KKDA 1JYBA 3MPSA 2B63G 2JK8A 5C0XI 3H3VI 1B8AA 3GD7A 4UP8A 1BKBA 4Y7NH 4DV3Q 2Y0SG 2K5VA 1UEBA 1HZAA 2QEXA 1EQQA 3I4MH 4DR5Q 2UU9Q 3D31A 1NY4A 1HNXL 1VQAA 1G51A 3BJUA 2K4KA 1U5KA 3STBD 3CMEA 3HOYG 5FJ8G 1IL2A 3K8AA 2Q2IA 2WB1G 3RLOA 4C3HH 4YY3L 4LNQA 4BBSG 3K81C 1Y1VG 1HNZL 2JEBI 3MEFA 3E0EA 4UPAA 2JA9A 3HOZH 1RB9A 1YI2A 3PF4A 1B2OA 4LF8L 4WJ4A 3A5UA 2UUBL 1L2FA 2ZJQA 2KN9A 1CUKA 1XMQL 2ATWA 1VQDA 4JYAQ 2UXDL 4BBRH 4HIMA 3S1MH 5BR8Q 4WJ3M 1AE3A 2CFMA 4DV0L 4HIDA 3S15H 1PYSB 1C9OA 1WFQA 1IROA 2QGQA 1SN8A 1RDVA 1X65A 4DR7Q 2CQOA 4QIWE 4DUYL 4GNXA 4DR4L 4MZ9A 1SFOH 5IP7H 2NZHA 1GVPA 5FLMH 4OWTB 1R0FA 4DV7L 4A3MG 4GLXA 2HHHL 2MO1A 1PHJA 3CCSA 2N8NA 4IPDA 3I4OA 3GTKH 4GLVB 1JT8A 3ER0A 4JI5L 2GVBA 1W3SA 3CAMA 1OXUA 1N32Q 4LF9L 1SLJA 3BU2A 1QZHA 4LW1A 8RXNA 3RN2A 4YWMA 4J15A 2OQ0A 1CSQA 2FXQA 1SMWA 4YY3Q 5M3MG 3CCQA 1B71A 2HT1A 2AKWB 3HOXG 3E9IA 2WAQG 2Z6KC 4AIMA 1DGSA 2I5MX 3HOUH 3OW2A 3BZCA 5IP9G 1J5EL 1WI5A 3GTQH 4LF4L 4JV5L 2VW9A 1Q81C 3NELA 4APVA 1PH6A 1ASYA 4L5SA 3H3VH 3FKIH 3RZOH 4GN3B 1QUQB 1TWAH 3I4NG 2IT1A 1A8VA 1EQRA 2PI2A 3I56A 1N36L 1M1KC 4OO1I 1EUJA 3CCRA 4GOPA 2JA7G 2RF4A 1VCXA 4C2MH 3DLLA 4OWXB 1BFYA 1RYTA 2YTVA 1I50H 1S30A 1UE5A 4UP9A 4DV7Q 4A93G 2HHHQ 2DGYA 3OYYA 5HGQA 3Q8DA 4TPUA 4AR6A 4DV6L 3UDFA 1PH4A 2K5NA 5ELNA 2R93G 4JI5Q 1PH2A 2B29A 3KYUA 2C35B 2ID0A 3JAMi 5C3EG 1HR0W 1VQ7A 4LF9Q 1Y1WG 4R1JA 2MNAA 1VQCA 3K7UC 4RMFA 1L0WA 1E22A 4HJ7A 1YEZA 3KYYA 1E24A 4PZ8A 4AQYL 5JEAJ 5C44H 3PWFA 3F2DA 1EIYB 1FHHA 2PQAA 4OO1G 4YWKA 2F4VL 1FVIA 1SMMA 1PH3A 4A3LG 2OQKA 4JV5Q 1J5EQ 2IHFA 2HQLA 1U0LA 4JI8Q 3TS0A 3AQQA 1Q1BA 1YK4A 2V3BB 1GM5A 2LXJA 1LUZA 3GTLH 3JC63 3OTOL 2K5HA 4OWWB 1D7QA 4KHPL 5M5YH 4RXNA 2E2IH 3AEVA 3W1GA 3PO2H 1ZRPA 1IZ6A 4QJFA 3HOVG 3KDFA 1FHMA 1QVFA 5IYBG 5IE8A 3KF8B 5LMNL 3UDXA 1LTLA 4GKJQ 3TRZA 3KFUA 3A0JA 1J6QA
chains in the Genus database with same CATH superfamily
3K0XA 4OX9Q 4A3GL 2LY7A 2N78A 3NK9A 4J8QA 4JI4L 3ZYYX 1SYBA 1UE6A 3S14H 3AMUA 1Y14B 5KEEA 1C48A 1GO3E 3JAMc 4IPCA 2R93L 3FPUB 3RR5A 3GTGH 1LTBD 5EKLA 3M3YH 2RDHA 3KYXA 4HTHA 1X3PA 1IBML 4A3MB 3SVMA 3I7FA 1STGA 4AI2A 5GQOA 1HTPA 2G9HD 4P71A 4X3TA 3GTPL 2EVBA 1N32L 3OWFA 1KDBA 1TWFL 3QR8A 5CBAE 3C2PA 4KY7A 2F0IA 2WB1E 3K5NA 4POFA 3W2DA 1PZXA 5CV7A 5AN9H 1BQ9A 3BZKA 1V9PA 3S2DB 1IU5A 5JEAG 1K8AC 4JI4Q 2HIXA 5JJZA 5IP7G 2XWBB 3UE1A 4FVMA 1SMYD 3CC4A 1GHKA 1WTXA 4GKKL 5FOBB 1IBLL 1J8IA 2YU9B 1AFPA 4UAIA 3PO3H 1OWCA 1IBMQ 4QQBX 2EE1A 1KHIA 1VQ4A 2JA6L 2HVYC 2ZJRA 2E2HH 5K36H 1RHPA 2F3VA 3WWNB 1AZQA 2F0EA 1Y1WB 1MSHA 1EOTA 1TQOA 1K28A 1JE5A 2KQ3A 2RCNA 4KD3A 4RKBA 1R9TH 2BA1A 5CORA 3J81L 1HNWQ 4QL5A 3HOZL 1BDOA 2EY4E 3I73A 1MIUA 1IHZA 2L55A 5C0XH 4GKKQ 1KC8C 3GTOB 1PFBA 4CDEC 1PLFA 1X56A 2K5QA 1WCMB 1IBLQ 3K7AB 3RD4A 5HGTA 3GTJL 1C7YA 5KNCA 1CI3M 1BR9A 1D1KA 1H95A 3F1ZA 1PH9A 2UXBQ 1XPUA 4A3MH 4GKJL 3OPOA 1SMXA 3F8TA 3STBC 1RIPA 3A5ZB 5EPLA 4HJ5A 1B3AA 1NMGA 2JP1A 2O5JD 2CKZB 2XJRA 2R7DA 2JYOA 1QNKA 1MJCA 3KOJA 1OTCA 2WV6D 4DGZA 4DR3L 2L4NA 2B2TC 1VQJA 4A3CG 4NP5A 5KGUA 4JOIA 3S2DH 1YNXA 1Y69U 2A68C 3UDIA 5IGDA 4R4TA 3AFQA 2FINB 2A6ED 3M9BA 3NPPA 1WTOA 4DU9A 1YV1A 4XTCS 2YU9H 3CW2C 2DSXA 4K5WA 3MA2B 4DK3C 4U673 1Y1VB 5C0XJ 2YTXA 3VPBE 1LABA 2EYFA 4DV1L 2CWAA 4A3EG 2CVRA 1Y1WH 3IU3I 2YV5A 2F0HA 4HR7B 1O7YA 4A93L 4CJ1B 1MBYA 4ILWA 4DR3Q 4HIKA 2CW0C 4A3JB 4DAYB 4JI2L 1HCZA 1LT6D 2HDLA 2Q2HA 2JA8L 1AEXA 3K6OA 2AQCA 2DJFC 3ERSX 4LFCL 2JA5B 5JJIA 1SRUA 2WKDA 4KK7A 3GTOH 2RBMA 1VQEA 1NCVA 1WCMH 3K7AH 3HOWH 3W1BA 5DM73 1JB7A 2Q2UA 5IYBH 1TWAB 5C3WA 1BQQT 5M3MB 1ONLA 3CCEA 1VQ6A 2J9UB 1P16A 2AWOA 3S1RL 3J80E 5M5WL 4V0BA 1YVCA 4DV1Q 4AYBG 3PO3G 1SAPA 2K28A 3I2ZA 4JAGA 4ZKBB 3HKSA 3PIPA 2R61A 3DEOA 4G57A 5K36G 3PGZA 1H9RA 2OWOA 3CC7A 7RXNA 4JI2Q 1KAWA 4KI0A 4U671 5EQ0A 5C44B 2ASBA 4R4IA 1XTDA 4NXML 2KVMA 2D0PA 2WFWA 4LFCQ 1VMPA 1B2JA 5LL6X 2B63H 2PZTA 5RXNA 3TZDA 4O0AA 4Y7NL 1DM0B 2HIVA 5MF6A 3I4ML 5E4XA 3ULLA 1W2BA 1K8GA 5C0XG 3PUVA 1LM0A 1RDGA 4DK6C 2EYMA 3KLWA 1Y1VH 1JB3A 2IPKD 2RDFA 1EYDA 3S2HB 3HEJA 1KTKA 2AUKA 5EINC 5CV9A 3CCJA 1B4OA 2JE6I 4IFDH 4A3FL 4QF4A 4X62L 3EQLC 1HNXQ 1NNQA 2M6PA 1Y8OB 2Z0SA 4A3JH 4A3BB 1NNXA 1S5BD 2DN8A 2RHQB 1S5CD 3CPWA 5C3XA 2JSOA 3BG3A 2JA5H 3J7AF 2KBNA 1FGUA 2QDBA 3LGJA 2UUBQ 5C4ZA 3I90A 1XMQQ 1UAPA 1Z9FA 2IW3A 2LS01 4DV0Q 3VA5A 1SE3A 3ND9A 4EGVA 1ILQA 5M3MH 1HFNA 2FMMA 3UI2A 4B3TL 1CQVA 4C56C 2SDFA 2XJTA 2GN5A 4HCSA 5FKAC 2VNUD 1QNUA 2JN4A 1NXGA 4WORA 4BY7B 3VR3A 4DNTB 3E9HA 1LT5D 1K73C 1KL9A 4X62Q 2B2YA 1PH8A 3DHQA 3TBIB 1C0AA 1BRFA 3J80c 3E3XA 1Q90A 4TVMA 1JMCA 2UUAL 1FL0A 3HKZB 1QOHA 3L0OA 2AQ1B 2KHSA 4IFDJ 2IHEA 1OXXK 1SFOB 1K3BC 2PQAB 5IGGA 1CKNA 1R0IA 1RDPD 3IFDA 4L5QA 2K52A 5C44L 3G48A 5C4JB 1EFWA 1NUCA 2EYPA 1WCMG 3RZTA 2ICEC 4B3TQ 5ELOA 4PG3A 4DV3L 1QCVA 3HOWG 2NB0A 2NZOA 5CYUA 4DR5L 2EY2A 5AI3A 3S2HH 2K03A 4RCOA 3P20A 3B0AB 3GTQB 3G4SA 2QL0A 2KOLA 2UUAQ 1HUNA 3FKIB 3PCOB 4E6IA 3J7ZC 1HXYD 3RLNA 1L0XB 2UXCL 5FO7B 3MXNB 4K2KA 5JJKA 1ZYRD 1I50B 4OELB 4CBVA 1UUPA 5IYDL 2R92B 4RHRA 1MD2D 1EY8A 6RXNA 4KHPQ 2B63G 4IUVA 5C0XI 1B8AA 2NYDA 5FO8B 3GD7A 1JCKB 4DV3Q 4ME5A 1UEBA 2MJ8A 1KNEA 4KKSA 4DR5Q 2NN6H 3CQZL 1G51A 1LV9A 1U5KA 3STBD 3CMEA 3HOYG 3K8AA 5G3LF 1XWEA 5MGNA 3K81C 1Y1VG 3CU7A 1R4PB 2JEBI 1HNZL 3E0EA 1G2SA 4ZN3B 2Q8TA 1QJOA 2K04A 3MFGA 2KN9A 3NBIA 4PMCA 4OL7A 1VQDA 1A2UA 1HPCA 2EDGA 2UXDL 2E2DC 2CFMA 4BY7L 2A68D 4QUFA 1SJED 5CR3A 4ZRZA 4K14A 1SFOH 1GVPA 5FLMH 4NDXA 4ZQ3A 2HHHL 1PHJA 4GLVB 5I2XA 1NXEA 5C4XL 2GVBA 3QQCE 1LLRD 3BU2A 3Q6SA 5IYCL 1X3QA 3J7AV 3SHLA 5M3MG 4KY5A 3CCQA 2HT1A 1W6KA 3E9IA 2WAQG 1RYQA 1TWHB 1DGSA 4JAEA 1IKMA 3D3RA 3BZCA 1J5EL 3GTQH 4JV5L 1SEBD 1F9RA 3S16B 1PH6A 4LHLA 1ASYA 1GXDC 1OO9B 2A73B 3FKIH 2J4XA 1U4LA 3DWAA 5M5XB 3SK5A 2IT1A 1STEA 1EQRA 4BBSL 3I56A 1N36L 3M4OB 3BS1A 1I50H 1S30A 2HHHQ 2F0KA 2C6AA 5HGQA 3Q8DA 1PH2A 2RFKB 4O1NA 2ID0A 1VQ7A 3MC0B 5FO9B 4AQYL 3FEWX 4CJ0B 1SNMA 3PWFA 1QB5D 4OO1G 2F4VL 2R92L 1SMMA 1EYCA 3OWEB 1SSOA 1J5EQ 4JV5Q 2NVXL 2HQLA 3EROA 3X3MA 2G5DA 5GAEc 4X3UA 1XYIA 3A55A 1GM5A 1LUZA 3JC63 2SOBA 3LWQB 1BOSA 3W1GA 3PIO3 1ZRPA 4QJFA 4CJ2C 1IL8A 3GP7A 2EY1A 5D3DA 1TWCL 1PFNA 3KF8B 5LMNL 3VYSA 1RYTA 1N33L 2K7VA 5LMUQ 3H0GH 3G6JB 2BDNA 1SROA 3KYVA 2BA0A 5H1SE 1BF4A 2VXWA 4R8NA 2L5TA 3VYUA 2JA7L 3ITPA 4KJOA 1FYCA 5DM61 1ENCA 3EIVA 2V0FA 2MO0A 4JG2A 2VUML 3GO5A 5GADc 1N34L 1KABA 3RN5A 1II3A 1E8JA 2GMGA 2ZM6L 4IOCA 1DZ1A 3BDLA 4IN3A 4AHZA 2NN6G 2KCMA 3NUCA 1TWHH 3E0JA 4MHEA 4M1UB 3NHHA 4DR7L 2NVQB 5C6AA 4HJAA 3OOCA 3S16H 2ZTDA 4C3IG 4FXKC 2I5HA 3U4VA 5M5XH 1PFUA 1T9OA 3TP5A 1IYVA 2ERJA 2H4OA 4XT1B 5LMNQ 3U50C 2HR5A 1QVGA 1OXVA 1N33Q 4RG1A 3HKZG 4JC0A 2H1EA 1P8LA 1W6JA 2YYZA 1EEID 3PF5A 5AFWA 2Q8IB 3NQTA 2E74C 3HOVL 2NVYB 1TWGL 3M4OL 1HA6A 1V1PB 4KHZA 1N34Q 3I4NB 2ZM6Q 4JI1L 4OEMB 3GQBA 3FP9A 1H9JA 3H3VM 4PZ7A 1WVLA 1MSGA 2E75C 4FXDA 4IJHA 1STBA 2FFKB 4DK1A 5MFZA 4K5VA 2R93B 3J81i 4EQPA 4B3MQ 3AB9A 1CHQD 3PUWA 1IU6A 3TMEA 3Q0AA 1PV4A 3GTML 5IY0A 3EN2A 3U4ZA 2EY6A 2NZ1D 1Q7YC 1K9MC 1KDAA 1I4HA 2E2JH 4PMWA 3TS2A 1V1OA 3FKIG 2B2VC 1PA6A 3A44A 1K8MA 1VQ9A 4N8FA 1BCPC 3GTPB 2WAQE 1X6OA 1KXLA 1LKOA 1I4XA 5NUCA 1TWFB 1YZ6A 2XWJB 3KLSA 4ODGA 1FNWA 4JI8L 3HZXA 3V96A 3MFYA 2Z1CA 3FPPA 4KV6A 2WACA 4GNXC 4OXPA 1VDZA 1TKWB 2XGTA 4JI1Q 2AHOB 2QF7A 1SYFA 2B2UC 1AW7A 1HZ9A 1YBYA 4WFN3 4Y52L 1VQMA 1K83H 5H1Sc 1TR5A 3MTSA 3NFPI 1MGSA 5DAUA 1LO5D 1FNVA 3OHXC 2NVQH 1PZKD 1A63A 3H09A 1KLUD 2O2LD 4OX9L 1U9RA 5E4WC 4OIKA 2FMCA 1M90C 1V1QA 3QWNA 4R4OA 2VZAA 2F0FA 4C3JG 4JI3L 1CA5A 4GLAC 1DXMA 1F2ZA 3FMCA 4H44C 2EIFA 2I46A 4TVAB 5IT9E 4K8IA 5IP9H 4GOPC 4C3HB 2BH8A 1Q46A 2EZVA 3PUZA 3H0GG 3PIP3 3HOZB 4A3GH 1VMCA 3HOXL 1D5XC 3V05A 3VYRA 2VL6A 4N9PA 4TRDA 1ASZA 3FVQA 1XMOL 2NN6I 1P7PA 4BBRB 4KN4C 2IX1A 3GTJB 1MHWC 1PRTD 4DV4Q 2PNRC 2R93H 3NE5B 4L63B 5LMNW 3I4NL 5EIOC 1VS0A 3WOEA 1DD2A 4G4KA 4JI3Q 2D2CC 4MTNA 1EWIA 1I5FA 1VCIA 2TMPA 2YTYA 3OIQA 3GTPH 1K0SA 3W5OA 1TWFH 4M8AA 3U9OA 1SNPA 1A62A 3PSIA 4KY6A 1DCZA 1N8RC 4X64L 2B5ID 1BUVT 4DV5Q 3H3VC 2K32A 3DEPA 1YIJA 2F0QA 1XMOQ 2AQ3B 3T4AC 3P1HA 4A3CL 1NR4A 4JBWA 1ZXTA 4HIOA 3HKZE 5GAHc 1PXUA 2XVSA 1CKOA 4ME3A 4K2LA 1VF5C 1HNWL 3PIP1 1HTLD 1RKNA 2BE5C 4A3KH 2JA6H 1TS2A 2F0SA 4AR3A 3PIOA 1TXYA 1CZGA 2M4YA 5I4DA 3KYWA 4HMJA 4H0LC 2K5WA 5ELBA 1B7YB 3HP3A 4A3EL 1LTAD 1NAPA 4A93B 3KF6A 4UDUC 4A3IL 1KDCA 3S1QH 1E1OA 4LF6L 2UXBL 1QE6A 4X64Q 3KBGA 3UDGA 1I4QA 2L0ZA 4P74A 2DUDA 1IW7D 5IT9c 1S2ZA 2JA8B 5MLC3 1CA6A 2M6OA 2ZXPA 3MVVA 2PCFB 3PO2B 1VQFA 1FJGL 3LPEB 2VQEQ 4C3HL 4JCVE 2QKIC 1D8LA 1LACA 2Z3RB 4IQZA 3GTJH 4KN7C 1ESFA 1B53A 4BWGB 2AMCB 5AJ3Q 3H9BA 1EL0A 1SE8A 2XJVA 3S24A 3S1RB 4HSPA 5M5WB 1B1ZA 4BBRL 1EY4A 3S1ML 2PYAA 4B9XA 3S15L 2L1BA 3C46A 1B50A 1L1OC 3H99A 1EZ8A 4XGHA 2WP8J 1VQKA 1ET6A 1SE2A 1YHBA 4DKAC 1R0JA 2I5LX 3T16A 4LF6Q 4LF7L 2XNAC 4FF4A 5GROA 2BCOA 2B8FA 4F87A 1PTOD 2F52A 3KJPA 4LF8Q 2HCIA 3H6MA 4JBKA 1JICA 2HCCA 3NBHB 1FJGQ 4Y7NB 4A3GG 3BDOA 1CZWA 4DAPA 3IRBA 4YWLA 3I4MB 2KUMA 3H15A 4V196 2RA4A 1Q82C 3QVDA 1YNJC 3QO2A 3HOUL 1S40A 1S5FD 4DK0A 2B8GA 1SYDA 4NW2A 2EJGC 1WD1A 1LTRD 1C09A 1Z47A 3CF5A 3RZOL 1CAAA 2E8GA 4RGOS 4HJ9A 4LHNA 5KIXA 4S3SA 3F2CA 3JC62 4RGMA 4LF7Q 1F2YA 2A6HD 1EY5A 4A3FB 4L6TB 4A93H 1H7VA 2RCFA 1EIHA 3CP0A 1SNDA 1PH5A 3FHWA 4LF4L 3TSSA 2Z8LA 2MP1A 4AR4A 3A7AB 2QCPX 4FNFA 4JI6L 2JA8H 2OTJA 1SMUA 2ZTEA 1SR3A 5GAEC 4CKCA 2PMZE 2JI2A 1I4PA 3NENA 1X9NA 2L9HA 4AHWA 3QIAA 4A3LH 3TP6A 4CDFC 4PNYA 1IXRA 2SNMA 2XTIA 2DY7A 4DV6Q 4F7XA 4JBJA 2MS3A 3KDFB 2F3IA 1RL2A 3PO2L 1K3RA 2SNSA 4YIJA 5HY6A 5M5WH 1H9SA 2JI3A 4ZUJA 1BCPD 1Q8KA 4PMBA 5LL6S 4A3KG 2JA6G 4G7HC 3C1FA 1YUZA 4QIWP 2KCCA 4JBMA 2L11A 3K80C 1HHVA 1B3QA 4LF4Q 2LXKA 4HSVA 3TZUA 3K5OA 4FF3A 1O7IA 4QIWB 5GADC 4JI6Q 3OTOQ 2K1BA 2NVTL 2KKDA 3MPSA 1ODHA 3H3VI 5KYLA 3HJYB 4Y7NH 2Y0SG 2K5VA 2QEXA 1ET9A 3I4MH 1VZHA 5A2QE 4QMGA 1HNXL 1G91A 3TN2A 1JC7A 1I6HL 3RZDB 1B2TA 2XN9C 1IL2A 2CHBD 3RUZA 4LNQA 3S1NL 1RCVD 1TY2A 2MHVA 1YI2A 2B2VA 4QB4A 5IGBA 1C8CA 3PF4A 1EU4A 2WKCA 3A5UA 2UUBL 2EYHA 2ZJQA 1PRTB 4IUNA 1XMQL 4JYAQ 4AI1A 2XRQD 4DV0L 2RVLA 1PYSB 1C9OA 1WFQA 1SN8A 1RDVA 1DJRD 4GNXA 2NZHA 1R0FA 4A3MG 4GLXA 3CCSA 2B2UA 4BY1B 5DM71 1JT8A 2MPMA 3ER0A 4HAEA 1BO0A 4LF9L 1SLJA 2IJ0A 4LW1A 3MEHA 8RXNA 1WTVA 2OQ0A 1CSQA 2QDLA 1XX8A 1SE4A 2AKWB 2B63L 3CQZB 3I91A 1F2MA 4N9TA 1LTSD 3ND8A 1EY6A 2EJFC 1Q81C 1STNA 4L5SA 4KD4A 3HOYL 1TWAH 3S17L 4O42A 1EUJA 2PW5A 3L3OC 4GOPA 1VCXA 1A3UA 1BFYA 5I9OA 3G7LA 4A93G 1UE5A 1JR0D 2DGYA 4JVZA 5I6YA 2OEOA 4RFBA 3UDFA 3K5LA 4ZCKA 1BNZA 1D5MC 2HD3A 4WRDA 2A69C 5LHY1 4LF9Q 1Y1WG 4R1JA 2MNAA 4RMFA 1E22A 5M3FB 3VR2A 3KYYA 1TT2A 4X6AL 5C44H 1EIYB 5KNDA 1FHHA 5C4XB 1FVIA 5ELDA 1WD0A 4A3LG 2OQKA 2IHFA 1MI2A 1U0LA 3JAML 3TS0A 3AQQA 3R8BA 3FDTA 1Q1BA 2CQAA 2SEBD 2K5HA 1D7QA 4KHPL 1QQTA 1GUOA 2WB1P 3RZDL 1JWUD 1PZID 1FHMA 2FJ2A 3R3OA 5IYBG 4A3DL 1A3VA 2WB1B 4BBSB 1J6QA 2KJXA 5K5PA 4BA2I 1OWBA 3ULPA 2Z4HA 2K50A 4C2M1 3D4DA 5IYDH 3WOFA 1IYJB 1WTRA 3K5MA 2X6GA 4DF7A 2CCZA 4A3BH 1X3EA 1BBUA 1PTOB 4R4CA 4CDDC 1LKMA 3VYTA 1AP0A 2DNEA 4I7AA 3I4MG 3P8BA 4BY1L 1T9QA 5EJWA 1GKHA 1E1TA 2KCNA 1RWDA 3J81E 2NVXB 1PYBA 2Y0SE 4BXXL 2ICIA 3OSOA 2A19A 2RQXA 4B8CD 2VB3X 5BN3A 4ZAIA 4B08A 4B3SQ 3DWQA 4DV2L 4X66L 3BZDB 4BY7H 1NBWA 1TWCB 2PYKA 4JI0L 4U68A 1N9WA 5GAHC 2R7ZL 1F4LA 1PFVA 1K0RA 2E5LL 1I3QL 1BVSA 1HH2P 3CXCA 1S5DD 3E6ZX 4K9FA 4IFDG 3TP8A 2LSSA 4JK1C 3I72A 2JA7B 2RDGA 5C4XH 5KYIA 3NXWA 5EPJA 4IO9A 5IOCA 2I07B 5IYCH 4A3JG 1XNRL 2VUMB 5JAVA 2A1AA 5M3FL 2JA5G 1RTNA 2KENA 1L1OA 2MQHA 1RJTA 2OT2A 3VR5A 5C4JH 5BN4A 5EBCA 1SJHD 4AH6A 1F9SA 4P75A 4XQNA 1IYUA 1VQNA 2Z6KA 2ALYB 4FXGC 4DV2Q 4X66Q 1UE1A 3NWSA 4BBSH 1QZGA 4JI0Q 3EVQA 3IFTA 4C3IL 1BCPB 2NYZD 3F2UA 4KMUC 5JPNC 1QUQA 5CV5A 4ZK9B 2E5LQ 1BQ8A 1PH7A 2KCTA 2EYOA 3M7NA 2AUSB 2DNCA 2CW0D 5FJ8L 2ERSA 3HOVB 1TWGB 3I70A 1PTOH 1U4RA 4XIGS 1XNRQ 2M2LA 2F0MA 4B9WA 2XJPA 2F0OA 2OF1A 5C44G 4L5RC 3L7ZC 2B2WC 1T5EA 2OXPA 4XYOA 3DM1A 2R92H 1KAAA 4P73A 2QW7A 5A35A 5LMUL 4A4IA 2NVXH 1VZGA 2DJGC 1AN8A 3CHBD 1DOLA 3T13A 1LKPA 2JJQA 2VB2X 3GTMB 3J81c 3PZAA 1IBKQ 1PYWD 2F0WA 1PRTF 4DR1Q 5CV4A 5T1IA 3T1HL 3GV6A 1DONA 1B13A 2Q2TA 3RNUA 2K75A 1U4MA 3CD6A 5JVG3 4GOPB 1KRSA 4HN7A 4EQ5A 1PFWA 3ZJYC 4A75A 5IYDG 4LFAQ 3HFZB 5EKIA 1XPRA 4A76A 1UWVA 4A3BG 2VUMH 2F4IA 3DWPA 3TEHB 2D0OA 3J7Z1 3FRPB 4CHTB 4AI3A 1KQSA 1Q8IA 1T9HA 1TIID 5IGCA 4AR5A 3GTKB 1D6EC 1QG7A 2R3ZA 4QGUA 1G2TA 3T1HQ 5F2DA 1YHAA 2NBFA 2EPBA 3G71A 1CKNB 4OONA 5C3EL 4LF5Q 4ZYSA 3KUPA 1MKHA 3QOJA 3CKIB 4C3JL 3VR6A 4BY7G 3S9WA 3NTHA 3T1YQ 1S24A 4B3ML 4ABNA 3D4WA 4IFDI 3B08B 3HOVH 1TWGH 4GN4B 2XRSD 3M4OH 1GHJA 3EBEA 3D6CA 2F0NA 4R8IA 2L15A 3CMAA 4RCNA 3HOXB 5JVG1 5C4XG 3H0GL 4GZYC 1NE3A 2TSSA 2O5JC 4R9WA 1VF7A 5TSSA 3D4RA 1UE7A 4LFBQ 2R6GA 1M4VA 4NKLA 4PV1C 2N3SA 5FLMG 3PIO1 4PZ6A 1VQOA 3M85A 3GTMH 1EY0A 5JVH3 1YHQA 1TY0A 4I7ZC 3V2TA 3TP7A 1I4RA 3NEMA 3HRZC 2A6EC 3QJYA 1KD1C 4OHJA 2IY5B 1YITA 4J1MA 5IGFA 2NTTA 2A69D 1EIFA 1CT1D 2F0LA 4G7ZC 4G6BA 1X3FA 2KHIA 2PQEA 2O5IC 4XXEA 2EXDA 4DPGA 3MSUA 4HJ8A 3A54A 4CKBA 2V0EA 2GVAA 3UE0A 4POGA 4DR6L 4Y52H 1PTOF 3GDEA 1M8AA 2V1CC 4DR2L 1GOZA 3OMCA 4XQQA 3P2AA 4YCUA 2R92G 1F9QA 2RSOA 1UNSA 2F3WA 3E5SA 3SE0A 2ES2A 1LTTD 1DYQA 4IPGA 4DAMA 3J80L 3S14B 4RHSA 4HMIA 1L1OB 2ENBA 5IP7L 3N52A 3KLRA 4TQUS 4LUVA 4UHVA 1C4QA 1QILA 2J7ZA 3GTKL 1KIXA 1CSPA 3ICEA 4DV4L 4A3EB 4A3IB 4IOAA 1R0GA 3O13A 1G6PA 3SXHA 2D9UA 5JVH1 3R93A 5A2QL 1I4GA 2OCEA 3NSWA 5JPMC 1NJIC 4DR6Q 4RA8A 2RDVA 5FK9C 3HOXH 1NTGA 5CC4A 1WYDA 4DUYQ 3QOLA 2F0VA 4DR2Q 4DR4Q 1O7LA 2VUMG 1TS4A 4Q0FA 5HURA 3I55A 4CDCC 1NSNS 1Q86C 3D6WA 2NVYH 1EYAA 1SYGA 3EJIA 4K0KL 4HCEA 3I4NH 4DV5L 2EOTA 1YJWA 4AYBP 1Z92B 3DMUA 4LK1C 2A8VA 3A8KE 3H91A 3T53B 3S1MB 1F2LA 3S15B 2PW7A 4AYBB 1SYEA 3PO3B 2PPTA 2PVEA 3RLFA 2VY3A 3ULJA 3P7JA 5J1ZA 1A0IA 3CPFA 1BCPF 1HUMA 3JC66 2E2HB 1WOCA 5AI2A 3WWVA 4WFN1 5DLQE 2PZWA 2KA7A 4EX5A 4IALA 5J3BA 5C4HA 3HJWB 2K05A 1GUNA 2LKVA 1GUGA 3Q22A 1JOOA 3T51B 2EQSA 4A3CH 2UU9L 2EJMA 2F0UA 2K01A 1D5ZC 3GTLL 3HS0C 2F0JA 4IURA 2C6BA 4K0KQ 3HOUB 5M5YL 2E2IL 4RGNA 5I9PA 4AI0A 2JEAI 2PVXA 1YNNC 3RZOB 4LUZA 3OIPA 4H02A 3MQKB 4HEDA 2KEEA 4IUPA 2VQEL 5GAGc 3PV0A 1CK1A 5MFPA 1FGBD 4C2MB 5BR8L 4OGQC 2WINB 3PKIA 5AJ3L 4A3EH 4ID6A 2F0TA 4A3IH 5ELCA 1JYBA 3S14L 2L0CA 4UP8A 5D3IB 1BKBA 1S5ED 1A3TA 1HZAA 1EQQA 3GTGL 1B9NA 3A7LA 2UU9Q 3D31A 3M3YL 2QEJC 2K4KA 2Q2IA 4C3HH 4YY3L 5E1FA 3MEFA 1GUSA 4UPAA 3HOZH 3BYTB 4C1NI 2AQ2B 4LF8L 4WJ4A 1JWSD 1L2FA 2C9OA 3A56A 2F0DA 1Y8PB 1DOMA 4BBRH 3S1MH 5BR8Q 4WJ3M 4HIDA 4N8X1 2KECA 3S15H 2EXZA 1O7ZA 1X65A 4A3KL 2XIWA 1EEFD 4OWTB 4DV7L 2MO1A 2N8NA 4IPDA 3I4OA 1B44D 4LMQD 4JI5L 2NTSA 2G9DA 1W3SA 2L12A 1OXUA 1N32Q 3IKJA 2NVTB 3PO3L 4WJWA 2B2WA 2HQEA 4YWMA 3ONAB 4J15A 2HDMA 3RN2A 3S1QL 2FXQA 4YY3Q 2E2HL 3HOXG 2Z6KC 4AIMA 2I5MX 3HOUH 3OW7A 1QCBD 2Z9HA 4XT3B 1FD7D 5IP9G 1I6HB 1SBBB 2VW9A 1GUTA 3S1NB 2EYJA 1ZYRC 3RZOH 3FDJA 3SK6A 4FF2A 3I4NG 1R9TL 1M1KC 4E6YA 3HOWB 4CGYB 3CCRA 2RF4A 4C2MH 4DV7Q 4I65A 4TPUA 4AR6A 4DV6L 5ELNA 1D1IA 2R93G 3RMHA 1E2WA 4JI5Q 3AU7A 3KYUA 3JAMi 3LX0A 3LWVB 1L0WA 4HJ7A 1YEZA 2M4VA 4DXGA 3F2DA 3MAQA 2PQAA 4YWKA 4A3ML 4GS7D 4QUCA 5C5MA 2K33A 4QCLA 4DAVA 3JR7A 2V3BB 2LXJA 2LFNA 2B63B 3OTOL 3AEVA 4RXNA 4EQOA 3Q24A 3PO2H 1IZ6A 4RGTA 4K8JA 3KLSX 1QVFA 5IE8A 3HOYB 3S2DL 3S17B 5KRUA 3TRZA 4GKJQ 3CCMA 1PFYA 2IWHA 3K35A 3S1RH 1JE4A 1QVCA 5CV6A 3MXNA 4A3IG 1F9PA 5E7NA 5JJLA 4QY7A 2YU9L 3URYA 2NVTH 2Z6BA 1XNQL 1XJVA 4JYAL 1DOKA 4AHYA 3PKJA 1Z6HA 1D2BA 5FLXE 1EYGA 4BS9A 1IRNA 1EZ6A 4ALPA 3CCLA 4IUQA 1Y1WL 1O80A 1I6HH 2XJSA 5CV8A 4C3HG 1BE7A 4MNOA 3A8JE 3S1NH 1GUWA 3VDYA 3D0FA 2PPBC 3HOZG 2WAQP 4JAFA 5JOBA 4A3LL 1E7ZA 1U4PA 2R7FA 1PFSA 1CQFA 1X55A 1PZJD 3LNLA 2HUGA 1TS5A 1L0YB 3W3AA 4BBRG 2MFIA 2WAQB 3L9AX 1JOKA 3GTOL 4GN5A 4NPSA 4A3DB 3IAYA 1WCML 1VQPA 3K7AL 1VQ5A 3HOWL 1EWCA 1AE2A 1XNQQ 5IYBL 2EY5A 4R4QA 2F0PA 1DVBA 4A3FH 1AH9A 4MN3A 3J7A5 4LJZC 2H12A 2K14A 5EGTA 1EQVA 2ZIXA 1R4QB 4KLKA 2Z4IA 3HOUG 3U58A 1OXTA 1EQTA 3KF6B 3OMGA 4PQXA 4DFAA 5C5LA 1S72A 2RHSB 4UP7A 4X3KA 1VQIA 3EFXD 2QA4A 2UUCL 1TS3A 3HOYH 4RKLA 3S17H 1EOVA 2ZTCA 3J81j 1HA5A 4YHHL 3QG1A 1B70B 1Q1EA 3X3NA 4KKTA 4K6DA 3G6EA 1WJJA 1BBWA 2R7ZB 3C3LA 1Y1VL 1I3QB 3NTKA 3C1EA 4ZUIA 4RAUC 1Q3LA 4C1NK 4NXMQ 3BVZA 4X6AH 2V4DA 4FDBA 1JWMD 1YNND 1ILPA 3MHBA 4XQJA 1SNOA 1JJGA 2XJQA 1FNUA 3RZ6A 1S4ZA 1ML0D 5FLXc 2O4XA 4XXBB 4IUTA 2JA8G 1STHA 4A3JL 2UUCQ 3PO2G 5K2ME 3CRLC 3RZDH 2BE5D 2PSMC 2Q8RE 1EY7A 2JA5L 1KLGD 3DUZA 4K6LA 2K5DA 4DA2A 4YHHQ 1YJNA 3TREA 4A3DH 1CTMA 1SYCA 4C3IB 1JJCB 2AWNA 1ENAA 1TWAL 1JJ2A 2M00A 3KF8A 4V190 3HKZP 4JI7L 5M3ML 4BA1I 1PMRA 3PUYA 2VQFL 1BXTA 3A8IE 5J39A 1E3PA 2PNHA 3HG9A 4FP5D 2OTLA 2E76C 3AYHB 2PO4A 2IX0A 4B3SL 2KEDA 5D14A 4FF1A 1J9OA 4MIUA 4MTKA 4DNRB 4BY1H 1PH1A 4LWCA 1HFGA 5I6WA 2X6LA 2N88A 4NXNL 5EAYA 1S3OA 1Q12A 1RODA 2CH4W 4OO1H 1JORA 1G6ZA 4BXXH 3H9CA 4XYQA 4LUOA 1A15A 3KYHC 3CQZH 3CC2A 1AZPA 2IL8A 3L2PA 3K57A 1V43A 4DXFA 2NUCA 1H9MA 4CKEA 4LAAA 4JI7Q 4FO2A 2VQFQ 4F8MA 2R7ZH 1HRJA 5ISRA 4JW0A 4EQNA 1PFMA 3CCUA 4G7OC 1I3QH 5IT9L 1I94L 2MGSA 1H9SB 4B3RL 4EVOA 5EBDA 3S2HL 4ZKCB 2WIIB 2NWGA 4A3FG 4AYBE 4L5TA 1ZEQX 4YCVA 1V1PA 4H7BA 2CWPA 1KRTA 5DEHA 1DX8A 5GAGC 1VQGA 2D5DA 4NXNQ 1IKLA 1YNJD 4A3BL 5M3FH 1XXGA 3H94A 4H13C 3AFPA 1X3GA 3HAXC 4YCWA 3VR4A 5CBEE 1HQRD 3ZG6A 3F2BA 2KHJA 5CGKA 3SK4A 2B3GA 3DXJC 1A2TA 1VQBA 1LT3D 4NMZA 4RWSC 1X32A 3LWRB 4C3IH 1NMFA 2N49A 5IWAL 5C3EB 2BOSA 1PRTC 4KHVA 5CMDA 3BVMA 1ICFB 3B6YA 3DM3A 3LWUA 1HZBA 4C3JB 1I94Q 4B3RQ 2DY8A 2UXCQ 3LWPB 2CKAA 2CKCA 3A74A 2P5ZX 5FJ8H 1HZCA 1SXTA 5COYA 5E3FA 1IBKL 3KJOA 2PZUA 4DR1L 1PDQA 1UEAB 3J80i 1MJEA 4DUZL 3M7GA 4IJLA 2A74C 3PMFA 5EKKA 3TQYA 4O2DA 3H0GB 3BDCA 1HJPA 3M4QA 4GNXB 2IX3A 1CFMA 4ZN1B 1PVOA 4FYDA 3I3CA 2APOB 4LFAL 1GJXA 2ZXOA 1TU2B 5IIFA 1SFOL 5FLML 1VQHA 3WDNA 2H5XA 3MZ5A 5DNFA 3SEBA 1EIGA 2ZJPA 1HNZQ 4UY8C 1XPOA 2JXMB 1GD7A 3M4YA 5IWAQ 3MWYW 1QYBA 3LNNA 3SK8A 5C4JL 3I4LA 2PMZP 4P2CB 4A3DG 4KKUA 2M9VA 2UXDQ 1STYA 4IPHA 1T9PA 1FR3A 1R0HA 1SNQA 2B2TA 2PMZB 5DM63 3BYYB 3T56B 3H97A 1SMYC 4DUZQ 3GTQL 1VQ8A 1TWCH 3SGIA 3TDQA 2GA4B 3K59A 1HR0L 4LF5L 3FKIL 2EYLA 1YK5A 1VQLA 2J0TD 4TSSA 4BY1G 4Z9CB 3T1YL 4OIJA 3CCVA 2K2DA 2JA7H 2QILA 2N55A 1LTID 5IGEA 3SS2A 1I50L 4X65L 1LT4D 1IW7C 2RSNA 4BXXG 1CM9A 2VS1A 4NB3A 4DNIA 4GS3A 3J7YW 4ULLA 5C3EH 4LFBL 1F77A 1ESRA 1EU3A 1ENFA 2A5HA 4JOIC 2JQOA 4C3JH 2X69A 1OXSC 1N36Q 2AUJD 2AYJA 2E2JB 2FHTA 3LWEA 2BH2A 3IL8A 4KTAA 2R7ZG 3P75A 4RH6A 4JPBW 2LCQA 4K5XA 3N6RA 1YJ9A 1HR0Q 3M4PA 3HGBA 3PUXA 2PI2E 1CKMA 1CADA 5BN5A 4JADA 2D62A 1BBXC 2ZT9C 1X54A 2XSCA 1YUXA 2Z3QB 3RYGA 3R2TA 3K58A 4ZLTF 4X3SA 1Y8NB 4AQYQ 1KNAA 1LYLA 4X65Q 5T1GA 1B9MA 1PTOC 3J7Y1 5M3FG 2F4VQ 4P72A 1TVXA 1XTCD 2I0QA 1K83B 1WTPA 1VZIA 1G291 1ZKOA 2C5CA 5IYCG 3LWOB 2CH4A 1WTWA 1STAA 4Q5VA 2JK8A 2JI1A 3BVGA 4F88A 2ZXRA 1E2VA 5I2YA 3D8GA 2B39A 1E2ZA 3U9SA 1TWHL 3WWLA 1NY4A 3NQIA 4IUUA 1VQAA 3BJUA 2MUYA 3ERQA 5FJ8G 3S16L 2WB1G 5EPKA 3RLOA 4BBSG 3R2IA 2LMCB 2A6HC 5M5XL 2CR8A 3K0YA 2JA9A 1RB9A 3GTLB 1B2OA 1A6XA 1SNCA 5M5YB 2E2IB 1CUKA 2XJUA 5KNBA 4A3GB 2ATWA 1QWYA 4HIMA 1AE3A 2RKSA 5L37A 5J22A 1IROA 3PL5A 1EFID 2QGQA 4DR7Q 2CQOA 1K8OA 4QIWE 4DUYL 5JEAH 4DR4L 2F03A 4MZ9A 5IP7H 3KK7A 3SR1A 5G3LD 3GTKH 3JAME 1H9KA 1V8QA 1T5XD 3CAMA 4TKOB 1QZHA 3NP8A 5FLXL 4UY81 1CHPD 3I8ZA 1WJVA 3NTIA 1SMWA 1LTGD 1B71A 3GTGB 3NBHA 3M3YB 2F0GA 3OW2A 1WI5A 2F1MA 1O78A 2E2JL 3NELA 3GV3A 4APVA 3H3VH 5D65A 4J6HA 3KBXA 1QUQB 2K6AA 3MXPA 4GN3B 3EA6A 3NWTA 1A8VA 1Z7TA 2PI2A 1WTQA 4OO1I 1WTHA 3QB3A 2JA7G 2BDOA 3DLLA 4OWXB 4XDXA 5ELFA 4KJNA 4L8JA 2YTVA 3MXUA 5IODA 1G8ZD 4UP9A 1RTOA 3OYYA 1HQMC 4IZ8A 3SDZA 4DN4M 1PH4A 1RD9D 2K5NA 1EWHA 2B29A 1JOQA 1HR0W 2C35B 4A3KB 2JA6B 5C3EG 3VA7A 1I6VC 1SDFA 1K83L 1RF2D 1VQCA 3K7UC 1E24A 4PZ8A 5JEAJ 4AHXA 2NVQL 1E0BA 1PH3A 2Y0SP 4JI8Q 3PQIA 3S1QB 3CRKC 1YK4A 1EY9A 3GTLH 5ELEA 4DAYA 3Q23A 4OWWB 5M5YH 2E2IH 2Y0SB 1NR2A 2B2YC 5M9OA 3HOVG 3KDFA 1ICWA 5IP9L 3MXGA 3UDXA 1LTLA 1R9TB 3KFUA 3A0JA 1JQYD 2NVYL
chains in the Genus database with same CATH topology
3K0XA 4OX9Q 2N78A 4JI4L 1UE6A 3S14H 1Y14B 1GO3E 3JAMc 4IPCA 3RR5A 3GTGH 3M3YH 3KYXA 1IBML 3I7FA 4AI2A 5GQOA 4P71A 1N32L 2WB1E 4POFA 5AN9H 1BQ9A 3BZKA 1V9PA 1IU5A 5JEAG 1K8AC 4JI4Q 2HIXA 5IP7G 3UE1A 3CC4A 4GKKL 1IBLL 3PO3H 1OWCA 1IBMQ 4QQBX 1KHIA 1VQ4A 2ZJRA 2E2HH 3WWNB 1JE5A 2RCNA 1R9TH 2BA1A 1HNWQ 4QL5A 1MIUA 4GKKQ 1KC8C 1X56A 1IBLQ 1C7YA 1H95A 3F1ZA 1PH9A 2UXBQ 1XPUA 4A3MH 4GKJL 1SMXA 3F8TA 3STBC 1RIPA 3A5ZB 4HJ5A 1NMGA 2O5JD 2CKZB 2XJRA 2R7DA 1MJCA 3KOJA 1OTCA 4DR3L 1VQJA 4A3CG 4JOIA 3S2DH 1YNXA 3UDIA 4R4TA 3AFQA 2A6ED 3M9BA 1YV1A 4XTCS 2YU9H 3CW2C 2DSXA 4DK3C 5C0XJ 2YTXA 3VPBE 4DV1L 2CWAA 4A3EG 1Y1WH 3IU3I 2YV5A 4DR3Q 4HIKA 4JI2L 4DAYB 2Q2HA 3ERSX 4LFCL 5JJIA 1SRUA 3GTOH 1VQEA 1WCMH 3K7AH 3HOWH 3W1BA 1JB7A 2Q2UA 5IYBH 3CCEA 1VQ6A 2J9UB 1P16A 2AWOA 4DV1Q 1YVCA 4AYBG 3PO3G 3I2ZA 4JAGA 3HKSA 3PIPA 5K36G 3PGZA 2OWOA 3CC7A 7RXNA 4JI2Q 1KAWA 4KI0A 4U671 2ASBA 4R4IA 1XTDA 4NXML 2D0PA 2WFWA 4LFCQ 1B2JA 2B63H 5RXNA 4O0AA 2HIVA 5MF6A 1W2BA 3ULLA 1K8GA 5C0XG 3PUVA 1LM0A 1RDGA 4DK6C 3KLWA 1Y1VH 5EINC 3CCJA 2JE6I 4X62L 1HNXQ 1NNQA 2M6PA 2Z0SA 4A3JH 2RHQB 3CPWA 2JA5H 2KBNA 1FGUA 3LGJA 2UUBQ 1XMQQ 1Z9FA 4DV0Q 5M3MH 4B3TL 2XJTA 2GN5A 2VNUD 1NXGA 3E9HA 1K73C 1KL9A 4X62Q 1PH8A 1C0AA 1BRFA 3J80c 4TVMA 1JMCA 2UUAL 1FL0A 3L0OA 4IFDJ 2IHEA 1OXXK 2PQAB 1CKNA 1R0IA 4L5QA 2K52A 3G48A 1EFWA 1WCMG 3RZTA 4B3TQ 5ELOA 4PG3A 4DV3L 1QCVA 3HOWG 2NZOA 4DR5L 5AI3A 3S2HH 3B0AB 3G4SA 2QL0A 2UUAQ 3PCOB 3J7ZC 3RLNA 2UXCL 3MXNB 5JJKA 4KHPQ 6RXNA 2B63G 5C0XI 1B8AA 2NYDA 3GD7A 4DV3Q 1UEBA 4DR5Q 1G51A 1U5KA 3STBD 3CMEA 3HOYG 3K8AA 5MGNA 3K81C 1Y1VG 1HNZL 2JEBI 3E0EA 4ZN3B 2KN9A 1VQDA 2UXDL 2CFMA 2A68D 1SFOH 1GVPA 5FLMH 2HHHL 1PHJA 4GLVB 1NXEA 2GVBA 3QQCE 3BU2A 5M3MG 3CCQA 2HT1A 3E9IA 2WAQG 1RYQA 1DGSA 4JAEA 3GTQH 3BZCA 1J5EL 4JV5L 1PH6A 4LHLA 1ASYA 3FKIH 2IT1A 1EQRA 3I56A 1N36L 1I50H 1S30A 2HHHQ 2C6AA 5HGQA 3Q8DA 1PH2A 2ID0A 1VQ7A 4AQYL 3PWFA 4OO1G 2F4VL 1SMMA 4JV5Q 1J5EQ 2HQLA 5GAEc 1GM5A 1LUZA 3JC63 3W1GA 1ZRPA 4QJFA 3KF8B 5LMNL 1RYTA 1N33L 5LMUQ 3H0GH 1SROA 3KYVA 2BA0A 5H1SE 5DM61 3EIVA 2V0FA 2MO0A 4JG2A 3GO5A 5GADc 1N34L 3RN5A 1E8JA 2GMGA 2ZM6L 4IOCA 4AHZA 2NN6G 2KCMA 1TWHH 4DR7L 4HJAA 3S16H 2ZTDA 2I5HA 3U4VA 5M5XH 1T9OA 2ERJA 5LMNQ 3U50C 2HR5A 1QVGA 1OXVA 1N33Q 4RG1A 3HKZG 4JC0A 1P8LA 2YYZA 3PF5A 4KHZA 1N34Q 2ZM6Q 4JI1L 3FP9A 4PZ7A 4IJHA 5MFZA 3J81i 4B3MQ 3PUWA 1IU6A 1PV4A 5IY0A 3EN2A 3U4ZA 1K9MC 1Q7YC 2E2JH 4PMWA 3TS2A 3FKIG 1PA6A 3A44A 1VQ9A 2WAQE 1X6OA 1KXLA 1LKOA 1YZ6A 4JI8L 4GNXC 4OXPA 4JI1Q 2XGTA 2AHOB 1HZ9A 1YBYA 1VQMA 1K83H 5H1Sc 3NFPI 2NVQH 1A63A 4OX9L 1M90C 1V1QA 4R4OA 2VZAA 4JI3L 4GLAC 2EIFA 4TVAB 5IP9H 4GOPC 2BH8A 1Q46A 3PUZA 3H0GG 4A3GH 2VL6A 1ASZA 1XMOL 2NN6I 2IX1A 4DV4Q 2R93H 5LMNW 5EIOC 1VS0A 4JI3Q 4MTNA 1EWIA 1I5FA 1VCIA 2YTYA 3GTPH 3W5OA 1TWFH 3PSIA 1A62A 1N8RC 4X64L 2B5ID 4DV5Q 1YIJA 1XMOQ 4JBWA 4HIOA 3HKZE 5GAHc 1CKOA 4ME3A 1HNWL 3PIP1 4A3KH 2JA6H 4AR3A 3PIOA 1TXYA 2M4YA 3KYWA 1B7YB 3KF6A 3S1QH 1E1OA 4LF6L 2UXBL 4X64Q 3UDGA 2L0ZA 4P74A 2DUDA 1IW7D 5IT9c 1S2ZA 5MLC3 2M6OA 1VQFA 1FJGL 3LPEB 2VQEQ 4JCVE 1D8LA 2Z3RB 3GTJH 2AMCB 5AJ3Q 1SE8A 2XJVA 3S24A 2PYAA 1L1OC 4XGHA 2WP8J 1VQKA 1YHBA 4DKAC 4LF6Q 1R0JA 2I5LX 4LF7L 5GROA 2F52A 3KJPA 4LF8Q 4JBKA 1FJGQ 3NBHB 4A3GG 3IRBA 4YWLA 3H15A 4V196 1Q82C 3QVDA 1S40A 1C09A 1Z47A 3CF5A 1CAAA 2E8GA 4HJ9A 4LHNA 3F2CA 3JC62 4LF7Q 2A6HD 4A93H 1H7VA 3CP0A 1PH5A 4LF4L 3FHWA 4AR4A 2JA8H 4JI6L 2OTJA 1SMUA 2ZTEA 1SR3A 5GAEC 2JI2A 2PMZE 3NENA 1X9NA 4AHWA 4A3LH 1IXRA 2XTIA 4DV6Q 4JBJA 2MS3A 3KDFB 2F3IA 1RL2A 1K3RA 5HY6A 5M5WH 2JI3A 1Q8KA 4A3KG 2JA6G 1YUZA 4JBMA 3K80C 4LF4Q 2LXKA 1O7IA 5GADC 4JI6Q 3OTOQ 2KKDA 3MPSA 1ODHA 3H3VI 4Y7NH 2Y0SG 2K5VA 2QEXA 3I4MH 1VZHA 1HNXL 1IL2A 4LNQA 1YI2A 3PF4A 3A5UA 2UUBL 2ZJQA 1XMQL 4JYAQ 4AI1A 4DV0L 1PYSB 1C9OA 1WFQA 1SN8A 1RDVA 4GNXA 2NZHA 1R0FA 4A3MG 4GLXA 3CCSA 5DM71 1JT8A 3ER0A 4LF9L 1SLJA 4LW1A 8RXNA 2OQ0A 1CSQA 2AKWB 1Q81C 4L5SA 1TWAH 1EUJA 4GOPA 1VCXA 1BFYA 4A93G 1UE5A 2DGYA 3UDFA 4LF9Q 1Y1WG 4R1JA 2MNAA 4RMFA 1E22A 3KYYA 5C44H 1EIYB 1FHHA 1FVIA 4A3LG 2OQKA 2IHFA 1U0LA 3TS0A 3AQQA 1Q1BA 2K5HA 1D7QA 4KHPL 1FHMA 5IYBG 1J6QA 4BA2I 1OWBA 3ULPA 2K50A 5IYDH 1IYJB 2CCZA 4A3BH 1X3EA 1BBUA 4R4CA 1LKMA 3I4MG 3P8BA 1T9QA 1GKHA 1E1TA 1RWDA 1PYBA 2Y0SE 2A19A 4B8CD 4B3SQ 4DV2L 4X66L 4BY7H 1NBWA 4JI0L 1N9WA 5GAHC 1K0RA 2E5LL 1BVSA 1HH2P 3CXCA 4K9FA 4IFDG 2LSSA 5C4XH 4IO9A 1XNRL 4A3JG 5IYCH 2A1AA 2JA5G 2KENA 1L1OA 2MQHA 5C4JH 4AH6A 4P75A 1VQNA 2Z6KA 2ALYB 4DV2Q 4X66Q 1UE1A 4BBSH 1QZGA 4JI0Q 1QUQA 2E5LQ 1BQ8A 1PH7A 2KCTA 3M7NA 2ERSA 4XIGS 1XNRQ 2XJPA 5C44G 4L5RC 3L7ZC 2R92H 4P73A 5LMUL 4A4IA 2NVXH 1VZGA 1LKPA 2JJQA 3J81c 3PZAA 1IBKQ 4DR1Q 3T1HL 1B13A 2Q2TA 3RNUA 2K75A 3CD6A 4GOPB 1KRSA 4EQ5A 3ZJYC 4A75A 5IYDG 4LFAQ 3HFZB 1XPRA 4A76A 1UWVA 4A3BG 2VUMH 3TEHB 2D0OA 3J7Z1 4AI3A 1KQSA 1T9HA 4AR5A 4QGUA 3T1HQ 1YHAA 3G71A 1CKNB 4OONA 4LF5Q 1MKHA 4BY7G 3T1YQ 1S24A 4B3ML 4IFDI 3B08B 3HOVH 1TWGH 4GN4B 3M4OH 3EBEA 2L15A 3CMAA 5JVG1 5C4XG 1NE3A 4LFBQ 1UE7A 2R6GA 1VQOA 2N3SA 5FLMG 3PIO1 4PZ6A 3M85A 3GTMH 1YHQA 3NEMA 1KD1C 2IY5B 1YITA 2A69D 1EIFA 4G6BA 1X3FA 2KHIA 2EXDA 4DPGA 3MSUA 4HJ8A 2V0EA 2GVAA 3UE0A 4POGA 4DR6L 4Y52H 3GDEA 2V1CC 4DR2L 3P2AA 4YCUA 2R92G 2ES2A 4IPGA 4DAMA 1L1OB 4TQUS 4LUVA 3ICEA 1KIXA 1CSPA 4DV4L 1G6PA 4IOAA 1R0GA 5JVH1 2OCEA 1NJIC 4DR6Q 2RDVA 3HOXH 1NTGA 1WYDA 4DUYQ 4DR2Q 4DR4Q 2VUMG 3I55A 1Q86C 2NVYH 4K0KL 3I4NH 4DV5L 1YJWA 1Z92B 2A8VA 2PPTA 2PVEA 3RLFA 2VY3A 3ULJA 1A0IA 3CPFA 3JC66 1WOCA 5AI2A 3WWVA 4WFN1 5DLQE 4EX5A 5J3BA 2EQSA 4A3CH 2UU9L 2C6BA 4K0KQ 4AI0A 2JEAI 2PVXA 4LUZA 4H02A 2VQEL 5GAGc 3PV0A 5MFPA 5BR8L 3PKIA 5AJ3L 4A3EH 4A3IH 1JYBA 4UP8A 1BKBA 1HZAA 1EQQA 2UU9Q 3D31A 2K4KA 2Q2IA 4C3HH 4YY3L 3MEFA 4UPAA 3HOZH 4LF8L 4WJ4A 1L2FA 4BBRH 3S1MH 5BR8Q 4WJ3M 4HIDA 3S15H 1X65A 4OWTB 4DV7L 2MO1A 2N8NA 4IPDA 3I4OA 4JI5L 1W3SA 1N32Q 1OXUA 3RN2A 4YWMA 4J15A 2FXQA 4YY3Q 3HOXG 2Z6KC 4AIMA 2I5MX 3HOUH 5IP9G 2VW9A 3RZOH 3I4NG 1M1KC 4E6YA 3CCRA 2RF4A 4C2MH 4DV7Q 4TPUA 4AR6A 4DV6L 5ELNA 2R93G 4JI5Q 3KYUA 3JAMi 1L0WA 4HJ7A 1YEZA 2M4VA 3F2DA 2PQAA 4YWKA 4GS7D 2V3BB 2LXJA 3OTOL 3AEVA 4RXNA 3PO2H 1IZ6A 1QVFA 5IE8A 4GKJQ 3TRZA 3CCMA 3K35A 3S1RH 1QVCA 4A3IG 5E7NA 5JJLA 4QY7A 2NVTH 1XNQL 1XJVA 4JYAL 4AHYA 3PKJA 1EYGA 1IRNA 4ALPA 3CCLA 1I6HH 2XJSA 1BE7A 4MNOA 3S1NH 3VDYA 3D0FA 3HOZG 4JAFA 1E7ZA 2R7FA 1PFSA 1X55A 3LNLA 4BBRG 2MFIA 4GN5A 4NPSA 1VQPA 1VQ5A 1AE2A 1XNQQ 4R4QA 1DVBA 4A3FH 1AH9A 3J7A5 2H12A 2K14A 2ZIXA 4KLKA 3HOUG 3U58A 1OXTA 3KF6B 1S72A 2RHSB 4UP7A 1VQIA 2QA4A 2UUCL 3HOYH 3S17H 1EOVA 2ZTCA 3J81j 4YHHL 1B70B 1Q1EA 3G6EA 1WJJA 1BBWA 4NXMQ 4X6AH 4FDBA 1JJGA 2XJQA 3RZ6A 5FLXc 4XXBB 2JA8G 2UUCQ 3PO2G 5K2ME 3RZDH 2BE5D 2PSMC 4YHHQ 1YJNA 3TREA 4A3DH 1JJCB 2AWNA 1JJ2A 4JI7L 4BA1I 3PUYA 2VQFL 1E3PA 2PNHA 2OTLA 3AYHB 2IX0A 4B3SL 4BY1H 1PH1A 4LWCA 4NXNL 5EAYA 1S3OA 1Q12A 4BXXH 4LUOA 3KYHC 3CQZH 3CC2A 3L2PA 1V43A 4JI7Q 2VQFQ 2R7ZH 3CCUA 1I3QH 1I94L 4B3RL 4A3FG 4AYBE 4L5TA 4YCVA 2CWPA 1KRTA 1DX8A 5GAGC 1VQGA 4NXNQ 5M3FH 3AFPA 1X3GA 4YCWA 3ZG6A 3F2BA 2KHJA 2B3GA 1VQBA 4C3IH 1NMFA 2N49A 5IWAL 3DM3A 3B6YA 1I94Q 1HZBA 4B3RQ 2UXCQ 2CKAA 2CKCA 3A74A 5FJ8H 1HZCA 1IBKL 3KJOA 4DR1L 3J80i 1MJEA 4DUZL 4IJLA 3TQYA 4O2DA 1HJPA 3M4QA 4GNXB 4ZN1B 1PVOA 4LFAL 1VQHA 2H5XA 2ZJPA 1HNZQ 4UY8C 1XPOA 1GD7A 5IWAQ 1QYBA 4A3DG 2UXDQ 4IPHA 1T9PA 1R0HA 4DUZQ 1VQ8A 1TWCH 3SGIA 1HR0L 4LF5L 1VQLA 1YK5A 4BY1G 3T1YL 3CCVA 2K2DA 2JA7H 3SS2A 4X65L 4BXXG 2VS1A 4NB3A 4DNIA 4GS3A 5C3EH 4LFBL 4JOIC 2JQOA 4C3JH 1OXSC 1N36Q 2AYJA 2R7ZG 2BH2A 2LCQA 1YJ9A 1HR0Q 3M4PA 3PUXA 1CKMA 1CADA 2PI2E 4JADA 2D62A 1X54A 1YUXA 2Z3QB 3RYGA 4AQYQ 1LYLA 4X65Q 3J7Y1 5M3FG 2F4VQ 4P72A 2I0QA 1VZIA 1G291 5IYCG 2JK8A 3WWLA 1NY4A 1VQAA 3BJUA 5FJ8G 2WB1G 3RLOA 4BBSG 2CR8A 2JA9A 1RB9A 1B2OA 1CUKA 2XJUA 2ATWA 4HIMA 1AE3A 1IROA 2QGQA 4DR7Q 2CQOA 4QIWE 4DUYL 4DR4L 4MZ9A 5IP7H 3GTKH 3CAMA 1QZHA 4UY81 1WJVA 1SMWA 1B71A 3OW2A 1WI5A 3NELA 4APVA 3H3VH 4GN3B 1QUQB 1A8VA 2PI2A 4OO1I 2JA7G 3DLLA 4OWXB 2YTVA 4UP9A 3OYYA 1PH4A 2K5NA 2B29A 1HR0W 2C35B 5C3EG 1VQCA 3K7UC 1E24A 4PZ8A 5JEAJ 4AHXA 1PH3A 4JI8Q 1YK4A 3GTLH 4OWWB 5M5YH 2E2IH 3HOVG 3KDFA 3UDXA 1LTLA 3KFUA 3A0JA 2JI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM A;  1N33 L;  5LMU Q;  3K0X A;  4OX9 Q;  4BA2 I;  3H0G H;  3S1R H;  1QVC A;  1SRO A;  3ULP A;  3KYV A;  2K50 A;  2BA0 A;  5H1S E;  2N78 A;  5IYD H;  4JI4 L;  1IYJ B;  4A3I G;  5E7N A;  3EIV A;  4QY7 A;  5JJL A;  2MO0 A;  4JG2 A;  1UE6 A;  2NVT H;  3GO5 A;  2CCZ A;  1XNQ L;  1X3E A;  1BBU A;  1XJV A;  3S14 H;  4A3B H;  1Y14 B;  3RN5 A;  1N34 L;  4JYA L;  4R4C A;  1GO3 E;  1E8J A;  2GMG A;  2ZM6 L;  1LKM A;  4IOC A;  3JAM c;  4IPC A;  3I4M G;  2NN6 G;  3RR5 A;  2KCM A;  1IRN A;  1EYG A;  4ALP A;  3GTG H;  1TWH H;  1T9Q A;  3M3Y H;  3CCL A;  3KYX A;  4DR7 L;  1IBM L;  1I6H H;  3I7F A;  1GKH A;  4HJA A;  1E1T A;  1RWD A;  1BE7 A;  3S16 H;  4MNO A;  5GQO A;  2ZTD A;  3S1N H;  1PYB A;  2I5H A;  2Y0S E;  4P71 A;  3D0F A;  3U4V A;  5M5X H;  3VDY A;  3HOZ G;  1T9O A;  2A19 A;  1E7Z A;  2R7F A;  1PFS A;  1N32 L;  1X55 A;  5LMN Q;  3U50 C;  2HR5 A;  1QVG A;  1OXV A;  2WB1 E;  4BBR G;  1N33 Q;  4B3S Q;  2MFI A;  4POF A;  4RG1 A;  3HKZ G;  4JC0 A;  4DV2 L;  1P8L A;  4X66 L;  4BY7 H;  1BQ9 A;  1NBW A;  3BZK A;  2YYZ A;  1V9P A;  4GN5 A;  4NPS A;  4JI0 L;  3PF5 A;  1N9W A;  1IU5 A;  5JEA G;  5GAH C;  1VQP A;  1K8A C;  2HIX A;  5IP7 G;  1VQ5 A;  4JI4 Q;  1K0R A;  2E5L L;  3UE1 A;  1AE2 A;  1BVS A;  1HH2 P;  1XNQ Q;  3CXC A;  4KHZ A;  3CC4 A;  1N34 Q;  4K9F A;  4R4Q A;  1DVB A;  2ZM6 Q;  4JI1 L;  2LSS A;  4GKK L;  4IFD G;  4A3F H;  1AH9 A;  3J7A 5;  1IBL L;  5C4X H;  3FP9 A;  4PZ7 A;  4IO9 A;  1XNR L;  4A3J G;  5IYC H;  2K14 A;  1IBM Q;  3PO3 H;  4QQB X;  1KHI A;  1VQ4 A;  4IJH A;  2ZJR A;  2E2H H;  2A1A A;  4KLK A;  3J81 i;  4B3M Q;  2JA5 G;  3PUW A;  1IU6 A;  3HOU G;  2KEN A;  1L1O A;  2MQH A;  1PV4 A;  5IY0 A;  3EN2 A;  3U58 A;  1OXT A;  3U4Z A;  5C4J H;  1Q7Y C;  3KF6 B;  1K9M C;  2E2J H;  4PMW A;  3TS2 A;  4AH6 A;  1S72 A;  3FKI G;  1PA6 A;  2RHS B;  4UP7 A;  3A44 A;  4P75 A;  1VQI A;  1VQN A;  1VQ9 A;  2QA4 A;  2Z6K A;  2ALY B;  2UUC L;  1JE5 A;  4X66 Q;  2RCN A;  2WAQ E;  4DV2 Q;  1EOV A;  1UE1 A;  1X6O A;  2BA1 A;  2ZTC A;  1LKO A;  3J81 j;  1R9T H;  1QZG A;  4JI0 Q;  4BBS H;  1HNW Q;  1YZ6 A;  4QL5 A;  4YHH L;  1QUQ A;  2OTJ A;  2E5L Q;  1BQ8 A;  1B70 B;  4JI8 L;  1PH7 A;  2KCT A;  1MIU A;  1Q1E A;  3M7N A;  3G6E A;  1WJJ A;  4GNX C;  4OXP A;  1KC8 C;  4GKK Q;  4JI1 Q;  2XGT A;  1X56 A;  1BBW A;  2AHO B;  1IBL Q;  4IFD J;  1HZ9 A;  1YBY A;  4XIG S;  1C7Y A;  1VQM A;  1XNR Q;  1K83 H;  4NXM Q;  5C44 G;  4L5R C;  3L7Z C;  3F1Z A;  1PH9 A;  2UXB Q;  4X6A H;  1H95 A;  1XPU A;  4FDB A;  4A3M H;  2NVQ H;  4GKJ L;  1SMX A;  2R92 H;  1A63 A;  4P73 A;  3F8T A;  5LMU L;  4A4I A;  1JJG A;  4OX9 L;  3RZ6 A;  2NVX H;  3STB C;  1M90 C;  5FLX c;  1V1Q A;  1RIP A;  4R4O A;  2VZA A;  3A5Z B;  2JA8 G;  4HJ5 A;  1NMG A;  1LKP A;  2JJQ A;  4GLA C;  4JI3 L;  2CKZ B;  2UUC Q;  3PO2 G;  2R7D A;  3PZA A;  3J81 c;  1IBK Q;  4DR1 Q;  2EIF A;  3RZD H;  1MJC A;  3KOJ A;  3T1H L;  4TVA B;  4YHH Q;  1B13 A;  1OTC A;  2Q2T A;  4DR3 L;  3RNU A;  1VQJ A;  2K75 A;  1YJN A;  5IP9 H;  4A3C G;  4GOP C;  3TRE A;  4JOI A;  4A3D H;  3CD6 A;  2BH8 A;  3S2D H;  1YNX A;  1Q46 A;  3UDI A;  4GOP B;  3PUZ A;  1KRS A;  1JJC B;  2AWN A;  3H0G G;  4R4T A;  3AFQ A;  4EQ5 A;  1JJ2 A;  4A3G H;  4JI7 L;  3M9B A;  3ZJY C;  4A75 A;  4BA1 I;  5IYD G;  4LFA Q;  3PUY A;  2VQF L;  2VL6 A;  1ASZ A;  3HFZ B;  1XMO L;  1XPR A;  1E3P A;  1YV1 A;  2NN6 I;  2PNH A;  4XTC S;  1UWV A;  4A76 A;  2YU9 H;  2IX1 A;  3CW2 C;  2VUM H;  4A3B G;  2DSX A;  2OTL A;  3AYH B;  4DK3 C;  2IX0 A;  5C0X J;  3TEH B;  4DV4 Q;  4B3S L;  2D0O A;  2YTX A;  2R93 H;  5LMN W;  4DV1 L;  1VS0 A;  2CWA A;  1PH1 A;  4BY1 H;  4LWC A;  4A3E G;  1KQS A;  1T9H A;  1Y1W H;  2YV5 A;  4JI3 Q;  4AR5 A;  3HOY H;  4NXN L;  5EAY A;  4QGU A;  4MTN A;  1S3O A;  1Q12 A;  1EWI A;  1I5F A;  1VCI A;  3T1H Q;  1YHA A;  2YTY A;  4BXX H;  4LUO A;  4DR3 Q;  3GTP H;  3G71 A;  4HIK A;  1CKN B;  4JI2 L;  4DAY B;  3KYH C;  3CQZ H;  4OON A;  1TWF H;  3W5O A;  3CC2 A;  3L2P A;  4LF5 Q;  1V43 A;  2Q2H A;  3PSI A;  1A62 A;  1MKH A;  3ERS X;  4LFC L;  4BY7 G;  5JJI A;  4JI7 Q;  1SRU A;  1N8R C;  3T1Y Q;  1S24 A;  4X64 L;  4DV5 Q;  4B3M L;  3GTO H;  1VQE A;  1YIJ A;  2VQF Q;  4IFD I;  1WCM H;  3K7A H;  2R7Z H;  1XMO Q;  3HOV H;  3HOW H;  3W1B A;  1TWG H;  4GN4 B;  3CCU A;  3M4O H;  1JB7 A;  1I3Q H;  3EBE A;  4JBW A;  5IYB H;  1I94 L;  2Q2U A;  2L15 A;  4B3R L;  4HIO A;  3HKZ E;  3CMA A;  3CCE A;  1VQ6 A;  4A3F G;  1P16 A;  2AWO A;  1CKO A;  4L5T A;  4AYB E;  5C4X G;  1NE3 A;  4ME3 A;  1YVC A;  4YCV A;  4AYB G;  4DV1 Q;  3PO3 G;  1HNW L;  2CWP A;  1KRT A;  3I2Z A;  1UE7 A;  4LFB Q;  1KXL A;  2R6G A;  3HKS A;  1DX8 A;  3PIP A;  2N3S A;  5GAG C;  1VQG A;  4PZ6 A;  5FLM G;  4A3K H;  1VQO A;  3M85 A;  4NXN Q;  2JA6 H;  5K36 G;  3PGZ A;  4AR3 A;  3PIO A;  1TXY A;  2OWO A;  5M3F H;  2M4Y A;  3AFP A;  1X3G A;  3KYW A;  3GTM H;  3CC7 A;  4YCW A;  7RXN A;  4JI2 Q;  1KAW A;  1YHQ A;  3F2B A;  2KHJ A;  4KI0 A;  2B3G A;  1VQB A;  1B7Y B;  3NEM A;  1KD1 C;  2ASB A;  2IY5 B;  1YIT A;  4R4I A;  1XTD A;  4NXM L;  3KF6 A;  3S1Q H;  2D0P A;  1EIF A;  2WFW A;  1E1O A;  4LF6 L;  4LFC Q;  2UXB L;  1B2J A;  4X64 Q;  2B63 H;  5RXN A;  1X3F A;  1NMF A;  2N49 A;  4O0A A;  4C3I H;  4P74 A;  5IWA L;  3UDG A;  2DUD A;  2HIV A;  2KHI A;  5IT9 c;  1S2Z A;  2EXD A;  1W2B A;  3DM3 A;  3B6Y A;  3ULL A;  4DPG A;  1HZB A;  1K8G A;  5C0X G;  1I94 Q;  4B3R Q;  4HJ8 A;  1VQF A;  3PUV A;  2UXC Q;  1FJG L;  1LM0 A;  2VQE Q;  3A74 A;  5FJ8 H;  1RDG A;  1HZC A;  1D8L A;  2GVA A;  4JCV E;  3UE0 A;  4DK6 C;  4POG A;  3KJO A;  3GTJ H;  3KLW A;  4DR1 L;  1IBK L;  4DR6 L;  1Y1V H;  3GDE A;  1PH5 A;  2AMC B;  3J80 i;  5AJ3 Q;  1MJE A;  4Y52 H;  1SE8 A;  4DUZ L;  2V1C C;  4IJL A;  4DR2 L;  3TQY A;  4O2D A;  4YCU A;  3S24 A;  3CCJ A;  2R92 G;  2JE6 I;  1HJP A;  2ES2 A;  3M4Q A;  4X62 L;  2PYA A;  4GNX B;  1PVO A;  1L1O C;  1HNX Q;  4IPG A;  4DAM A;  4LFA L;  1NNQ A;  2Z0S A;  4A3J H;  2WP8 J;  1L1O B;  1VQK A;  1YHB A;  4DKA C;  4LF6 Q;  1R0J A;  1VQH A;  2I5L X;  2RHQ B;  2H5X A;  4LUV A;  4TQU S;  5GRO A;  4LF7 L;  3CPW A;  2ZJP A;  1HNZ Q;  3ICE A;  4UY8 C;  1XPO A;  1KIX A;  1CSP A;  1GD7 A;  5IWA Q;  2JA5 H;  4DV4 L;  1QYB A;  2F52 A;  3KJP A;  2KBN A;  1FGU A;  4LF8 Q;  4A3D G;  1G6P A;  3LGJ A;  1R0G A;  2UUB Q;  4IOA A;  4JBK A;  1XMQ Q;  1FJG Q;  1Z9F A;  3NBH B;  2UXD Q;  4IPH A;  1T9P A;  4A3G G;  1R0H A;  4DV0 Q;  2OCE A;  4YWL A;  3IRB A;  5M3M H;  1NJI C;  3H15 A;  4DR6 Q;  2RDV A;  3HOX H;  1Q82 C;  1NTG A;  3QVD A;  4B3T L;  1WYD A;  4DUZ Q;  4DUY Q;  1VQ8 A;  2GN5 A;  4DR2 Q;  4DR4 Q;  1S40 A;  1TWC H;  3SGI A;  2VNU D;  2VUM G;  3I55 A;  1HR0 L;  1C09 A;  3S17 H;  4LF5 L;  1Z47 A;  3CF5 A;  1Q86 C;  2NVY H;  3E9H A;  1CAA A;  1YK5 A;  1K73 C;  1VQL A;  2E8G A;  4HJ9 A;  1KL9 A;  4X62 Q;  4K0K L;  1PH8 A;  4BY1 G;  3I4N H;  3T1Y L;  1BRF A;  3J80 c;  3F2C A;  4DV5 L;  3CCV A;  1YJW A;  1JMC A;  1C0A A;  2K2D A;  2UUA L;  2JA7 H;  3JC6 2;  1FL0 A;  2A8V A;  3SS2 A;  4X65 L;  4LF7 Q;  4A93 H;  1H7V A;  3L0O A;  4BXX G;  2PVE A;  3CP0 A;  3RLF A;  2IHE A;  2VS1 A;  1OXX K;  2VY3 A;  3FHW A;  4GS3 A;  4NB3 A;  3ULJ A;  4DNI A;  1A0I A;  3CPF A;  2PQA B;  3JC6 6;  5C3E H;  4LFB L;  1WOC A;  5AI2 A;  4AR4 A;  2JA8 H;  4JI6 L;  1CKN A;  1R0I A;  3WWV A;  4L5Q A;  4JOI C;  1SMU A;  2JQO A;  2K52 A;  2ZTE A;  5DLQ E;  4C3J H;  1SR3 A;  3G48 A;  1OXS C;  1N36 Q;  5GAE C;  1EFW A;  2PMZ E;  5J3B A;  3NEN A;  1WCM G;  4EX5 A;  3RZT A;  1X9N A;  4B3T Q;  2BH2 A;  5ELO A;  4PG3 A;  4DV3 L;  1QCV A;  3HOW G;  2R7Z G;  4A3L H;  2NZO A;  2LCQ A;  2EQS A;  4DR5 L;  1IXR A;  1YJ9 A;  1HR0 Q;  3M4P A;  2UU9 L;  4A3C H;  3PUX A;  1CKM A;  1CAD A;  2PI2 E;  5AI3 A;  2XTI A;  3S2H H;  4DV6 Q;  4JBJ A;  2MS3 A;  2D62 A;  3KDF B;  2F3I A;  4K0K Q;  1RL2 A;  1K3R A;  5HY6 A;  5M5W H;  3G4S A;  1X54 A;  2QL0 A;  1YUX A;  2JEA I;  2PVX A;  3RYG A;  2UUA Q;  1Q8K A;  4A3K G;  4AQY Q;  2JA6 G;  1LYL A;  4LUZ A;  3PCO B;  4X65 Q;  3J7Z C;  1YUZ A;  3RLN A;  5M3F G;  2F4V Q;  4H02 A;  4P72 A;  4JBM A;  2UXC L;  2I0Q A;  3K80 C;  2VQE L;  3MXN B;  3PV0 A;  5BR8 L;  4LF4 Q;  2LXK A;  5JJK A;  1G29 1;  5IYC G;  1O7I A;  5AJ3 L;  5GAD C;  4A3E H;  4JI6 Q;  3OTO Q;  4A3I H;  4KHP Q;  6RXN A;  2KKD A;  1JYB A;  3MPS A;  2B63 G;  2JK8 A;  5C0X I;  3H3V I;  1B8A A;  3GD7 A;  4UP8 A;  1BKB A;  4Y7N H;  4DV3 Q;  2Y0S G;  2K5V A;  1UEB A;  1HZA A;  2QEX A;  1EQQ A;  3I4M H;  4DR5 Q;  2UU9 Q;  3D31 A;  1NY4 A;  1HNX L;  1VQA A;  1G51 A;  3BJU A;  2K4K A;  1U5K A;  3STB D;  3CME A;  3HOY G;  5FJ8 G;  1IL2 A;  3K8A A;  2Q2I A;  2WB1 G;  3RLO A;  4C3H H;  4YY3 L;  4LNQ A;  4BBS G;  3K81 C;  1Y1V G;  1HNZ L;  2JEB I;  3MEF A;  3E0E A;  4UPA A;  2JA9 A;  3HOZ H;  1RB9 A;  1YI2 A;  3PF4 A;  1B2O A;  4LF8 L;  4WJ4 A;  3A5U A;  2UUB L;  1L2F A;  2ZJQ A;  2KN9 A;  1CUK A;  1XMQ L;  2ATW A;  1VQD A;  4JYA Q;  2UXD L;  4BBR H;  4HIM A;  3S1M H;  5BR8 Q;  4WJ3 M;  1AE3 A;  2CFM A;  4DV0 L;  4HID A;  3S15 H;  1PYS B;  1C9O A;  1WFQ A;  1IRO A;  2QGQ A;  1SN8 A;  1RDV A;  1X65 A;  4DR7 Q;  2CQO A;  4QIW E;  4DUY L;  4GNX A;  4DR4 L;  4MZ9 A;  1SFO H;  5IP7 H;  2NZH A;  1GVP A;  5FLM H;  4OWT B;  1R0F A;  4DV7 L;  4A3M G;  4GLX A;  2HHH L;  2MO1 A;  1PHJ A;  3CCS A;  2N8N A;  4IPD A;  3I4O A;  3GTK H;  4GLV B;  1JT8 A;  3ER0 A;  4JI5 L;  2GVB A;  1W3S A;  3CAM A;  1OXU A;  1N32 Q;  4LF9 L;  1SLJ A;  3BU2 A;  1QZH A;  4LW1 A;  8RXN A;  3RN2 A;  4YWM A;  4J15 A;  2OQ0 A;  1CSQ A;  2FXQ A;  1SMW A;  4YY3 Q;  5M3M G;  3CCQ A;  1B71 A;  2HT1 A;  2AKW B;  3HOX G;  3E9I A;  2WAQ G;  2Z6K C;  4AIM A;  1DGS A;  2I5M X;  3HOU H;  3OW2 A;  3BZC A;  5IP9 G;  1J5E L;  1WI5 A;  3GTQ H;  4LF4 L;  4JV5 L;  2VW9 A;  1Q81 C;  3NEL A;  4APV A;  1PH6 A;  1ASY A;  4L5S A;  3H3V H;  3FKI H;  3RZO H;  4GN3 B;  1QUQ B;  1TWA H;  3I4N G;  2IT1 A;  1A8V A;  1EQR A;  2PI2 A;  3I56 A;  1N36 L;  1M1K C;  4OO1 I;  1EUJ A;  3CCR A;  4GOP A;  2JA7 G;  2RF4 A;  1VCX A;  4C2M H;  3DLL A;  4OWX B;  1BFY A;  1RYT A;  2YTV A;  1I50 H;  1S30 A;  1UE5 A;  4UP9 A;  4DV7 Q;  4A93 G;  2HHH Q;  2DGY A;  3OYY A;  5HGQ A;  3Q8D A;  4TPU A;  4AR6 A;  4DV6 L;  3UDF A;  1PH4 A;  2K5N A;  5ELN A;  2R93 G;  4JI5 Q;  1PH2 A;  2B29 A;  3KYU A;  2C35 B;  2ID0 A;  3JAM i;  5C3E G;  1HR0 W;  1VQ7 A;  4LF9 Q;  1Y1W G;  4R1J A;  2MNA A;  1VQC A;  3K7U C;  4RMF A;  1L0W A;  1E22 A;  4HJ7 A;  1YEZ A;  3KYY A;  1E24 A;  4PZ8 A;  4AQY L;  5JEA J;  5C44 H;  3PWF A;  3F2D A;  1EIY B;  1FHH A;  2PQA A;  4OO1 G;  4YWK A;  2F4V L;  1FVI A;  1SMM A;  1PH3 A;  4A3L G;  2OQK A;  4JV5 Q;  1J5E Q;  2IHF A;  2HQL A;  1U0L A;  4JI8 Q;  3TS0 A;  3AQQ A;  1Q1B A;  1YK4 A;  2V3B B;  1GM5 A;  2LXJ A;  1LUZ A;  3GTL H;  3JC6 3;  3OTO L;  2K5H A;  4OWW B;  1D7Q A;  4KHP L;  5M5Y H;  4RXN A;  2E2I H;  3AEV A;  3W1G A;  3PO2 H;  1ZRP A;  1IZ6 A;  4QJF A;  3HOV G;  3KDF A;  1FHM A;  1QVF A;  5IYB G;  5IE8 A;  3KF8 B;  5LMN L;  3UDX A;  1LTL A;  4GKJ Q;  3TRZ A;  3KFU A;  3A0J A;  1J6Q A; 
#chains in the Genus database with same CATH topology
 3K0X A;  4OX9 Q;  4A3G L;  2LY7 A;  2N78 A;  3NK9 A;  4J8Q A;  4JI4 L;  3ZYY X;  1SYB A;  1UE6 A;  3S14 H;  3AMU A;  1Y14 B;  5KEE A;  1C48 A;  1GO3 E;  3JAM c;  4IPC A;  2R93 L;  3FPU B;  3RR5 A;  3GTG H;  1LTB D;  5EKL A;  3M3Y H;  2RDH A;  3KYX A;  4HTH A;  1X3P A;  1IBM L;  4A3M B;  3SVM A;  3I7F A;  1STG A;  4AI2 A;  5GQO A;  1HTP A;  2G9H D;  4P71 A;  4X3T A;  3GTP L;  2EVB A;  1N32 L;  3OWF A;  1KDB A;  1TWF L;  3QR8 A;  5CBA E;  3C2P A;  4KY7 A;  2F0I A;  2WB1 E;  3K5N A;  4POF A;  3W2D A;  1PZX A;  5CV7 A;  5AN9 H;  1BQ9 A;  3BZK A;  1V9P A;  3S2D B;  1IU5 A;  5JEA G;  1K8A C;  4JI4 Q;  2HIX A;  5JJZ A;  5IP7 G;  2XWB B;  3UE1 A;  4FVM A;  1SMY D;  3CC4 A;  1GHK A;  1WTX A;  4GKK L;  5FOB B;  1IBL L;  1J8I A;  2YU9 B;  1AFP A;  4UAI A;  3PO3 H;  1OWC A;  1IBM Q;  4QQB X;  2EE1 A;  1KHI A;  1VQ4 A;  2JA6 L;  2HVY C;  2ZJR A;  2E2H H;  5K36 H;  1RHP A;  2F3V A;  3WWN B;  1AZQ A;  2F0E A;  1Y1W B;  1MSH A;  1EOT A;  1TQO A;  1K28 A;  1JE5 A;  2KQ3 A;  2RCN A;  4KD3 A;  4RKB A;  1R9T H;  2BA1 A;  5COR A;  3J81 L;  1HNW Q;  4QL5 A;  3HOZ L;  1BDO A;  2EY4 E;  3I73 A;  1MIU A;  1IHZ A;  2L55 A;  5C0X H;  4GKK Q;  1KC8 C;  3GTO B;  1PFB A;  4CDE C;  1PLF A;  1X56 A;  2K5Q A;  1WCM B;  1IBL Q;  3K7A B;  3RD4 A;  5HGT A;  3GTJ L;  1C7Y A;  5KNC A;  1CI3 M;  1BR9 A;  1D1K A;  1H95 A;  3F1Z A;  1PH9 A;  2UXB Q;  1XPU A;  4A3M H;  4GKJ L;  3OPO A;  1SMX A;  3F8T A;  3STB C;  1RIP A;  3A5Z B;  5EPL A;  4HJ5 A;  1B3A A;  1NMG A;  2JP1 A;  2O5J D;  2CKZ B;  2XJR A;  2R7D A;  2JYO A;  1QNK A;  1MJC A;  3KOJ A;  1OTC A;  2WV6 D;  4DGZ A;  4DR3 L;  2L4N A;  2B2T C;  1VQJ A;  4A3C G;  4NP5 A;  5KGU A;  4JOI A;  3S2D H;  1YNX A;  1Y69 U;  2A68 C;  3UDI A;  5IGD A;  4R4T A;  3AFQ A;  2FIN B;  2A6E D;  3M9B A;  3NPP A;  1WTO A;  4DU9 A;  1YV1 A;  4XTC S;  2YU9 H;  3CW2 C;  2DSX A;  4K5W A;  3MA2 B;  4DK3 C;  4U67 3;  1Y1V B;  5C0X J;  2YTX A;  3VPB E;  1LAB A;  2EYF A;  4DV1 L;  2CWA A;  4A3E G;  2CVR A;  1Y1W H;  3IU3 I;  2YV5 A;  2F0H A;  4HR7 B;  1O7Y A;  4A93 L;  4CJ1 B;  1MBY A;  4ILW A;  4DR3 Q;  4HIK A;  2CW0 C;  4A3J B;  4DAY B;  4JI2 L;  1HCZ A;  1LT6 D;  2HDL A;  2Q2H A;  2JA8 L;  1AEX A;  3K6O A;  2AQC A;  2DJF C;  3ERS X;  4LFC L;  2JA5 B;  5JJI A;  1SRU A;  2WKD A;  4KK7 A;  3GTO H;  2RBM A;  1VQE A;  1NCV A;  1WCM H;  3K7A H;  3HOW H;  3W1B A;  5DM7 3;  1JB7 A;  2Q2U A;  5IYB H;  1TWA B;  5C3W A;  1BQQ T;  5M3M B;  1ONL A;  3CCE A;  1VQ6 A;  2J9U B;  1P16 A;  2AWO A;  3S1R L;  3J80 E;  5M5W L;  4V0B A;  1YVC A;  4DV1 Q;  4AYB G;  3PO3 G;  1SAP A;  2K28 A;  3I2Z A;  4JAG A;  4ZKB B;  3HKS A;  3PIP A;  2R61 A;  3DEO A;  4G57 A;  5K36 G;  3PGZ A;  1H9R A;  2OWO A;  3CC7 A;  7RXN A;  4JI2 Q;  1KAW A;  4KI0 A;  4U67 1;  5EQ0 A;  5C44 B;  2ASB A;  4R4I A;  1XTD A;  4NXM L;  2KVM A;  2D0P A;  2WFW A;  4LFC Q;  1VMP A;  1B2J A;  5LL6 X;  2B63 H;  2PZT A;  5RXN A;  3TZD A;  4O0A A;  4Y7N L;  1DM0 B;  2HIV A;  5MF6 A;  3I4M L;  5E4X A;  3ULL A;  1W2B A;  1K8G A;  5C0X G;  3PUV A;  1LM0 A;  1RDG A;  4DK6 C;  2EYM A;  3KLW A;  1Y1V H;  1JB3 A;  2IPK D;  2RDF A;  1EYD A;  3S2H B;  3HEJ A;  1KTK A;  2AUK A;  5EIN C;  5CV9 A;  3CCJ A;  1B4O A;  2JE6 I;  4IFD H;  4A3F L;  4QF4 A;  4X62 L;  3EQL C;  1HNX Q;  1NNQ A;  2M6P A;  1Y8O B;  2Z0S A;  4A3J H;  4A3B B;  1NNX A;  1S5B D;  2DN8 A;  2RHQ B;  1S5C D;  3CPW A;  5C3X A;  2JSO A;  3BG3 A;  2JA5 H;  3J7A F;  2KBN A;  1FGU A;  2QDB A;  3LGJ A;  2UUB Q;  5C4Z A;  3I90 A;  1XMQ Q;  1UAP A;  1Z9F A;  2IW3 A;  2LS0 1;  4DV0 Q;  3VA5 A;  1SE3 A;  3ND9 A;  4EGV A;  1ILQ A;  5M3M H;  1HFN A;  2FMM A;  3UI2 A;  4B3T L;  1CQV A;  4C56 C;  2SDF A;  2XJT A;  2GN5 A;  4HCS A;  5FKA C;  2VNU D;  1QNU A;  2JN4 A;  1NXG A;  4WOR A;  4BY7 B;  3VR3 A;  4DNT B;  3E9H A;  1LT5 D;  1K73 C;  1KL9 A;  4X62 Q;  2B2Y A;  1PH8 A;  3DHQ A;  3TBI B;  1C0A A;  1BRF A;  3J80 c;  3E3X A;  1Q90 A;  4TVM A;  1JMC A;  2UUA L;  1FL0 A;  3HKZ B;  1QOH A;  3L0O A;  2AQ1 B;  2KHS A;  4IFD J;  2IHE A;  1OXX K;  1SFO B;  1K3B C;  2PQA B;  5IGG A;  1CKN A;  1R0I A;  1RDP D;  3IFD A;  4L5Q A;  2K52 A;  5C44 L;  3G48 A;  5C4J B;  1EFW A;  1NUC A;  2EYP A;  1WCM G;  3RZT A;  2ICE C;  4B3T Q;  5ELO A;  4PG3 A;  4DV3 L;  1QCV A;  3HOW G;  2NB0 A;  2NZO A;  5CYU A;  4DR5 L;  2EY2 A;  5AI3 A;  3S2H H;  2K03 A;  4RCO A;  3P20 A;  3B0A B;  3GTQ B;  3G4S A;  2QL0 A;  2KOL A;  2UUA Q;  1HUN A;  3FKI B;  3PCO B;  4E6I A;  3J7Z C;  1HXY D;  3RLN A;  1L0X B;  2UXC L;  5FO7 B;  3MXN B;  4K2K A;  5JJK A;  1ZYR D;  1I50 B;  4OEL B;  4CBV A;  1UUP A;  5IYD L;  2R92 B;  4RHR A;  1MD2 D;  1EY8 A;  6RXN A;  4KHP Q;  2B63 G;  4IUV A;  5C0X I;  1B8A A;  2NYD A;  5FO8 B;  3GD7 A;  1JCK B;  4DV3 Q;  4ME5 A;  1UEB A;  2MJ8 A;  1KNE A;  4KKS A;  4DR5 Q;  2NN6 H;  3CQZ L;  1G51 A;  1LV9 A;  1U5K A;  3STB D;  3CME A;  3HOY G;  3K8A A;  5G3L F;  1XWE A;  5MGN A;  3K81 C;  1Y1V G;  3CU7 A;  1R4P B;  2JEB I;  1HNZ L;  3E0E A;  1G2S A;  4ZN3 B;  2Q8T A;  1QJO A;  2K04 A;  3MFG A;  2KN9 A;  3NBI A;  4PMC A;  4OL7 A;  1VQD A;  1A2U A;  1HPC A;  2EDG A;  2UXD L;  2E2D C;  2CFM A;  4BY7 L;  2A68 D;  4QUF A;  1SJE D;  5CR3 A;  4ZRZ A;  4K14 A;  1SFO H;  1GVP A;  5FLM H;  4NDX A;  4ZQ3 A;  2HHH L;  1PHJ A;  4GLV B;  5I2X A;  1NXE A;  5C4X L;  2GVB A;  3QQC E;  1LLR D;  3BU2 A;  3Q6S A;  5IYC L;  1X3Q A;  3J7A V;  3SHL A;  5M3M G;  4KY5 A;  3CCQ A;  2HT1 A;  1W6K A;  3E9I A;  2WAQ G;  1RYQ A;  1TWH B;  1DGS A;  4JAE A;  1IKM A;  3D3R A;  3BZC A;  1J5E L;  3GTQ H;  4JV5 L;  1SEB D;  1F9R A;  3S16 B;  1PH6 A;  4LHL A;  1ASY A;  1GXD C;  1OO9 B;  2A73 B;  3FKI H;  2J4X A;  1U4L A;  3DWA A;  5M5X B;  3SK5 A;  2IT1 A;  1STE A;  1EQR A;  4BBS L;  3I56 A;  1N36 L;  3M4O B;  3BS1 A;  1I50 H;  1S30 A;  2HHH Q;  2F0K A;  2C6A A;  5HGQ A;  3Q8D A;  1PH2 A;  2RFK B;  4O1N A;  2ID0 A;  1VQ7 A;  3MC0 B;  5FO9 B;  4AQY L;  3FEW X;  4CJ0 B;  1SNM A;  3PWF A;  1QB5 D;  4OO1 G;  2F4V L;  2R92 L;  1SMM A;  1EYC A;  3OWE B;  1SSO A;  1J5E Q;  4JV5 Q;  2NVX L;  2HQL A;  3ERO A;  3X3M A;  2G5D A;  5GAE c;  4X3U A;  1XYI A;  3A55 A;  1GM5 A;  1LUZ A;  3JC6 3;  2SOB A;  3LWQ B;  1BOS A;  3W1G A;  3PIO 3;  1ZRP A;  4QJF A;  4CJ2 C;  1IL8 A;  3GP7 A;  2EY1 A;  5D3D A;  1TWC L;  1PFN A;  3KF8 B;  5LMN L;  3VYS A;  1RYT A;  1N33 L;  2K7V A;  5LMU Q;  3H0G H;  3G6J B;  2BDN A;  1SRO A;  3KYV A;  2BA0 A;  5H1S E;  1BF4 A;  2VXW A;  4R8N A;  2L5T A;  3VYU A;  2JA7 L;  3ITP A;  4KJO A;  1FYC A;  5DM6 1;  1ENC A;  3EIV A;  2V0F A;  2MO0 A;  4JG2 A;  2VUM L;  3GO5 A;  5GAD c;  1N34 L;  1KAB A;  3RN5 A;  1II3 A;  1E8J A;  2GMG A;  2ZM6 L;  4IOC A;  1DZ1 A;  3BDL A;  4IN3 A;  4AHZ A;  2NN6 G;  2KCM A;  3NUC A;  1TWH H;  3E0J A;  4MHE A;  4M1U B;  3NHH A;  4DR7 L;  2NVQ B;  5C6A A;  4HJA A;  3OOC A;  3S16 H;  2ZTD A;  4C3I G;  4FXK C;  2I5H A;  3U4V A;  5M5X H;  1PFU A;  1T9O A;  3TP5 A;  1IYV A;  2ERJ A;  2H4O A;  4XT1 B;  5LMN Q;  3U50 C;  2HR5 A;  1QVG A;  1OXV A;  1N33 Q;  4RG1 A;  3HKZ G;  4JC0 A;  2H1E A;  1P8L A;  1W6J A;  2YYZ A;  1EEI D;  3PF5 A;  5AFW A;  2Q8I B;  3NQT A;  2E74 C;  3HOV L;  2NVY B;  1TWG L;  3M4O L;  1HA6 A;  1V1P B;  4KHZ A;  1N34 Q;  3I4N B;  2ZM6 Q;  4JI1 L;  4OEM B;  3GQB A;  3FP9 A;  1H9J A;  3H3V M;  4PZ7 A;  1WVL A;  1MSG A;  2E75 C;  4FXD A;  4IJH A;  1STB A;  2FFK B;  4DK1 A;  5MFZ A;  4K5V A;  2R93 B;  3J81 i;  4EQP A;  4B3M Q;  3AB9 A;  1CHQ D;  3PUW A;  1IU6 A;  3TME A;  3Q0A A;  1PV4 A;  3GTM L;  5IY0 A;  3EN2 A;  3U4Z A;  2EY6 A;  2NZ1 D;  1Q7Y C;  1K9M C;  1KDA A;  1I4H A;  2E2J H;  4PMW A;  3TS2 A;  1V1O A;  3FKI G;  2B2V C;  1PA6 A;  3A44 A;  1K8M A;  1VQ9 A;  4N8F A;  1BCP C;  3GTP B;  2WAQ E;  1X6O A;  1KXL A;  1LKO A;  1I4X A;  5NUC A;  1TWF B;  1YZ6 A;  2XWJ B;  3KLS A;  4ODG A;  1FNW A;  4JI8 L;  3HZX A;  3V96 A;  3MFY A;  2Z1C A;  3FPP A;  4KV6 A;  2WAC A;  4GNX C;  4OXP A;  1VDZ A;  1TKW B;  2XGT A;  4JI1 Q;  2AHO B;  2QF7 A;  1SYF A;  2B2U C;  1AW7 A;  1HZ9 A;  1YBY A;  4WFN 3;  4Y52 L;  1VQM A;  1K83 H;  5H1S c;  1TR5 A;  3MTS A;  3NFP I;  1MGS A;  5DAU A;  1LO5 D;  1FNV A;  3OHX C;  2NVQ H;  1PZK D;  1A63 A;  3H09 A;  1KLU D;  2O2L D;  4OX9 L;  1U9R A;  5E4W C;  4OIK A;  2FMC A;  1M90 C;  1V1Q A;  3QWN A;  4R4O A;  2VZA A;  2F0F A;  4C3J G;  4JI3 L;  1CA5 A;  4GLA C;  1DXM A;  1F2Z A;  3FMC A;  4H44 C;  2EIF A;  2I46 A;  4TVA B;  5IT9 E;  4K8I A;  5IP9 H;  4GOP C;  4C3H B;  2BH8 A;  1Q46 A;  2EZV A;  3PUZ A;  3H0G G;  3PIP 3;  3HOZ B;  4A3G H;  1VMC A;  3HOX L;  1D5X C;  3V05 A;  3VYR A;  2VL6 A;  4N9P A;  4TRD A;  1ASZ A;  3FVQ A;  1XMO L;  2NN6 I;  1P7P A;  4BBR B;  4KN4 C;  2IX1 A;  3GTJ B;  1MHW C;  1PRT D;  4DV4 Q;  2PNR C;  2R93 H;  3NE5 B;  4L63 B;  5LMN W;  3I4N L;  5EIO C;  1VS0 A;  3WOE A;  1DD2 A;  4G4K A;  4JI3 Q;  2D2C C;  4MTN A;  1EWI A;  1I5F A;  1VCI A;  2TMP A;  2YTY A;  3OIQ A;  3GTP H;  1K0S A;  3W5O A;  1TWF H;  4M8A A;  3U9O A;  1SNP A;  1A62 A;  3PSI A;  4KY6 A;  1DCZ A;  1N8R C;  4X64 L;  2B5I D;  1BUV T;  4DV5 Q;  3H3V C;  2K32 A;  3DEP A;  1YIJ A;  2F0Q A;  1XMO Q;  2AQ3 B;  3T4A C;  3P1H A;  4A3C L;  1NR4 A;  4JBW A;  1ZXT A;  4HIO A;  3HKZ E;  5GAH c;  1PXU A;  2XVS A;  1CKO A;  4ME3 A;  4K2L A;  1VF5 C;  1HNW L;  3PIP 1;  1HTL D;  1RKN A;  2BE5 C;  4A3K H;  2JA6 H;  1TS2 A;  2F0S A;  4AR3 A;  3PIO A;  1TXY A;  1CZG A;  2M4Y A;  5I4D A;  3KYW A;  4HMJ A;  4H0L C;  2K5W A;  5ELB A;  1B7Y B;  3HP3 A;  4A3E L;  1LTA D;  1NAP A;  4A93 B;  3KF6 A;  4UDU C;  4A3I L;  1KDC A;  3S1Q H;  1E1O A;  4LF6 L;  2UXB L;  1QE6 A;  4X64 Q;  3KBG A;  3UDG A;  1I4Q A;  2L0Z A;  4P74 A;  2DUD A;  1IW7 D;  5IT9 c;  1S2Z A;  2JA8 B;  5MLC 3;  1CA6 A;  2M6O A;  2ZXP A;  3MVV A;  2PCF B;  3PO2 B;  1VQF A;  1FJG L;  3LPE B;  2VQE Q;  4C3H L;  4JCV E;  2QKI C;  1D8L A;  1LAC A;  2Z3R B;  4IQZ A;  3GTJ H;  4KN7 C;  1ESF A;  1B53 A;  4BWG B;  2AMC B;  5AJ3 Q;  3H9B A;  1EL0 A;  1SE8 A;  2XJV A;  3S24 A;  3S1R B;  4HSP A;  5M5W B;  1B1Z A;  4BBR L;  1EY4 A;  3S1M L;  2PYA A;  4B9X A;  3S15 L;  2L1B A;  3C46 A;  1B50 A;  1L1O C;  3H99 A;  1EZ8 A;  4XGH A;  2WP8 J;  1VQK A;  1ET6 A;  1SE2 A;  1YHB A;  4DKA C;  1R0J A;  2I5L X;  3T16 A;  4LF6 Q;  4LF7 L;  2XNA C;  4FF4 A;  5GRO A;  2BCO A;  2B8F A;  4F87 A;  1PTO D;  2F52 A;  3KJP A;  4LF8 Q;  2HCI A;  3H6M A;  4JBK A;  1JIC A;  2HCC A;  3NBH B;  1FJG Q;  4Y7N B;  4A3G G;  3BDO A;  1CZW A;  4DAP A;  3IRB A;  4YWL A;  3I4M B;  2KUM A;  3H15 A;  4V19 6;  2RA4 A;  1Q82 C;  3QVD A;  1YNJ C;  3QO2 A;  3HOU L;  1S40 A;  1S5F D;  4DK0 A;  2B8G A;  1SYD A;  4NW2 A;  2EJG C;  1WD1 A;  1LTR D;  1C09 A;  1Z47 A;  3CF5 A;  3RZO L;  1CAA A;  2E8G A;  4RGO S;  4HJ9 A;  4LHN A;  5KIX A;  4S3S A;  3F2C A;  3JC6 2;  4RGM A;  4LF7 Q;  1F2Y A;  2A6H D;  1EY5 A;  4A3F B;  4L6T B;  4A93 H;  1H7V A;  2RCF A;  1EIH A;  3CP0 A;  1SND A;  1PH5 A;  3FHW A;  4LF4 L;  3TSS A;  2Z8L A;  2MP1 A;  4AR4 A;  3A7A B;  2QCP X;  4FNF A;  4JI6 L;  2JA8 H;  2OTJ A;  1SMU A;  2ZTE A;  1SR3 A;  5GAE C;  4CKC A;  2PMZ E;  2JI2 A;  1I4P A;  3NEN A;  1X9N A;  2L9H A;  4AHW A;  3QIA A;  4A3L H;  3TP6 A;  4CDF C;  4PNY A;  1IXR A;  2SNM A;  2XTI A;  2DY7 A;  4DV6 Q;  4F7X A;  4JBJ A;  2MS3 A;  3KDF B;  2F3I A;  1RL2 A;  3PO2 L;  1K3R A;  2SNS A;  4YIJ A;  5HY6 A;  5M5W H;  1H9S A;  2JI3 A;  4ZUJ A;  1BCP D;  1Q8K A;  4PMB A;  5LL6 S;  4A3K G;  2JA6 G;  4G7H C;  3C1F A;  1YUZ A;  4QIW P;  2KCC A;  4JBM A;  2L11 A;  3K80 C;  1HHV A;  1B3Q A;  4LF4 Q;  2LXK A;  4HSV A;  3TZU A;  3K5O A;  4FF3 A;  1O7I A;  4QIW B;  5GAD C;  4JI6 Q;  3OTO Q;  2K1B A;  2NVT L;  2KKD A;  3MPS A;  1ODH A;  3H3V I;  5KYL A;  3HJY B;  4Y7N H;  2Y0S G;  2K5V A;  2QEX A;  1ET9 A;  3I4M H;  1VZH A;  5A2Q E;  4QMG A;  1HNX L;  1G91 A;  3TN2 A;  1JC7 A;  1I6H L;  3RZD B;  1B2T A;  2XN9 C;  1IL2 A;  2CHB D;  3RUZ A;  4LNQ A;  3S1N L;  1RCV D;  1TY2 A;  2MHV A;  1YI2 A;  2B2V A;  4QB4 A;  5IGB A;  1C8C A;  3PF4 A;  1EU4 A;  2WKC A;  3A5U A;  2UUB L;  2EYH A;  2ZJQ A;  1PRT B;  4IUN A;  1XMQ L;  4JYA Q;  4AI1 A;  2XRQ D;  4DV0 L;  2RVL A;  1PYS B;  1C9O A;  1WFQ A;  1SN8 A;  1RDV A;  1DJR D;  4GNX A;  2NZH A;  1R0F A;  4A3M G;  4GLX A;  3CCS A;  2B2U A;  4BY1 B;  5DM7 1;  1JT8 A;  2MPM A;  3ER0 A;  4HAE A;  1BO0 A;  4LF9 L;  1SLJ A;  2IJ0 A;  4LW1 A;  3MEH A;  8RXN A;  1WTV A;  2OQ0 A;  1CSQ A;  2QDL A;  1XX8 A;  1SE4 A;  2AKW B;  2B63 L;  3CQZ B;  3I91 A;  1F2M A;  4N9T A;  1LTS D;  3ND8 A;  1EY6 A;  2EJF C;  1Q81 C;  1STN A;  4L5S A;  4KD4 A;  3HOY L;  1TWA H;  3S17 L;  4O42 A;  1EUJ A;  2PW5 A;  3L3O C;  4GOP A;  1VCX A;  1A3U A;  1BFY A;  5I9O A;  3G7L A;  4A93 G;  1UE5 A;  1JR0 D;  2DGY A;  4JVZ A;  5I6Y A;  2OEO A;  4RFB A;  3UDF A;  3K5L A;  4ZCK A;  1BNZ A;  1D5M C;  2HD3 A;  4WRD A;  2A69 C;  5LHY 1;  4LF9 Q;  1Y1W G;  4R1J A;  2MNA A;  4RMF A;  1E22 A;  5M3F B;  3VR2 A;  3KYY A;  1TT2 A;  4X6A L;  5C44 H;  1EIY B;  5KND A;  1FHH A;  5C4X B;  1FVI A;  5ELD A;  1WD0 A;  4A3L G;  2OQK A;  2IHF A;  1MI2 A;  1U0L A;  3JAM L;  3TS0 A;  3AQQ A;  3R8B A;  3FDT A;  1Q1B A;  2CQA A;  2SEB D;  2K5H A;  1D7Q A;  4KHP L;  1QQT A;  1GUO A;  2WB1 P;  3RZD L;  1JWU D;  1PZI D;  1FHM A;  2FJ2 A;  3R3O A;  5IYB G;  4A3D L;  1A3V A;  2WB1 B;  4BBS B;  1J6Q A;  2KJX A;  5K5P A;  4BA2 I;  1OWB A;  3ULP A;  2Z4H A;  2K50 A;  4C2M 1;  3D4D A;  5IYD H;  3WOF A;  1IYJ B;  1WTR A;  3K5M A;  2X6G A;  4DF7 A;  2CCZ A;  4A3B H;  1X3E A;  1BBU A;  1PTO B;  4R4C A;  4CDD C;  1LKM A;  3VYT A;  1AP0 A;  2DNE A;  4I7A A;  3I4M G;  3P8B A;  4BY1 L;  1T9Q A;  5EJW A;  1GKH A;  1E1T A;  2KCN A;  1RWD A;  3J81 E;  2NVX B;  1PYB A;  2Y0S E;  4BXX L;  2ICI A;  3OSO A;  2A19 A;  2RQX A;  4B8C D;  2VB3 X;  5BN3 A;  4ZAI A;  4B08 A;  4B3S Q;  3DWQ A;  4DV2 L;  4X66 L;  3BZD B;  4BY7 H;  1NBW A;  1TWC B;  2PYK A;  4JI0 L;  4U68 A;  1N9W A;  5GAH C;  2R7Z L;  1F4L A;  1PFV A;  1K0R A;  2E5L L;  1I3Q L;  1BVS A;  1HH2 P;  3CXC A;  1S5D D;  3E6Z X;  4K9F A;  4IFD G;  3TP8 A;  2LSS A;  4JK1 C;  3I72 A;  2JA7 B;  2RDG A;  5C4X H;  5KYI A;  3NXW A;  5EPJ A;  4IO9 A;  5IOC A;  2I07 B;  5IYC H;  4A3J G;  1XNR L;  2VUM B;  5JAV A;  2A1A A;  5M3F L;  2JA5 G;  1RTN A;  2KEN A;  1L1O A;  2MQH A;  1RJT A;  2OT2 A;  3VR5 A;  5C4J H;  5BN4 A;  5EBC A;  1SJH D;  4AH6 A;  1F9S A;  4P75 A;  4XQN A;  1IYU A;  1VQN A;  2Z6K A;  2ALY B;  4FXG C;  4DV2 Q;  4X66 Q;  1UE1 A;  3NWS A;  4BBS H;  1QZG A;  4JI0 Q;  3EVQ A;  3IFT A;  4C3I L;  1BCP B;  2NYZ D;  3F2U A;  4KMU C;  5JPN C;  1QUQ A;  5CV5 A;  4ZK9 B;  2E5L Q;  1BQ8 A;  1PH7 A;  2KCT A;  2EYO A;  3M7N A;  2AUS B;  2DNC A;  2CW0 D;  5FJ8 L;  2ERS A;  3HOV B;  1TWG B;  3I70 A;  1PTO H;  1U4R A;  4XIG S;  1XNR Q;  2M2L A;  2F0M A;  4B9W A;  2XJP A;  2F0O A;  2OF1 A;  5C44 G;  4L5R C;  3L7Z C;  2B2W C;  1T5E A;  2OXP A;  4XYO A;  3DM1 A;  2R92 H;  1KAA A;  4P73 A;  2QW7 A;  5A35 A;  5LMU L;  4A4I A;  2NVX H;  1VZG A;  2DJG C;  1AN8 A;  3CHB D;  1DOL A;  3T13 A;  1LKP A;  2JJQ A;  2VB2 X;  3GTM B;  3J81 c;  3PZA A;  1IBK Q;  1PYW D;  2F0W A;  1PRT F;  4DR1 Q;  5CV4 A;  5T1I A;  3T1H L;  3GV6 A;  1DON A;  1B13 A;  2Q2T A;  3RNU A;  2K75 A;  1U4M A;  3CD6 A;  5JVG 3;  4GOP B;  1KRS A;  4HN7 A;  4EQ5 A;  1PFW A;  3ZJY C;  4A75 A;  5IYD G;  4LFA Q;  3HFZ B;  5EKI A;  1XPR A;  4A76 A;  1UWV A;  4A3B G;  2VUM H;  2F4I A;  3DWP A;  3TEH B;  2D0O A;  3J7Z 1;  3FRP B;  4CHT B;  4AI3 A;  1KQS A;  1Q8I A;  1T9H A;  1TII D;  5IGC A;  4AR5 A;  3GTK B;  1D6E C;  1QG7 A;  2R3Z A;  4QGU A;  1G2T A;  3T1H Q;  5F2D A;  1YHA A;  2NBF A;  2EPB A;  3G71 A;  1CKN B;  4OON A;  5C3E L;  4LF5 Q;  4ZYS A;  3KUP A;  1MKH A;  3QOJ A;  3CKI B;  4C3J L;  3VR6 A;  4BY7 G;  3S9W A;  3NTH A;  3T1Y Q;  1S24 A;  4B3M L;  4ABN A;  3D4W A;  4IFD I;  3B08 B;  3HOV H;  1TWG H;  4GN4 B;  2XRS D;  3M4O H;  1GHJ A;  3EBE A;  3D6C A;  2F0N A;  4R8I A;  2L15 A;  3CMA A;  4RCN A;  3HOX B;  5JVG 1;  5C4X G;  3H0G L;  4GZY C;  1NE3 A;  2TSS A;  2O5J C;  4R9W A;  1VF7 A;  5TSS A;  3D4R A;  1UE7 A;  4LFB Q;  2R6G A;  1M4V A;  4NKL A;  4PV1 C;  2N3S A;  5FLM G;  3PIO 1;  4PZ6 A;  1VQO A;  3M85 A;  3GTM H;  1EY0 A;  5JVH 3;  1YHQ A;  1TY0 A;  4I7Z C;  3V2T A;  3TP7 A;  1I4R A;  3NEM A;  3HRZ C;  2A6E C;  3QJY A;  1KD1 C;  4OHJ A;  2IY5 B;  1YIT A;  4J1M A;  5IGF A;  2NTT A;  2A69 D;  1EIF A;  1CT1 D;  2F0L A;  4G7Z C;  4G6B A;  1X3F A;  2KHI A;  2PQE A;  2O5I C;  4XXE A;  2EXD A;  4DPG A;  3MSU A;  4HJ8 A;  3A54 A;  4CKB A;  2V0E A;  2GVA A;  3UE0 A;  4POG A;  4DR6 L;  4Y52 H;  1PTO F;  3GDE A;  1M8A A;  2V1C C;  4DR2 L;  1GOZ A;  3OMC A;  4XQQ A;  3P2A A;  4YCU A;  2R92 G;  1F9Q A;  2RSO A;  1UNS A;  2F3W A;  3E5S A;  3SE0 A;  2ES2 A;  1LTT D;  1DYQ A;  4IPG A;  4DAM A;  3J80 L;  3S14 B;  4RHS A;  4HMI A;  1L1O B;  2ENB A;  5IP7 L;  3N52 A;  3KLR A;  4TQU S;  4LUV A;  4UHV A;  1C4Q A;  1QIL A;  2J7Z A;  3GTK L;  1KIX A;  1CSP A;  3ICE A;  4DV4 L;  4A3E B;  4A3I B;  4IOA A;  1R0G A;  3O13 A;  1G6P A;  3SXH A;  2D9U A;  5JVH 1;  3R93 A;  5A2Q L;  1I4G A;  2OCE A;  3NSW A;  5JPM C;  1NJI C;  4DR6 Q;  4RA8 A;  2RDV A;  5FK9 C;  3HOX H;  1NTG A;  5CC4 A;  1WYD A;  4DUY Q;  3QOL A;  2F0V A;  4DR2 Q;  4DR4 Q;  1O7L A;  2VUM G;  1TS4 A;  4Q0F A;  5HUR A;  3I55 A;  4CDC C;  1NSN S;  1Q86 C;  3D6W A;  2NVY H;  1EYA A;  1SYG A;  3EJI A;  4K0K L;  4HCE A;  3I4N H;  4DV5 L;  2EOT A;  1YJW A;  4AYB P;  1Z92 B;  3DMU A;  4LK1 C;  2A8V A;  3A8K E;  3H91 A;  3T53 B;  3S1M B;  1F2L A;  3S15 B;  2PW7 A;  4AYB B;  1SYE A;  3PO3 B;  2PPT A;  2PVE A;  3RLF A;  2VY3 A;  3ULJ A;  3P7J A;  5J1Z A;  1A0I A;  3CPF A;  1BCP F;  1HUM A;  3JC6 6;  2E2H B;  1WOC A;  5AI2 A;  3WWV A;  4WFN 1;  5DLQ E;  2PZW A;  2KA7 A;  4EX5 A;  4IAL A;  5J3B A;  5C4H A;  3HJW B;  2K05 A;  1GUN A;  2LKV A;  1GUG A;  3Q22 A;  1JOO A;  3T51 B;  2EQS A;  4A3C H;  2UU9 L;  2EJM A;  2F0U A;  2K01 A;  1D5Z C;  3GTL L;  3HS0 C;  2F0J A;  4IUR A;  2C6B A;  4K0K Q;  3HOU B;  5M5Y L;  2E2I L;  4RGN A;  5I9P A;  4AI0 A;  2JEA I;  2PVX A;  1YNN C;  3RZO B;  4LUZ A;  3OIP A;  4H02 A;  3MQK B;  4HED A;  2KEE A;  4IUP A;  2VQE L;  5GAG c;  3PV0 A;  1CK1 A;  5MFP A;  1FGB D;  4C2M B;  5BR8 L;  4OGQ C;  2WIN B;  3PKI A;  5AJ3 L;  4A3E H;  4ID6 A;  2F0T A;  4A3I H;  5ELC A;  1JYB A;  3S14 L;  2L0C A;  4UP8 A;  5D3I B;  1BKB A;  1S5E D;  1A3T A;  1HZA A;  1EQQ A;  3GTG L;  1B9N A;  3A7L A;  2UU9 Q;  3D31 A;  3M3Y L;  2QEJ C;  2K4K A;  2Q2I A;  4C3H H;  4YY3 L;  5E1F A;  3MEF A;  1GUS A;  4UPA A;  3HOZ H;  3BYT B;  4C1N I;  2AQ2 B;  4LF8 L;  4WJ4 A;  1JWS D;  1L2F A;  2C9O A;  3A56 A;  2F0D A;  1Y8P B;  1DOM A;  4BBR H;  3S1M H;  5BR8 Q;  4WJ3 M;  4HID A;  4N8X 1;  2KEC A;  3S15 H;  2EXZ A;  1O7Z A;  1X65 A;  4A3K L;  2XIW A;  1EEF D;  4OWT B;  4DV7 L;  2MO1 A;  2N8N A;  4IPD A;  3I4O A;  1B44 D;  4LMQ D;  4JI5 L;  2NTS A;  2G9D A;  1W3S A;  2L12 A;  1OXU A;  1N32 Q;  3IKJ A;  2NVT B;  3PO3 L;  4WJW A;  2B2W A;  2HQE A;  4YWM A;  3ONA B;  4J15 A;  2HDM A;  3RN2 A;  3S1Q L;  2FXQ A;  4YY3 Q;  2E2H L;  3HOX G;  2Z6K C;  4AIM A;  2I5M X;  3HOU H;  3OW7 A;  1QCB D;  2Z9H A;  4XT3 B;  1FD7 D;  5IP9 G;  1I6H B;  1SBB B;  2VW9 A;  1GUT A;  3S1N B;  2EYJ A;  1ZYR C;  3RZO H;  3FDJ A;  3SK6 A;  4FF2 A;  3I4N G;  1R9T L;  1M1K C;  4E6Y A;  3HOW B;  4CGY B;  3CCR A;  2RF4 A;  4C2M H;  4DV7 Q;  4I65 A;  4TPU A;  4AR6 A;  4DV6 L;  5ELN A;  1D1I A;  2R93 G;  3RMH A;  1E2W A;  4JI5 Q;  3AU7 A;  3KYU A;  3JAM i;  3LX0 A;  3LWV B;  1L0W A;  4HJ7 A;  1YEZ A;  2M4V A;  4DXG A;  3F2D A;  3MAQ A;  2PQA A;  4YWK A;  4A3M L;  4GS7 D;  4QUC A;  5C5M A;  2K33 A;  4QCL A;  4DAV A;  3JR7 A;  2V3B B;  2LXJ A;  2LFN A;  2B63 B;  3OTO L;  3AEV A;  4RXN A;  4EQO A;  3Q24 A;  3PO2 H;  1IZ6 A;  4RGT A;  4K8J A;  3KLS X;  1QVF A;  5IE8 A;  3HOY B;  3S2D L;  3S17 B;  5KRU A;  3TRZ A;  4GKJ Q;  3CCM A;  1PFY A;  2IWH A;  3K35 A;  3S1R H;  1JE4 A;  1QVC A;  5CV6 A;  3MXN A;  4A3I G;  1F9P A;  5E7N A;  5JJL A;  4QY7 A;  2YU9 L;  3URY A;  2NVT H;  2Z6B A;  1XNQ L;  1XJV A;  4JYA L;  1DOK A;  4AHY A;  3PKJ A;  1Z6H A;  1D2B A;  5FLX E;  1EYG A;  4BS9 A;  1IRN A;  1EZ6 A;  4ALP A;  3CCL A;  4IUQ A;  1Y1W L;  1O80 A;  1I6H H;  2XJS A;  5CV8 A;  4C3H G;  1BE7 A;  4MNO A;  3A8J E;  3S1N H;  1GUW A;  3VDY A;  3D0F A;  2PPB C;  3HOZ G;  2WAQ P;  4JAF A;  5JOB A;  4A3L L;  1E7Z A;  1U4P A;  2R7F A;  1PFS A;  1CQF A;  1X55 A;  1PZJ D;  3LNL A;  2HUG A;  1TS5 A;  1L0Y B;  3W3A A;  4BBR G;  2MFI A;  2WAQ B;  3L9A X;  1JOK A;  3GTO L;  4GN5 A;  4NPS A;  4A3D B;  3IAY A;  1WCM L;  1VQP A;  3K7A L;  1VQ5 A;  3HOW L;  1EWC A;  1AE2 A;  1XNQ Q;  5IYB L;  2EY5 A;  4R4Q A;  2F0P A;  1DVB A;  4A3F H;  1AH9 A;  4MN3 A;  3J7A 5;  4LJZ C;  2H12 A;  2K14 A;  5EGT A;  1EQV A;  2ZIX A;  1R4Q B;  4KLK A;  2Z4I A;  3HOU G;  3U58 A;  1OXT A;  1EQT A;  3KF6 B;  3OMG A;  4PQX A;  4DFA A;  5C5L A;  1S72 A;  2RHS B;  4UP7 A;  4X3K A;  1VQI A;  3EFX D;  2QA4 A;  2UUC L;  1TS3 A;  3HOY H;  4RKL A;  3S17 H;  1EOV A;  2ZTC A;  3J81 j;  1HA5 A;  4YHH L;  3QG1 A;  1B70 B;  1Q1E A;  3X3N A;  4KKT A;  4K6D A;  3G6E A;  1WJJ A;  1BBW A;  2R7Z B;  3C3L A;  1Y1V L;  1I3Q B;  3NTK A;  3C1E A;  4ZUI A;  4RAU C;  1Q3L A;  4C1N K;  4NXM Q;  3BVZ A;  4X6A H;  2V4D A;  4FDB A;  1JWM D;  1YNN D;  1ILP A;  3MHB A;  4XQJ A;  1SNO A;  1JJG A;  2XJQ A;  1FNU A;  3RZ6 A;  1S4Z A;  1ML0 D;  5FLX c;  2O4X A;  4XXB B;  4IUT A;  2JA8 G;  1STH A;  4A3J L;  2UUC Q;  3PO2 G;  5K2M E;  3CRL C;  3RZD H;  2BE5 D;  2PSM C;  2Q8R E;  1EY7 A;  2JA5 L;  1KLG D;  3DUZ A;  4K6L A;  2K5D A;  4DA2 A;  4YHH Q;  1YJN A;  3TRE A;  4A3D H;  1CTM A;  1SYC A;  4C3I B;  1JJC B;  2AWN A;  1ENA A;  1TWA L;  1JJ2 A;  2M00 A;  3KF8 A;  4V19 0;  3HKZ P;  4JI7 L;  5M3M L;  4BA1 I;  1PMR A;  3PUY A;  2VQF L;  1BXT A;  3A8I E;  5J39 A;  1E3P A;  2PNH A;  3HG9 A;  4FP5 D;  2OTL A;  2E76 C;  3AYH B;  2PO4 A;  2IX0 A;  4B3S L;  2KED A;  5D14 A;  4FF1 A;  1J9O A;  4MIU A;  4MTK A;  4DNR B;  4BY1 H;  1PH1 A;  4LWC A;  1HFG A;  5I6W A;  2X6L A;  2N88 A;  4NXN L;  5EAY A;  1S3O A;  1Q12 A;  1ROD A;  2CH4 W;  4OO1 H;  1JOR A;  1G6Z A;  4BXX H;  3H9C A;  4XYQ A;  4LUO A;  1A15 A;  3KYH C;  3CQZ H;  3CC2 A;  1AZP A;  2IL8 A;  3L2P A;  3K57 A;  1V43 A;  4DXF A;  2NUC A;  1H9M A;  4CKE A;  4LAA A;  4JI7 Q;  4FO2 A;  2VQF Q;  4F8M A;  2R7Z H;  1HRJ A;  5ISR A;  4JW0 A;  4EQN A;  1PFM A;  3CCU A;  4G7O C;  1I3Q H;  5IT9 L;  1I94 L;  2MGS A;  1H9S B;  4B3R L;  4EVO A;  5EBD A;  3S2H L;  4ZKC B;  2WII B;  2NWG A;  4A3F G;  4AYB E;  4L5T A;  1ZEQ X;  4YCV A;  1V1P A;  4H7B A;  2CWP A;  1KRT A;  5DEH A;  1DX8 A;  5GAG C;  1VQG A;  2D5D A;  4NXN Q;  1IKL A;  1YNJ D;  4A3B L;  5M3F H;  1XXG A;  3H94 A;  4H13 C;  3AFP A;  1X3G A;  3HAX C;  4YCW A;  3VR4 A;  5CBE E;  1HQR D;  3ZG6 A;  3F2B A;  2KHJ A;  5CGK A;  3SK4 A;  2B3G A;  3DXJ C;  1A2T A;  1VQB A;  1LT3 D;  4NMZ A;  4RWS C;  1X32 A;  3LWR B;  4C3I H;  1NMF A;  2N49 A;  5IWA L;  5C3E B;  2BOS A;  1PRT C;  4KHV A;  5CMD A;  3BVM A;  1ICF B;  3B6Y A;  3DM3 A;  3LWU A;  1HZB A;  4C3J B;  1I94 Q;  4B3R Q;  2DY8 A;  2UXC Q;  3LWP B;  2CKA A;  2CKC A;  3A74 A;  2P5Z X;  5FJ8 H;  1HZC A;  1SXT A;  5COY A;  5E3F A;  1IBK L;  3KJO A;  2PZU A;  4DR1 L;  1PDQ A;  1UEA B;  3J80 i;  1MJE A;  4DUZ L;  3M7G A;  4IJL A;  2A74 C;  3PMF A;  5EKK A;  3TQY A;  4O2D A;  3H0G B;  3BDC A;  1HJP A;  3M4Q A;  4GNX B;  2IX3 A;  1CFM A;  4ZN1 B;  1PVO A;  4FYD A;  3I3C A;  2APO B;  4LFA L;  1GJX A;  2ZXO A;  1TU2 B;  5IIF A;  1SFO L;  5FLM L;  1VQH A;  3WDN A;  2H5X A;  3MZ5 A;  5DNF A;  3SEB A;  1EIG A;  2ZJP A;  1HNZ Q;  4UY8 C;  1XPO A;  2JXM B;  1GD7 A;  3M4Y A;  5IWA Q;  3MWY W;  1QYB A;  3LNN A;  3SK8 A;  5C4J L;  3I4L A;  2PMZ P;  4P2C B;  4A3D G;  4KKU A;  2M9V A;  2UXD Q;  1STY A;  4IPH A;  1T9P A;  1FR3 A;  1R0H A;  1SNQ A;  2B2T A;  2PMZ B;  5DM6 3;  3BYY B;  3T56 B;  3H97 A;  1SMY C;  4DUZ Q;  3GTQ L;  1VQ8 A;  1TWC H;  3SGI A;  3TDQ A;  2GA4 B;  3K59 A;  1HR0 L;  4LF5 L;  3FKI L;  2EYL A;  1YK5 A;  1VQL A;  2J0T D;  4TSS A;  4BY1 G;  4Z9C B;  3T1Y L;  4OIJ A;  3CCV A;  2K2D A;  2JA7 H;  2QIL A;  2N55 A;  1LTI D;  5IGE A;  3SS2 A;  1I50 L;  4X65 L;  1LT4 D;  1IW7 C;  2RSN A;  4BXX G;  1CM9 A;  2VS1 A;  4NB3 A;  4DNI A;  4GS3 A;  3J7Y W;  4ULL A;  5C3E H;  4LFB L;  1F77 A;  1ESR A;  1EU3 A;  1ENF A;  2A5H A;  4JOI C;  2JQO A;  4C3J H;  2X69 A;  1OXS C;  1N36 Q;  2AUJ D;  2AYJ A;  2E2J B;  2FHT A;  3LWE A;  2BH2 A;  3IL8 A;  4KTA A;  2R7Z G;  3P75 A;  4RH6 A;  4JPB W;  2LCQ A;  4K5X A;  3N6R A;  1YJ9 A;  1HR0 Q;  3M4P A;  3HGB A;  3PUX A;  2PI2 E;  1CKM A;  1CAD A;  5BN5 A;  4JAD A;  2D62 A;  1BBX C;  2ZT9 C;  1X54 A;  2XSC A;  1YUX A;  2Z3Q B;  3RYG A;  3R2T A;  3K58 A;  4ZLT F;  4X3S A;  1Y8N B;  4AQY Q;  1KNA A;  1LYL A;  4X65 Q;  5T1G A;  1B9M A;  1PTO C;  3J7Y 1;  5M3F G;  2F4V Q;  4P72 A;  1TVX A;  1XTC D;  2I0Q A;  1K83 B;  1WTP A;  1VZI A;  1G29 1;  1ZKO A;  2C5C A;  5IYC G;  3LWO B;  2CH4 A;  1WTW A;  1STA A;  4Q5V A;  2JK8 A;  2JI1 A;  3BVG A;  4F88 A;  2ZXR A;  1E2V A;  5I2Y A;  3D8G A;  2B39 A;  1E2Z A;  3U9S A;  1TWH L;  3WWL A;  1NY4 A;  3NQI A;  4IUU A;  1VQA A;  3BJU A;  2MUY A;  3ERQ A;  5FJ8 G;  3S16 L;  2WB1 G;  5EPK A;  3RLO A;  4BBS G;  3R2I A;  2LMC B;  2A6H C;  5M5X L;  2CR8 A;  3K0Y A;  2JA9 A;  1RB9 A;  3GTL B;  1B2O A;  1A6X A;  1SNC A;  5M5Y B;  2E2I B;  1CUK A;  2XJU A;  5KNB A;  4A3G B;  2ATW A;  1QWY A;  4HIM A;  1AE3 A;  2RKS A;  5L37 A;  5J22 A;  1IRO A;  3PL5 A;  1EFI D;  2QGQ A;  4DR7 Q;  2CQO A;  1K8O A;  4QIW E;  4DUY L;  5JEA H;  4DR4 L;  2F03 A;  4MZ9 A;  5IP7 H;  3KK7 A;  3SR1 A;  5G3L D;  3GTK H;  3JAM E;  1H9K A;  1V8Q A;  1T5X D;  3CAM A;  4TKO B;  1QZH A;  3NP8 A;  5FLX L;  4UY8 1;  1CHP D;  3I8Z A;  1WJV A;  3NTI A;  1SMW A;  1LTG D;  1B71 A;  3GTG B;  3NBH A;  3M3Y B;  2F0G A;  3OW2 A;  1WI5 A;  2F1M A;  1O78 A;  2E2J L;  3NEL A;  3GV3 A;  4APV A;  3H3V H;  5D65 A;  4J6H A;  3KBX A;  1QUQ B;  2K6A A;  3MXP A;  4GN3 B;  3EA6 A;  3NWT A;  1A8V A;  1Z7T A;  2PI2 A;  1WTQ A;  4OO1 I;  1WTH A;  3QB3 A;  2JA7 G;  2BDO A;  3DLL A;  4OWX B;  4XDX A;  5ELF A;  4KJN A;  4L8J A;  2YTV A;  3MXU A;  5IOD A;  1G8Z D;  4UP9 A;  1RTO A;  3OYY A;  1HQM C;  4IZ8 A;  3SDZ A;  4DN4 M;  1PH4 A;  1RD9 D;  2K5N A;  1EWH A;  2B29 A;  1JOQ A;  1HR0 W;  2C35 B;  4A3K B;  2JA6 B;  5C3E G;  3VA7 A;  1I6V C;  1SDF A;  1K83 L;  1RF2 D;  1VQC A;  3K7U C;  1E24 A;  4PZ8 A;  5JEA J;  4AHX A;  2NVQ L;  1E0B A;  1PH3 A;  2Y0S P;  4JI8 Q;  3PQI A;  3S1Q B;  3CRK C;  1YK4 A;  1EY9 A;  3GTL H;  5ELE A;  4DAY A;  3Q23 A;  4OWW B;  5M5Y H;  2E2I H;  2Y0S B;  1NR2 A;  2B2Y C;  5M9O A;  3HOV G;  3KDF A;  1ICW A;  5IP9 L;  3MXG A;  3UDX A;  1LTL A;  1R9T B;  3KFU A;  3A0J A;  1JQY D;  2NVY L; 
#chains in the Genus database with same CATH homology
 3K0X A;  4OX9 Q;  2N78 A;  4JI4 L;  1UE6 A;  3S14 H;  1Y14 B;  1GO3 E;  3JAM c;  4IPC A;  3RR5 A;  3GTG H;  3M3Y H;  3KYX A;  1IBM L;  3I7F A;  4AI2 A;  5GQO A;  4P71 A;  1N32 L;  2WB1 E;  4POF A;  5AN9 H;  1BQ9 A;  3BZK A;  1V9P A;  1IU5 A;  5JEA G;  1K8A C;  4JI4 Q;  2HIX A;  5IP7 G;  3UE1 A;  3CC4 A;  4GKK L;  1IBL L;  3PO3 H;  1OWC A;  1IBM Q;  4QQB X;  1KHI A;  1VQ4 A;  2ZJR A;  2E2H H;  3WWN B;  1JE5 A;  2RCN A;  1R9T H;  2BA1 A;  1HNW Q;  4QL5 A;  1MIU A;  4GKK Q;  1KC8 C;  1X56 A;  1IBL Q;  1C7Y A;  1H95 A;  3F1Z A;  1PH9 A;  2UXB Q;  1XPU A;  4A3M H;  4GKJ L;  1SMX A;  3F8T A;  3STB C;  1RIP A;  3A5Z B;  4HJ5 A;  1NMG A;  2O5J D;  2CKZ B;  2XJR A;  2R7D A;  1MJC A;  3KOJ A;  1OTC A;  4DR3 L;  1VQJ A;  4A3C G;  4JOI A;  3S2D H;  1YNX A;  3UDI A;  4R4T A;  3AFQ A;  2A6E D;  3M9B A;  1YV1 A;  4XTC S;  2YU9 H;  3CW2 C;  2DSX A;  4DK3 C;  5C0X J;  2YTX A;  3VPB E;  4DV1 L;  2CWA A;  4A3E G;  1Y1W H;  3IU3 I;  2YV5 A;  4DR3 Q;  4HIK A;  4JI2 L;  4DAY B;  2Q2H A;  3ERS X;  4LFC L;  5JJI A;  1SRU A;  3GTO H;  1VQE A;  1WCM H;  3K7A H;  3HOW H;  3W1B A;  1JB7 A;  2Q2U A;  5IYB H;  3CCE A;  1VQ6 A;  2J9U B;  1P16 A;  2AWO A;  4DV1 Q;  1YVC A;  4AYB G;  3PO3 G;  3I2Z A;  4JAG A;  3HKS A;  3PIP A;  5K36 G;  3PGZ A;  2OWO A;  3CC7 A;  7RXN A;  4JI2 Q;  1KAW A;  4KI0 A;  4U67 1;  2ASB A;  4R4I A;  1XTD A;  4NXM L;  2D0P A;  2WFW A;  4LFC Q;  1B2J A;  2B63 H;  5RXN A;  4O0A A;  2HIV A;  5MF6 A;  1W2B A;  3ULL A;  1K8G A;  5C0X G;  3PUV A;  1LM0 A;  1RDG A;  4DK6 C;  3KLW A;  1Y1V H;  5EIN C;  3CCJ A;  2JE6 I;  4X62 L;  1HNX Q;  1NNQ A;  2M6P A;  2Z0S A;  4A3J H;  2RHQ B;  3CPW A;  2JA5 H;  2KBN A;  1FGU A;  3LGJ A;  2UUB Q;  1XMQ Q;  1Z9F A;  4DV0 Q;  5M3M H;  4B3T L;  2XJT A;  2GN5 A;  2VNU D;  1NXG A;  3E9H A;  1K73 C;  1KL9 A;  4X62 Q;  1PH8 A;  1C0A A;  1BRF A;  3J80 c;  4TVM A;  1JMC A;  2UUA L;  1FL0 A;  3L0O A;  4IFD J;  2IHE A;  1OXX K;  2PQA B;  1CKN A;  1R0I A;  4L5Q A;  2K52 A;  3G48 A;  1EFW A;  1WCM G;  3RZT A;  4B3T Q;  5ELO A;  4PG3 A;  4DV3 L;  1QCV A;  3HOW G;  2NZO A;  4DR5 L;  5AI3 A;  3S2H H;  3B0A B;  3G4S A;  2QL0 A;  2UUA Q;  3PCO B;  3J7Z C;  3RLN A;  2UXC L;  3MXN B;  5JJK A;  4KHP Q;  6RXN A;  2B63 G;  5C0X I;  1B8A A;  2NYD A;  3GD7 A;  4DV3 Q;  1UEB A;  4DR5 Q;  1G51 A;  1U5K A;  3STB D;  3CME A;  3HOY G;  3K8A A;  5MGN A;  3K81 C;  1Y1V G;  1HNZ L;  2JEB I;  3E0E A;  4ZN3 B;  2KN9 A;  1VQD A;  2UXD L;  2CFM A;  2A68 D;  1SFO H;  1GVP A;  5FLM H;  2HHH L;  1PHJ A;  4GLV B;  1NXE A;  2GVB A;  3QQC E;  3BU2 A;  5M3M G;  3CCQ A;  2HT1 A;  3E9I A;  2WAQ G;  1RYQ A;  1DGS A;  4JAE A;  3GTQ H;  3BZC A;  1J5E L;  4JV5 L;  1PH6 A;  4LHL A;  1ASY A;  3FKI H;  2IT1 A;  1EQR A;  3I56 A;  1N36 L;  1I50 H;  1S30 A;  2HHH Q;  2C6A A;  5HGQ A;  3Q8D A;  1PH2 A;  2ID0 A;  1VQ7 A;  4AQY L;  3PWF A;  4OO1 G;  2F4V L;  1SMM A;  4JV5 Q;  1J5E Q;  2HQL A;  5GAE c;  1GM5 A;  1LUZ A;  3JC6 3;  3W1G A;  1ZRP A;  4QJF A;  3KF8 B;  5LMN L;  1RYT A;  1N33 L;  5LMU Q;  3H0G H;  1SRO A;  3KYV A;  2BA0 A;  5H1S E;  5DM6 1;  3EIV A;  2V0F A;  2MO0 A;  4JG2 A;  3GO5 A;  5GAD c;  1N34 L;  3RN5 A;  1E8J A;  2GMG A;  2ZM6 L;  4IOC A;  4AHZ A;  2NN6 G;  2KCM A;  1TWH H;  4DR7 L;  4HJA A;  3S16 H;  2ZTD A;  2I5H A;  3U4V A;  5M5X H;  1T9O A;  2ERJ A;  5LMN Q;  3U50 C;  2HR5 A;  1QVG A;  1OXV A;  1N33 Q;  4RG1 A;  3HKZ G;  4JC0 A;  1P8L A;  2YYZ A;  3PF5 A;  4KHZ A;  1N34 Q;  2ZM6 Q;  4JI1 L;  3FP9 A;  4PZ7 A;  4IJH A;  5MFZ A;  3J81 i;  4B3M Q;  3PUW A;  1IU6 A;  1PV4 A;  5IY0 A;  3EN2 A;  3U4Z A;  1K9M C;  1Q7Y C;  2E2J H;  4PMW A;  3TS2 A;  3FKI G;  1PA6 A;  3A44 A;  1VQ9 A;  2WAQ E;  1X6O A;  1KXL A;  1LKO A;  1YZ6 A;  4JI8 L;  4GNX C;  4OXP A;  4JI1 Q;  2XGT A;  2AHO B;  1HZ9 A;  1YBY A;  1VQM A;  1K83 H;  5H1S c;  3NFP I;  2NVQ H;  1A63 A;  4OX9 L;  1M90 C;  1V1Q A;  4R4O A;  2VZA A;  4JI3 L;  4GLA C;  2EIF A;  4TVA B;  5IP9 H;  4GOP C;  2BH8 A;  1Q46 A;  3PUZ A;  3H0G G;  4A3G H;  2VL6 A;  1ASZ A;  1XMO L;  2NN6 I;  2IX1 A;  4DV4 Q;  2R93 H;  5LMN W;  5EIO C;  1VS0 A;  4JI3 Q;  4MTN A;  1EWI A;  1I5F A;  1VCI A;  2YTY A;  3GTP H;  3W5O A;  1TWF H;  3PSI A;  1A62 A;  1N8R C;  4X64 L;  2B5I D;  4DV5 Q;  1YIJ A;  1XMO Q;  4JBW A;  4HIO A;  3HKZ E;  5GAH c;  1CKO A;  4ME3 A;  1HNW L;  3PIP 1;  4A3K H;  2JA6 H;  4AR3 A;  3PIO A;  1TXY A;  2M4Y A;  3KYW A;  1B7Y B;  3KF6 A;  3S1Q H;  1E1O A;  4LF6 L;  2UXB L;  4X64 Q;  3UDG A;  2L0Z A;  4P74 A;  2DUD A;  1IW7 D;  5IT9 c;  1S2Z A;  5MLC 3;  2M6O A;  1VQF A;  1FJG L;  3LPE B;  2VQE Q;  4JCV E;  1D8L A;  2Z3R B;  3GTJ H;  2AMC B;  5AJ3 Q;  1SE8 A;  2XJV A;  3S24 A;  2PYA A;  1L1O C;  4XGH A;  2WP8 J;  1VQK A;  1YHB A;  4DKA C;  4LF6 Q;  1R0J A;  2I5L X;  4LF7 L;  5GRO A;  2F52 A;  3KJP A;  4LF8 Q;  4JBK A;  1FJG Q;  3NBH B;  4A3G G;  3IRB A;  4YWL A;  3H15 A;  4V19 6;  1Q82 C;  3QVD A;  1S40 A;  1C09 A;  1Z47 A;  3CF5 A;  1CAA A;  2E8G A;  4HJ9 A;  4LHN A;  3F2C A;  3JC6 2;  4LF7 Q;  2A6H D;  4A93 H;  1H7V A;  3CP0 A;  1PH5 A;  4LF4 L;  3FHW A;  4AR4 A;  2JA8 H;  4JI6 L;  2OTJ A;  1SMU A;  2ZTE A;  1SR3 A;  5GAE C;  2JI2 A;  2PMZ E;  3NEN A;  1X9N A;  4AHW A;  4A3L H;  1IXR A;  2XTI A;  4DV6 Q;  4JBJ A;  2MS3 A;  3KDF B;  2F3I A;  1RL2 A;  1K3R A;  5HY6 A;  5M5W H;  2JI3 A;  1Q8K A;  4A3K G;  2JA6 G;  1YUZ A;  4JBM A;  3K80 C;  4LF4 Q;  2LXK A;  1O7I A;  5GAD C;  4JI6 Q;  3OTO Q;  2KKD A;  3MPS A;  1ODH A;  3H3V I;  4Y7N H;  2Y0S G;  2K5V A;  2QEX A;  3I4M H;  1VZH A;  1HNX L;  1IL2 A;  4LNQ A;  1YI2 A;  3PF4 A;  3A5U A;  2UUB L;  2ZJQ A;  1XMQ L;  4JYA Q;  4AI1 A;  4DV0 L;  1PYS B;  1C9O A;  1WFQ A;  1SN8 A;  1RDV A;  4GNX A;  2NZH A;  1R0F A;  4A3M G;  4GLX A;  3CCS A;  5DM7 1;  1JT8 A;  3ER0 A;  4LF9 L;  1SLJ A;  4LW1 A;  8RXN A;  2OQ0 A;  1CSQ A;  2AKW B;  1Q81 C;  4L5S A;  1TWA H;  1EUJ A;  4GOP A;  1VCX A;  1BFY A;  4A93 G;  1UE5 A;  2DGY A;  3UDF A;  4LF9 Q;  1Y1W G;  4R1J A;  2MNA A;  4RMF A;  1E22 A;  3KYY A;  5C44 H;  1EIY B;  1FHH A;  1FVI A;  4A3L G;  2OQK A;  2IHF A;  1U0L A;  3TS0 A;  3AQQ A;  1Q1B A;  2K5H A;  1D7Q A;  4KHP L;  1FHM A;  5IYB G;  1J6Q A;  4BA2 I;  1OWB A;  3ULP A;  2K50 A;  5IYD H;  1IYJ B;  2CCZ A;  4A3B H;  1X3E A;  1BBU A;  4R4C A;  1LKM A;  3I4M G;  3P8B A;  1T9Q A;  1GKH A;  1E1T A;  1RWD A;  1PYB A;  2Y0S E;  2A19 A;  4B8C D;  4B3S Q;  4DV2 L;  4X66 L;  4BY7 H;  1NBW A;  4JI0 L;  1N9W A;  5GAH C;  1K0R A;  2E5L L;  1BVS A;  1HH2 P;  3CXC A;  4K9F A;  4IFD G;  2LSS A;  5C4X H;  4IO9 A;  1XNR L;  4A3J G;  5IYC H;  2A1A A;  2JA5 G;  2KEN A;  1L1O A;  2MQH A;  5C4J H;  4AH6 A;  4P75 A;  1VQN A;  2Z6K A;  2ALY B;  4DV2 Q;  4X66 Q;  1UE1 A;  4BBS H;  1QZG A;  4JI0 Q;  1QUQ A;  2E5L Q;  1BQ8 A;  1PH7 A;  2KCT A;  3M7N A;  2ERS A;  4XIG S;  1XNR Q;  2XJP A;  5C44 G;  4L5R C;  3L7Z C;  2R92 H;  4P73 A;  5LMU L;  4A4I A;  2NVX H;  1VZG A;  1LKP A;  2JJQ A;  3J81 c;  3PZA A;  1IBK Q;  4DR1 Q;  3T1H L;  1B13 A;  2Q2T A;  3RNU A;  2K75 A;  3CD6 A;  4GOP B;  1KRS A;  4EQ5 A;  3ZJY C;  4A75 A;  5IYD G;  4LFA Q;  3HFZ B;  1XPR A;  4A76 A;  1UWV A;  4A3B G;  2VUM H;  3TEH B;  2D0O A;  3J7Z 1;  4AI3 A;  1KQS A;  1T9H A;  4AR5 A;  4QGU A;  3T1H Q;  1YHA A;  3G71 A;  1CKN B;  4OON A;  4LF5 Q;  1MKH A;  4BY7 G;  3T1Y Q;  1S24 A;  4B3M L;  4IFD I;  3B08 B;  3HOV H;  1TWG H;  4GN4 B;  3M4O H;  3EBE A;  2L15 A;  3CMA A;  5JVG 1;  5C4X G;  1NE3 A;  4LFB Q;  1UE7 A;  2R6G A;  1VQO A;  2N3S A;  5FLM G;  3PIO 1;  4PZ6 A;  3M85 A;  3GTM H;  1YHQ A;  3NEM A;  1KD1 C;  2IY5 B;  1YIT A;  2A69 D;  1EIF A;  4G6B A;  1X3F A;  2KHI A;  2EXD A;  4DPG A;  3MSU A;  4HJ8 A;  2V0E A;  2GVA A;  3UE0 A;  4POG A;  4DR6 L;  4Y52 H;  3GDE A;  2V1C C;  4DR2 L;  3P2A A;  4YCU A;  2R92 G;  2ES2 A;  4IPG A;  4DAM A;  1L1O B;  4TQU S;  4LUV A;  3ICE A;  1KIX A;  1CSP A;  4DV4 L;  1G6P A;  4IOA A;  1R0G A;  5JVH 1;  2OCE A;  1NJI C;  4DR6 Q;  2RDV A;  3HOX H;  1NTG A;  1WYD A;  4DUY Q;  4DR2 Q;  4DR4 Q;  2VUM G;  3I55 A;  1Q86 C;  2NVY H;  4K0K L;  3I4N H;  4DV5 L;  1YJW A;  1Z92 B;  2A8V A;  2PPT A;  2PVE A;  3RLF A;  2VY3 A;  3ULJ A;  1A0I A;  3CPF A;  3JC6 6;  1WOC A;  5AI2 A;  3WWV A;  4WFN 1;  5DLQ E;  4EX5 A;  5J3B A;  2EQS A;  4A3C H;  2UU9 L;  2C6B A;  4K0K Q;  4AI0 A;  2JEA I;  2PVX A;  4LUZ A;  4H02 A;  2VQE L;  5GAG c;  3PV0 A;  5MFP A;  5BR8 L;  3PKI A;  5AJ3 L;  4A3E H;  4A3I H;  1JYB A;  4UP8 A;  1BKB A;  1HZA A;  1EQQ A;  2UU9 Q;  3D31 A;  2K4K A;  2Q2I A;  4C3H H;  4YY3 L;  3MEF A;  4UPA A;  3HOZ H;  4LF8 L;  4WJ4 A;  1L2F A;  4BBR H;  3S1M H;  5BR8 Q;  4WJ3 M;  4HID A;  3S15 H;  1X65 A;  4OWT B;  4DV7 L;  2MO1 A;  2N8N A;  4IPD A;  3I4O A;  4JI5 L;  1W3S A;  1N32 Q;  1OXU A;  3RN2 A;  4YWM A;  4J15 A;  2FXQ A;  4YY3 Q;  3HOX G;  2Z6K C;  4AIM A;  2I5M X;  3HOU H;  5IP9 G;  2VW9 A;  3RZO H;  3I4N G;  1M1K C;  4E6Y A;  3CCR A;  2RF4 A;  4C2M H;  4DV7 Q;  4TPU A;  4AR6 A;  4DV6 L;  5ELN A;  2R93 G;  4JI5 Q;  3KYU A;  3JAM i;  1L0W A;  4HJ7 A;  1YEZ A;  2M4V A;  3F2D A;  2PQA A;  4YWK A;  4GS7 D;  2V3B B;  2LXJ A;  3OTO L;  3AEV A;  4RXN A;  3PO2 H;  1IZ6 A;  1QVF A;  5IE8 A;  4GKJ Q;  3TRZ A;  3CCM A;  3K35 A;  3S1R H;  1QVC A;  4A3I G;  5E7N A;  5JJL A;  4QY7 A;  2NVT H;  1XNQ L;  1XJV A;  4JYA L;  4AHY A;  3PKJ A;  1EYG A;  1IRN A;  4ALP A;  3CCL A;  1I6H H;  2XJS A;  1BE7 A;  4MNO A;  3S1N H;  3VDY A;  3D0F A;  3HOZ G;  4JAF A;  1E7Z A;  2R7F A;  1PFS A;  1X55 A;  3LNL A;  4BBR G;  2MFI A;  4GN5 A;  4NPS A;  1VQP A;  1VQ5 A;  1AE2 A;  1XNQ Q;  4R4Q A;  1DVB A;  4A3F H;  1AH9 A;  3J7A 5;  2H12 A;  2K14 A;  2ZIX A;  4KLK A;  3HOU G;  3U58 A;  1OXT A;  3KF6 B;  1S72 A;  2RHS B;  4UP7 A;  1VQI A;  2QA4 A;  2UUC L;  3HOY H;  3S17 H;  1EOV A;  2ZTC A;  3J81 j;  4YHH L;  1B70 B;  1Q1E A;  3G6E A;  1WJJ A;  1BBW A;  4NXM Q;  4X6A H;  4FDB A;  1JJG A;  2XJQ A;  3RZ6 A;  5FLX c;  4XXB B;  2JA8 G;  2UUC Q;  3PO2 G;  5K2M E;  3RZD H;  2BE5 D;  2PSM C;  4YHH Q;  1YJN A;  3TRE A;  4A3D H;  1JJC B;  2AWN A;  1JJ2 A;  4JI7 L;  4BA1 I;  3PUY A;  2VQF L;  1E3P A;  2PNH A;  2OTL A;  3AYH B;  2IX0 A;  4B3S L;  4BY1 H;  1PH1 A;  4LWC A;  4NXN L;  5EAY A;  1S3O A;  1Q12 A;  4BXX H;  4LUO A;  3KYH C;  3CQZ H;  3CC2 A;  3L2P A;  1V43 A;  4JI7 Q;  2VQF Q;  2R7Z H;  3CCU A;  1I3Q H;  1I94 L;  4B3R L;  4A3F G;  4AYB E;  4L5T A;  4YCV A;  2CWP A;  1KRT A;  1DX8 A;  5GAG C;  1VQG A;  4NXN Q;  5M3F H;  3AFP A;  1X3G A;  4YCW A;  3ZG6 A;  3F2B A;  2KHJ A;  2B3G A;  1VQB A;  4C3I H;  1NMF A;  2N49 A;  5IWA L;  3DM3 A;  3B6Y A;  1I94 Q;  1HZB A;  4B3R Q;  2UXC Q;  2CKA A;  2CKC A;  3A74 A;  5FJ8 H;  1HZC A;  1IBK L;  3KJO A;  4DR1 L;  3J80 i;  1MJE A;  4DUZ L;  4IJL A;  3TQY A;  4O2D A;  1HJP A;  3M4Q A;  4GNX B;  4ZN1 B;  1PVO A;  4LFA L;  1VQH A;  2H5X A;  2ZJP A;  1HNZ Q;  4UY8 C;  1XPO A;  1GD7 A;  5IWA Q;  1QYB A;  4A3D G;  2UXD Q;  4IPH A;  1T9P A;  1R0H A;  4DUZ Q;  1VQ8 A;  1TWC H;  3SGI A;  1HR0 L;  4LF5 L;  1VQL A;  1YK5 A;  4BY1 G;  3T1Y L;  3CCV A;  2K2D A;  2JA7 H;  3SS2 A;  4X65 L;  4BXX G;  2VS1 A;  4NB3 A;  4DNI A;  4GS3 A;  5C3E H;  4LFB L;  4JOI C;  2JQO A;  4C3J H;  1OXS C;  1N36 Q;  2AYJ A;  2R7Z G;  2BH2 A;  2LCQ A;  1YJ9 A;  1HR0 Q;  3M4P A;  3PUX A;  1CKM A;  1CAD A;  2PI2 E;  4JAD A;  2D62 A;  1X54 A;  1YUX A;  2Z3Q B;  3RYG A;  4AQY Q;  1LYL A;  4X65 Q;  3J7Y 1;  5M3F G;  2F4V Q;  4P72 A;  2I0Q A;  1VZI A;  1G29 1;  5IYC G;  2JK8 A;  3WWL A;  1NY4 A;  1VQA A;  3BJU A;  5FJ8 G;  2WB1 G;  3RLO A;  4BBS G;  2CR8 A;  2JA9 A;  1RB9 A;  1B2O A;  1CUK A;  2XJU A;  2ATW A;  4HIM A;  1AE3 A;  1IRO A;  2QGQ A;  4DR7 Q;  2CQO A;  4QIW E;  4DUY L;  4DR4 L;  4MZ9 A;  5IP7 H;  3GTK H;  3CAM A;  1QZH A;  4UY8 1;  1WJV A;  1SMW A;  1B71 A;  3OW2 A;  1WI5 A;  3NEL A;  4APV A;  3H3V H;  4GN3 B;  1QUQ B;  1A8V A;  2PI2 A;  4OO1 I;  2JA7 G;  3DLL A;  4OWX B;  2YTV A;  4UP9 A;  3OYY A;  1PH4 A;  2K5N A;  2B29 A;  1HR0 W;  2C35 B;  5C3E G;  1VQC A;  3K7U C;  1E24 A;  4PZ8 A;  5JEA J;  4AHX A;  1PH3 A;  4JI8 Q;  1YK4 A;  3GTL H;  4OWW B;  5M5Y H;  2E2I H;  3HOV G;  3KDF A;  3UDX A;  1LTL A;  3KFU A;  3A0J A;  2JI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...