2VL6A

Structural analysis of the sulfolobus solfataricus mcm protein n- terminal domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
259
structure length
259
Chain Sequence
QIDYRDVFIEFLTTFKGNNNQNKYIERINELVAYRKKSLIIEFSDVLSFNENLAYEIINNTKIILPILEGALYDHILQLDPTYQRDIEKVHVRIVGIPRVIELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEVLEMPTICPKCGKPGQFRLIPEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPGDRVKVTGILDIKQDSPVKRGSRAVFDIYMKVSSIEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MINICHROMOSOME MAINTENANCE PROTEIN MCM
publication title Structural Analysis of the Sulfolobus Solfataricus Mcm Protein N-Terminal Domain.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 66
structure length 259
sequence length 259
chains with identical sequence B, C
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2vl6A03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vl6A02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 2vl6A01
1PH6A 3A5ZB 2LXJA 3HOWG 2K50A 4P75A 3RZDH 1T9PA 2Z6KC 1PH2A 2H5XA 5AI3A 3GD7A 3ZJYC 1X65A 1XMQQ 2VL6A 2NVQH 2R93H 3U4VA 1YJ9A 5JEAJ 1FJGQ 4C3IH 1VQFA 1VQKA 2HHHL 2K4KA 1SR3A 1BQ8A 1OXTA 2K5VA 4AR3A 1VQMA 2KENA 2DGYA 4DV7L 3TS2A 4JI5Q 1G6PA 3GDEA 3G4SA 3CCUA 2GMGA 1CKMA 2AWNA 4HIKA 4DR3Q 2JK8A 2VQFQ 1IBML 1VQ6A 3PGZA 1P8LA 2RHQB 4DR7L 2WAQE 5M3FG 2N8NA 1LTLA 1UE1A 5EAYA 4A3DH 1JJCB 4L5TA 4DPGA 5M5YH 1IYJB 3BU2A 2Z6KA 4GN3B 3F2BA 1EQQA 2HQLA 4IJLA 1I94L 1VQNA 4GKKQ 2BH8A 2D0PA 4JI1Q 2GVBA 5H1SE 3CCQA 3A44A 4X64L 4BA2I 3S15H 2UUCL 1KC8C 4BY1H 5HY6A 2QEXA 1PH5A 1E8JA 3HKSA 1OXSC 3GO5A 3KYXA 3RYGA 3K80C 2VQEQ 4DV3L 4A3BH 4P73A 5IWAQ 1H95A 4JI2L 4GOPB 2JA6H 4A75A 1YV1A 1VQIA 4B3RQ 4DV5Q 1T9QA 1R0IA 3M9BA 1QVFA 4X62L 2JE6I 2N49A 1O7IA 1TWFH 2ALYB 1YVCA 4LUOA 1BE7A 1E24A 2CQOA 4C3HH 4X65Q 2PMZE 2ZM6L 1PH4A 2E2IH 3QVDA 2I0QA 1HNWQ 1Q12A 4DK3C 4POFA 4DNIA 1NY4A 4OWTB 3TREA 3FKIH 4DKAC 1DX8A 1Y1WH 3PSIA 1IBLQ 4R4IA 1CSPA 2RHSB 2JEAI 1Q86C 1XPOA 1WJJA 2QGQA 4P72A 1VQAA 1JJ2A 1HR0L 4BA1I 2JA8H 1Q81C 1LYLA 4A4IA 2NVXH 2R92H 1YHQA 2OWOA 3S1NH 3GTLH 2IHEA 1VQ9A 2Q2HA 1XPUA 1VQ8A 1L1OC 2UU9Q 3HOXH 3K7UC 5J3BA 5LMNQ 1UE5A 2ES2A 3F2CA 4LW1A 4IFDG 4OO1G 1VQJA 2R93G 4PZ8A 4O0AA 4YHHL 2F52A 4YY3Q 2QA4A 1YIJA 3RZTA 2E5LL 2MQHA 4AR4A 4UP9A 5C0XI 4LF8Q 4JV5Q 4TQUS 3A5UA 3HOVG 3M7NA 4DV1Q 2YYZA 5C4JH 5C44G 1L2FA 2VS1A 3K8AA 1C9OA 2ZTDA 4OX9Q 3S17H 4XIGS 3J81i 4NXML 2A1AA 4A3DG 1N32L 2UUBQ 1E1OA 4NPSA 4QY7A 1D8LA 1BQ9A 4GKJQ 1SFOH 3KYUA 4QL5A 3HOWH 1PYBA 2R7DA 4AYBE 4X66Q 1YK5A 1WFQA 3I2ZA 3W5OA 1NMFA 4Y7NH 1HNZL 4C3JH 1IBKL 2ZJQA 2LSSA 1VQEA 3CMEA 1XMOQ 1A8VA 4A3BG 1QZGA 4DR2L 4HJAA 2JA6G 3CQZH 1BKBA 2NN6G 1K9MC 3B6YA 2LCQA 4RXNA 3TRZA 3KF8B 4PZ6A 3J80c 1SRUA 2MNAA 1EUJA 4DUZL 1EFWA 4LF4L 2E2HH 1LKOA 4LF5L 1HNXL 3OTOQ 2RCNA 1KRSA 1X3GA 1W2BA 3CC4A 3BZCA 2IHFA 3E0EA 4MNOA 1QZHA 1Y1WG 1WI5A 4JCVE 2RDVA 4A3FH 1IXRA 3SS2A 1V43A 1UEBA 2K52A 4KLKA 1RDVA 4A3IH 1QVGA 1J5EL 5JJKA 4HIMA 4JI0Q 3F8TA 4LFBQ 4HJ9A 1FGUA 4YWLA 3PIPA 2JA8G 1Q8KA 2R92G 2UXCL 5IYDH 3M85A 3JC63 1X56A 4KI0A 3HOXG 2JA7H 3CCSA 2DSXA 1G51A 1TXYA 3JC66 4B3SQ 5IP7H 3I4MH 1JMCA 3PO2H 3BZKA 3RN5A 1B71A 2MFIA 4P71A 3PF4A 4DV4Q 4JI4L 1BBUA 4TPUA 2KBNA 1J6QA 1GM5A 2UUAQ 3HOUH 2B3GA 2M4YA 3PUYA 6RXNA 4YY3L 4JYAQ 1RWDA 4A76A 3CXCA 2UXBL 1U5KA 1GO3E 3CPWA 1BBWA 3K81C 1V9PA 1B2JA 2K5HA 2MS3A 3UE0A 4POGA 2R7ZH 8RXNA 1B7YB 2K5NA 2Y0SG 4MZ9A 1KD1C 4JI6Q 3S1RH 2MO0A 2F4VQ 1EOVA 3TQYA 2I5HA 4DR1L 2A19A 2PQAA 3KYYA 4LF9Q 1L1OB 5IE8A 3H3VH 2OTLA 2CCZA 4JBWA 5GAEC 2Q2TA 4WJ3M 1IZ6A 5AJ3Q 1M1KC 5BR8L 3NENA 4GN4B 3J81j 3EIVA 5C0XJ 3PIOA 4QJFA 3T1YQ 1PYSB 4JI3L 1R0FA 1LUZA 4OWXB 3UE1A 3J7A5 4YWKA 3HOVH 1NE3A 4DAYB 1VCIA 2WB1G 3CCEA 4DR5L 3W1GA 5C44H 2V3BB 3CCVA 4GLXA 3GTKH 3RZOH 2IY5B 2PI2A 4B3RL 1S72A 3AFPA 2I5MX 1K73C 3GTGH 4X6AH 4A3JH 1QCVA 3E9HA 4IFDI 4OO1I 4Y52H 1X9NA 1FVIA 1M90C 4DR4Q 4A3FG 4A3IG 1UE7A 2AWOA 4OONA 3ER0A 2KKDA 1VQHA 3EN2A 3M4QA 1YHAA 3EBEA 4PZ7A 3CC2A 3T1HL 4LFAQ 5IYDG 4AQYQ 1JT8A 2VY3A 3S24A 1N36Q 3H0GG 1CKNA 5M3MG 3KFUA 2UXDQ 1SMWA 2JA9A 1EWIA 1SN8A 3PCOB 4LUVA 3KJPA 2A8VA 3RLNA 1K83H 1VQBA 2JA7G 2ZTCA 1UWVA 5IP7G 1KQSA 3I4MG 2XTIA 3PO2G 3G48A 1XTDA 3D31A 3RLFA 4A3EH 4AR5A 4OWWB 1VQLA 3HOUG 2CFMA 4KHPQ 3UDXA 1YUXA 4LFCL 4DUYL 1B2OA 1X3FA 1BFYA 1DGSA 3KYWA 2KHIA 1GVPA 4B3TQ 3PUZA 4JI7L 4ME3A 3PO3H 1T9OA 4LF7Q 2NN6I 3FHWA 1U0LA 3BJUA 4WJ4A 1YNXA 4NB3A 4A93G 2R7ZG 1XNQQ 2OCEA 3PUXA 2K75A 4DV2Q 3I4OA 2OQKA 1OXXK 2I5LX 1S30A 4AIMA 1XNRL 3NEMA 1K8GA 4R4QA 3RR5A 3PV0A 3KYHC 1VQPA 1HR0W 1Y14B 1PV4A 2BA1A 2PQAB 4EQ5A 1AE3A 1SMXA 4UPAA 3TEHB 1XMQL 3KF6A 1SLJA 1R0GA 1S2ZA 4NXNQ 1EIFA 1FJGL 3F2DA 3CCMA 1Z47A 1K8AC 3S2DH 1TWAH 2Q2UA 1CKOA 3CCLA 3PWFA 1ZRPA 4JI5L 4FDBA 3WWVA 1N33Q 4BXXG 2WFWA 3NBHB 4DR3L 4A3MH 4B3MQ 2VQFL 4A3JG 4BY7H 2V1CC 4A93H 4DR6Q 4OXPA 4IPDA 2YTVA 5JJIA 3RLOA 1A0IA 4ALPA 1UE6A 2B29A 1N34Q 2EIFA 4IOCA 2NVYH 4GKKL 4A3GH 4GLVB 4R4TA 1SROA 4JI1L 4L5SA 1Q46A 3DM3A 5IY0A 1SMUA 4QIWE 1MIUA 3CC7A 4BBSG 1YK4A 4EX5A 2N78A 2VQEL 4DV0Q 5FLMH 5C3EH 1XJVA 1X55A 2HT1A 5IWAL 2YTYA 3ULPA 1PHJA 3HOZG 3S2HH 2NZHA 5K36G 1S40A 1CKNB 1CSQA 1E3PA 4RG1A 2N3SA 1YBYA 4UP7A 2L15A 4YCUA 3JAMi 4DV5L 1CUKA 3KLWA 4A3EG 1PH8A 4X65L 1XPRA 1HNWL 3A74A 4AH6A 1PH1A 1IL2A 1SMMA 3KOJA 1PA6A 1IU6A 4GNXC 1IBLL 3PO3G 2ASBA 4PMWA 5GADC 2Q2IA 1RL2A 2HHHQ 4R4OA 2JA5G 1X3EA 1VQOA 4DV7Q 1MJCA 1IRNA 3H0GH 1T9HA 5M3MH 3LGJA 1IBMQ 2E2JH 4IPCA 2VW9A 4DK6C 2UU9L 1VCXA 2PVEA 5GQOA 1KIXA 5ELNA 4DAMA 3KYVA 1KHIA 1KL9A 1I94Q 1VQ5A 4IOAA 5ELOA 5LMNL 2BH2A 5JJLA 2YV5A 4GNXA 3J81c 4X64Q 4JI8Q 3ICEA 4IFDJ 1VQDA 3ULJA 1YITA 1OTCA 2UUCQ 2EQSA 4C2MH 3IRBA 4HJ8A 4DV3Q 1YJNA 1PH7A 2EXDA 5M5WH 4TVAB 4JI2Q 4LF8L 4GS3A 4JV5L 1I6HH 4A3MG 4DV1L 1N8RC 3K0XA 1WCMH 4OX9L 4X62Q 1H7VA 1RDGA 4KHZA 5JEAG 4YCWA 2ZM6Q 1Q82C 2R7FA 4JG2A 4P74A 4K0KQ 1YZ6A 2UUBL 4MTNA 3W1BA 2HIXA 4IO9A 1GKHA 4GKJL 3RNUA 3JC62 3HOYH 4A3GG 4BBRH 3GTMH 3L7ZC 4X66L 1YJWA 1QVCA 2NZOA 2PYAA 4HJ5A 3M4OH 1B8AA 1Y1VH 3HKZG 1K0RA 1HR0Q 2K2DA 2KN9A 4IPHA 4LF6Q 1TWHH 1WOCA 5FLMG 5C3EG 4A3KH 1XMOL 4A3LH 2RF4A 5FJ8H 1ASZA 4BXXH 1E7ZA 1RYTA 2ATWA 1PVOA 3PZAA 1DVBA 1EQRA 3PUWA 2XGTA 3J7ZC 3PF5A 3CD6A 3H3VI 4AR6A 2PVXA 3GTJH 1OXVA 4DV6Q 5M5XH 3OTOL 2LXKA 3A0JA 3G6EA 3K7AH 1LM0A 1GD7A 2CWAA 4YHHQ 1KXLA 1X6OA 1YHBA 5IT9c 2K14A 2E5LQ 1C0AA 2QL0A 1A62A 4JI0L 4LFBL 3L0OA 1B13A 2KHJA 3ERSX 1VQGA 1HZAA 4BBSH 3RN2A 1NBWA 1MJEA 2VUMH 3CP0A 3HOZH 4NXMQ 5E7NA 1HZ9A 4H02A 1N32Q 4YWMA 1FHMA 2AKWB 4B3SL 3I4NH 1PFSA 2PI2E 2PNHA 1RIPA 1YEZA 3ULLA 1JYBA 4UY8C 1HH2P 3HFZB 3MEFA 5LMUQ 4UP8A 1LKMA 4DV4L 1C09A 1KAWA 3I56A 3CMAA 1HNZQ 3KDFA 2YTXA 2MO1A 1IBKQ 2IT1A 2UUAL 1E22A 1NMGA 4JI8L 4GNXB 3E9IA 1LKPA 2JA5H 2JQOA 3STBC 4DR2Q 4JYAL 3OYYA 2WAQG 5IP9H 4K0KL 1WCMG 5IYBG 2D0OA 3I7FA 3UDIA 5C4XH 1PH3A 4LF4Q 3RZ6A 4DUZQ 5FLXc 4L5RC 1G291 2WP8J 2R6GA 4R1JA 3H15A 2ZTEA 4HJ7A 1HNXQ 4JI6L 4LF5Q 2F4VL 3HOYG 4LF9L 7RXNA 2JEBI 3KJOA 1JJGA 4BBRG 1JB7A 5IYCH 2JJQA 1QYBA 1YI2A 5AI2A 1YUZA 1Y1VG 2HR5A 3J80i 5AJ3L 4IJHA 1J5EQ 1QUQA 2Z0SA 4R4CA 4A3LG 3U50C 4A3KG 3T1YL 1NNQA 1Q7YC 5FJ8G 1JE5A 2UXCQ 3MPSA 4LF6L 3MXNB 1IROA 4QGUA 3U58A 3D0FA 4PG3A 1HJPA 2IX1A 3TS0A 1K3RA 3OW2A 3AFQA 1L0WA 5RXNA 2CWPA 1VQ4A 3NELA 4DV6L 3S14H 2DUDA 2NVTH 1CADA 3S1QH 4JI4Q 4DR4L 3CCJA 2CKZB 2E8GA 2B63H 3GTPH 5HGQA 3CF5A 4JBKA 1FHHA 2C35B 2FXQA 3F1ZA 1S24A 1S3OA 4A3CG 2UXBQ 4AQYL 4LFAL 2VUMG 3FP9A 1N36L 1AE2A 3GTOH 2UXDL 3AQQA 2HIVA 1VQ7A 4HIDA 3PUVA 3I4NG 1EIYB 4DR1Q 1L1OA 1FL0A 1IU5A 4GN5A 2OTJA 1Q1BA 1KRTA 3GTQH 4JOIC 1P16A 1W3SA 1HZBA 2KCTA 5BR8Q 4IPGA 4KHPL 3UDGA 1I5FA 5GROA 1EYGA 5LMUL 3S16H 1A63A 2OQ0A 4B3TL 1E1TA 4BY1G 4JI3Q 1VQCA 4LF7L 5IP9G 1CAAA 3KDFB 4GOPC 1BVSA 1I3QH 4DR7Q 5C4XG 1V1QA 4DR5Q 3CCRA 1R9TH 1XNQL 1X54A 2BA0A 3S1MH 4DV2L 1MKHA 1ASYA 4JBMA 4RMFA 4AYBG 5M3FH 3M4PA 4J15A 3STBD 1Z9FA 2Y0SE 1AH9A 4XTCS 1PH9A 3CAMA 1RB9A 4JOIA 5IYCG 5GAHC 4K9FA 2GVAA 3FKIG 3VDYA 1WYDA 3AYHB 4LNQA 2KCMA 5GAGC 4LUZA 4LWCA 3T1HQ 4JC0A 4QQBX 1VS0A 4BY7G 4NXNL 4GOPA 2GN5A 3KF6B 1QUQB 1SE8A 1HZCA 2F3IA 1NJIC 3HKZE 3M3YH 5C0XG 4YCVA 3SGIA 5IYBH 2ZJRA 1N33L 1TWGH 1TWCH 5LMNW 1Q1EA 4GLAC 2WB1E 4B3ML 1BRFA 2YU9H 3I55A 1NTGA 4DR6L 5DLQE 1OXUA 3CW2C 1R0JA 2ZJPA 2VNUD 2IX0A 2AHOB 2B63G 4O2DA 4LFCQ 4DUYQ 1N34L 1C7YA 4L5QA 1I50H 3JAMc 4JI7Q 4A3CH 1D7QA 2ID0A 3Q8DA 1R0HA 2AMCB 3DLLA 4DV0L 3UDFA 4JBJA 4HIOA 2D62A 1N9WA 3U4ZA 3CPFA 2VZAA 3L2PA 1XNRQ 4APVA 1B70B 3G71A 3AEVA
chains in the Genus database with same CATH superfamily
3A5ZB 2LXJA 2SEBD 5AI3A 1XMQQ 4KJNA 2A68C 1XX8A 5EJWA 4C3IH 4N9PA 2HHHL 1SR3A 3OW7A 2QEJC 3GDEA 3J7Y1 4HIKA 1CKMA 2AWNA 1P8LA 3GV3A 3GTOB 1BCPB 5C4JB 5EAYA 4OIJA 2JA6L 4IJLA 2EY1A 4H0LC 2Z4IA 1TWFL 2D0PA 4JI1Q 4C3HL 2XWBB 3CCQA 2E2IL 1AEXA 4X64L 3S15H 2UUCL 3K80C 1CHQD 2OT2A 4DV3L 3FKIL 1H95A 2RSNA 4GOPB 2JA6H 1YV1A 1VQIA 2NN6H 2EY2A 2JE6I 1O7IA 1TWFH 2EYOA 3K57A 1KD1C 4C3HH 2CQOA 5CV8A 3TMEA 2E2IH 3QVDA 4ZAIA 4NP5A 1STEA 4POFA 1NY4A 5IGDA 3FKIH 1DX8A 1LT6D 4K5VA 2V0EA 5AN9H 1ILQA 1XPOA 3Q22A 1Q81C 1EOTA 1YHQA 3PIP1 2HCCA 5MGNA 1L1OC 2UU9Q 2AUSB 2Z3QB 4WRDA 5C4JL 2M00A 5J3BA 1S4ZA 4IFDG 2R93G 3LWQB 5JAVA 4KY7A 2KOLA 4O0AA 2F52A 1C48A 4YHHL 1PZKD 4TQUS 3HOVG 3M7NA 5C4JH 2NWGA 2HQEA 3BS1A 1WTXA 2A1AA 4A3DG 4EQOA 2A69D 1SAPA 4NPSA 4QY7A 1D8LA 4KJOA 3TP8A 3MHBA 4QL5A 3A54A 1PYBA 2R7DA 5G3LF 3B08B 3I2ZA 1KTKA 1M4VA 4B08A 2DY7A 1HNZL 4DAYA 1IBKL 5BN3A 2R93B 4A3BG 1QZGA 4A3FL 4WFN1 1LT5D 3TRZA 1ENCA 2A5HA 4PZ6A 1PRTB 1SRUA 1WTHA 2MNAA 4DUZL 3HOVB 2RCNA 1KRSA 1W2BA 3BZCA 2IHFA 4A3DB 1R4QB 1AZPA 1QZHA 1HFGA 1MBYA 2NBFA 1CQFA 1WI5A 5M5YB 4A3FH 1QVGA 1IXRA 3D8GA 1J5EL 5JJKA 4LFBQ 4HJ9A 3VR5A 3PIPA 2JSOA 1KNAA 2IPKD 3P75A 2UXCL 1X56A 4DNRB 4A3BB 3NK9A 1G51A 1RYQA 2BDNA 1IHZA 1EY5A 1B71A 2XJTA 4MIUA 1EY7A 2PZTA 4X3KA 1BBUA 4PV1C 2B3GA 5JVH1 2M4YA 3V2TA 1GO3E 3CPWA 2K5NA 3TP7A 4JI6Q 3GTLB 2Z9HA 3HOVL 1ODHA 3H3VC 3W3AA 4WJ3M 1IZ6A 4IFDH 4KKTA 5BR8L 3NUCA 1CM9A 3PIOA 3GQBA 1ONLA 4Y52L 3P2AA 3T1YQ 1STGA 1LUZA 3EROA 4HCEA 4YWKA 1NE3A 4DAYB 3HOVH 2EOTA 1VDZA 3LNLA 1TWAB 1S72A 3S17B 2I5MX 3N52A 2ZXOA 2QW7A 4Y52H 1Z92B 1FVIA 1M90C 4K6DA 1SFOB 2E75C 1HTLD 3EN2A 3M4QA 2F3VA 4PZ7A 4Y7NB 2K5WA 2B2YC 3QR8A 3KFUA 1CKNA 4LHNA 1SMWA 1ZYRD 1EWIA 2A8VA 1D5XC 1VQBA 2ZTCA 4MTKA 3I4MG 3P7JA 1GUOA 2FINB 3HOUG 4LFCL 1X3FA 2KHIA 3H94A 1JC7A 4DK1A 2C6BA 3SEBA 4J8QA 2R7ZG 1QNKA 2OQKA 1ZEQX 1S30A 3MFGA 1TWAL 3PV0A 3RR5A 2KECA 4CDDC 3I4MB 4IUVA 4XYQA 3HKZP 4EQ5A 4BY7L 1JCKB 4A93L 1AE3A 3NWSA 1FR3A 3HOUB 1EIFA 2CR8A 1TWAH 4DFAA 1ZRPA 3M4YA 2WFWA 2E2DC 2JXMB 1LTSD 4FF4A 4BY7H 2R7ZB 4ZCKA 4ZK9B 4A93H 3RLOA 3SK4A 1PRTD 1UE6A 4RWSC 4UDUC 4AHZA 2B29A 4IOCA 3CHBD 4AI0A 4R4TA 4QUFA 5FOBB 1SMUA 4EX5A 1STYA 4DV0Q 1I4GA 3NHHA 5K36G 1RTOA 4HR7B 1CKNB 1CSQA 4RG1A 4DV5L 4A3EG 4KHVA 1PH8A 1CUKA 3KLWA 2PMZB 4DU9A 1TVXA 2KJXA 1C8CA 4AH6A 1QJOA 1PH1A 1IL2A 4LMQD 4ZN1B 1PTOF 1D5ZC 5J1ZA 4PMWA 2WAQP 4CDEC 1RL2A 2JA5G 2A6HC 1VQOA 5JVG1 1IRNA 5H1Sc 1Q3LA 2LFNA 3IU3I 2A73B 1J9OA 2RDFA 4DK6C 1VCXA 2PVEA 5M5WL 3J7Z1 4LAAA 3D3RA 4A3EB 2R7ZL 1KLGD 5LMNL 4BS9A 3BYYB 1SNCA 4HN7A 4JI8Q 1VQDA 2CH4A 2X69A 1OTCA 2B8FA 2EQSA 5ISRA 3IRBA 3HOYL 5M5WH 4JV5L 4GS3A 4A3MG 2DN8A 4OL7A 2KCCA 1IW7D 4KHZA 1Q82C 4YCWA 4KD3A 5ELFA 1STNA 1TKWB 2NB0A 3W1BA 2HIXA 1GKHA 3F2UA 4GKJL 3JC62 3HOYH 4A3GG 5CV6A 4X66L 1B9MA 1YJWA 1EL0A 1TY0A 4UY81 1Y1VH 5BN5A 1HR0Q 4IPHA 3NXWA 4LF6Q 1WOCA 4DGZA 3PZAA 1EQRA 3PUWA 3H3VI 2EYJA 4A3MB 1F2MA 4J1MA 3KUPA 5M5XH 4B9WA 3OTOL 2HVYC 1BF4A 1GJXA 3I91A 1B1ZA 1X6OA 2E5LQ 4A3GB 4JI0L 2PW5A 3J80E 2A69C 1HZAA 1NBWA 4AYBP 2BCOA 5K36H 2JA5L 2K1BA 2PNHA 4QIWP 3KBGA 1I4RA 2MP1A 1P7PA 3I56A 2EJFC 3CMAA 2L4NA 1SDFA 3AB9A 2IT1A 1E22A 1NMGA 1A6XA 1LKPA 2HDMA 2I46A 2JQOA 4PQXA 3U9OA 4DR2Q 2JA5H 3OYYA 1VMPA 5IYBG 4NW2A 1PH3A 4LF4Q 1A3UA 4ME5A 2R6GA 4HJ7A 4LF5Q 2F4VL 1PLFA 7RXNA 2JEBI 3VA7A 3KJOA 4BBRG 4IJHA 2Z0SA 3VR4A 3K5MA 4R4CA 3S1QL 3J7AV 2K32A 2ZXPA 2B63L 4IURA 4A3GL 5EPKA 2NYZD 4PG3A 2IX1A 1LACA 1QILA 5DM61 5KGUA 3TS0A 2IJ0A 3J7AF 4C1NK 2CWPA 2V4DA 1VQ4A 2PPTA 1Q90A 3S1QH 3BVZA 3FVQA 2CKZB 2B63H 4JBKA 3EJIA 1FHHA 4BBRB 3GTMB 1RTNA 3G6JB 3T13A 4MHEA 4AQYL 1PXUA 2VUMG 1E0BA 2UXDL 1BCPC 3AQQA 1Y8OB 1BDOA 5GAGc 4CDFC 5MFPA 1IU5A 3NTIA 3HS0C 1Q1BA 3VYSA 3KBXA 5D3DA 1KRTA 2F1MA 4IPGA 2J7ZA 1I5FA 3ERQA 4AI2A 4LF7L 4GOPC 5C4XG 4DR5Q 1XNQL 1XTCD 2VUMB 4DV2L 1O80A 1NNXA 2M4VA 3STBD 1PH9A 1SNDA 5IYCG 5IYBL 5A2QE 2JI3A 3VDYA 3AYHB 1HCZA 4LNQA 2E76C 3ZG6A 4JC0A 2KQ3A 1K8MA 2GN5A 1SE8A 1NJIC 3GTML 2LY7A 5C0XG 3SGIA 5IYBH 1N33L 1I50L 1F9QA 3BDOA 4I7AA 5C4XB 1BRFA 4DR6L 1OXUA 2CQAA 4XXEA 2HUGA 1V1OA 4DUYQ 3I3CA 3TDQA 1I50H 5CYUA 4JI7Q 3VYUA 1W6JA 3D6CA 1EFID 1KDBA 5FO8B 3RZDL 1GUTA 1SJED 2AMCB 2L5TA 4HIOA 2VZAA 2NTTA 3L2PA 3G71A 4K6LA 4ZQ3A 1PH6A 4ABNA 2X6LA 5EBCA 2IWHA 1SEBD 3RZDH 1PH2A 3S14B 1X65A 1G91A 2VL6A 3PIO3 3C3LA 3WWNB 1TY2A 5JEAJ 1FJGQ 1D6EC 5M9OA 1BQ8A 1OXTA 2K5VA 3TS2A 2DGYA 4DV7L 3MXUA 2GMGA 3CCUA 4DR3Q 2VQFQ 1S5ED 4EVOA 4FNFA 3FRPB 2N8NA 3NSWA 1LO5D 5C4ZA 4I65A 5C4XL 1IYJB 1EEFD 1QWYA 1XWEA 2Z6KA 4GN3B 2Q8TA 4V196 2HQLA 1CZWA 3BG3A 1E2WA 5IT9L 1I94L 2WV6D 4OELB 3GTQB 1FGBD 3QO2A 5HY6A 1E8JA 3HKSA 1EY8A 3RYGA 2VQEQ 4P73A 4JI2L 1UNSA 1CZGA 1T9QA 1R0IA 3M9BA 1QVFA 4X62L 4LUOA 1EY0A 2ALYB 1CHPD 1YVCA 4U673 1BE7A 1E24A 4X65Q 2ZM6L 3J81E 2I0QA 2JA8L 1HNWQ 2R92L 3FDTA 1PTOH 3VYRA 4DKAC 3D4WA 1Y1WH 1F4LA 2RHSB 4R4IA 3OOCA 4DK0A 2QGQA 1VQAA 4K8JA 4BA1I 2JA8H 1ESFA 2Y0SP 2R92H 1STAA 3NFPI 4LK1C 3FMCA 2Q2HA 1XPUA 4DAVA 1VQ8A 2L1BA 1GUNA 4S3SA 1OO9B 4X3TA 3LWVB 3F2CA 4LW1A 2CKCA 4OO1G 1VQJA 1K8OA 3BDCA 2QA4A 4YY3Q 1IW7C 3RZTA 3OMCA 2MQHA 3R2IA 2WB1P 3VPBE 4LF8Q 4WJWA 2EY6A 4RHRA 4JVZA 3IL8A 5C44G 2VS1A 3K8AA 4OX9Q 2ZTDA 4NXML 2UUBQ 1SYGA 1AFPA 3K58A 5DM73 1QE6A 1YK5A 3W5OA 1T5XD 2PYKA 3EQLC 2K01A 3X3NA 4EQPA 2ZJQA 1XMOQ 1KLUD 2XIWA 1WTOA 5I2XA 2JA6G 2NN6G 1K9MC 4RCNA 2LCQA 1GUWA 2EPBA 4C3HG 1EUJA 1EFWA 5CV5A 2CHBD 1HNXL 5HGTA 1X3GA 3LNNA 3CC4A 3E0EA 2DJFC 2JA7L 2K52A 1V43A 1UEBA 4KK7A 3AU7A 3PO2L 2DNEA 1LABA 3F8TA 1QCBD 1Q8KA 1PTOD 3S15B 4RA8A 2EXZA 3K5OA 3E3XA 3MA2B 2EYMA 2JA7H 2JA6B 4XT3B 4XQNA 3PO2H 4C1NI 3M7GA 4C3HB 4JADA 2MFIA 2E2IB 3PF4A 2EZVA 3OWEB 3BVGA 1J6QA 4DNTB 1PYWD 4JYAQ 2KEEA 1I4QA 2UXBL 3MFYA 3CXCA 1U5KA 2K5HA 2MS3A 2JP1A 1B7YB 4MZ9A 3H9CA 5J39A 2EJMA 3TQYA 4DR1L 1QOHA 3G7LA 5CGKA 3KYYA 1U4MA 3QJYA 5MF6A 5C44L 2OTLA 3GTKL 2CCZA 1KAAA 4OO1H 4IUTA 3JAML 1M1KC 3EIVA 4A3JL 4QJFA 1PYSB 1R0FA 3S9WA 4RKLA 2J9UB 3CCEA 5C44H 3GTKH 1JR0D 3S15L 3DUZA 2PI2A 2PSMC 4GZYC 4RAUC 3HP3A 4A3JH 2IW3A 4IFDI 2L55A 3V05A 3E5SA 4A3FG 2JYOA 4OONA 2B2WC 1VQHA 1YHAA 3EBEA 3T1HL 4LFAQ 4PMBA 1N36Q 2C9OA 1SN8A 3PCOB 4LUVA 1EYAA 1UWVA 3D31A 4HCSA 4KY6A 4AR5A 2MUYA 2XJQA 4IUPA 1VQLA 4KHPQ 3UDXA 1B2OA 4B3TQ 1IYUA 4A3FB 1R4PB 3PO3H 3J7YW 4WJ4A 4NB3A 2RQXA 3PUXA 2K75A 1OWBA 3HEJA 2I5LX 4AIMA 1XNRL 3NEMA 4R4QA 3JAME 4JPBW 4RH6A 1HR0W 2BA1A 4HTHA 2F03A 4V190 1B3AA 4HSVA 4ZKBB 1PFNA 5I9PA 3F2DA 2EYPA 3MAQA 2A6ED 3CCMA 3PWFA 2IY5B 4JI5L 2EDGA 3TZUA 5ELDA 1Q8IA 1HUMA 5GADc 1PZID 2V1CC 5JJIA 5C3EL 3P8BA 5CC4A 3S2HL 1QNUA 1L0XB 3Q23A 4GKKL 3DM3A 1H9KA 1JWSD 2Z6BA 3VYTA 4BBSG 4QUCA 3PIO1 5C3EH 2HT1A 5IWAL 2BDOA 3S2HH 1GXDC 4B3RL 4IFDJ 2WKDA 1TT2A 1WTQA 3PL5A 2XJSA 3DHQA 4R8NA 1OWCA 3I90A 2E2JL 3A74A 1O7YA 1IU6A 1IBLL 2ASBA 4CHTB 2HHHQ 2QILA 2MHVA 5E1FA 3LGJA 2OEOA 2E2JH 4BBSB 2VW9A 1CI3M 3C1EA 4N8X1 4F7XA 3SHLA 2B2TA 3OMGA 1QB5D 5ELNA 1AN8A 4DAMA 2C5CA 1B2TA 4U671 4IOAA 5ELOA 2XNAC 2BH2A 2YV5A 4GNXA 1SJHD 3K0YA 4X64Q 2UUCQ 3H99A 4G57A 4C2MH 4DV3Q 1YJNA 5JOBA 1ENAA 2EXDA 4DV1L 1QG7A 3K0XA 1WCMH 4BY7G 1H7VA 1RDGA 3ND9A 4A93G 4JG2A 4P74A 1RDPD 1TWHL 3WOEA 2PPBC 4MTNA 3U9SA 4L6TB 4DF7A 1EY6A 1QVCA 1H9RA 1B8AA 4P2CB 2DNCA 3HKZG 1K0RA 2K2DA 1B3QA 1TWHH 3SK5A 1PMRA 1RD9D 4QCLA 1JQYD 3J7ZC 2XGTA 2D5DA 1EQVA 3CD6A 4AR6A 3IKJA 1EWHA 3P20A 1UEAB 4BBSL 4OEMB 4DV6Q 2XJRA 3TN2A 4A93B 4BY7B 3PQIA 2LXKA 1I4HA 1LM0A 2CWAA 2RCFA 4YHHQ 3I4NL 2QL0A 2J4XA 1A62A 2B39A 2K6AA 1JE4A 1RJTA 1VQGA 4BBSH 1MJEA 3HKZB 1Y8PB 3WWLA 2L11A 4XYOA 3DWPA 1RHPA 5CV9A 1WD0A 4YWMA 1FHMA 4ULLA 4B3SL 3I4NH 2O5JC 4JW0A 1PFSA 5IP9L 2PI2E 4I7ZC 1NAPA 4UY8C 3QOJA 3TP5A 3MEFA 5LMUQ 4DV4L 1C09A 1EU3A 2F0JA 2H4OA 1HNZQ 2YTXA 2UUAL 1IBKQ 1Y69U 1FYCA 2L9HA 1DOLA 2RDGA 4JI8L 3E9IA 5F2DA 4GNXB 1ZXTA 4KV6A 2WAQG 5IP9H 2AYJA 2D0OA 5KYLA 5IGEA 4DUZQ 5FLXc 1ILPA 1G291 4R1JA 1Z6HA 1ET6A 3E0JA 2SNSA 3NBIA 3HOYG 4JK1C 4LF9L 1NXEA 2F0WA 1JB7A 4X3UA 1CK1A 1HQRD 3QWNA 3Q24A 5AI2A 1YUZA 1Y1VG 2HR5A 3J80i 5AJ3L 1J5EQ 1TIID 1O7ZA 3X3MA 3I70A 5ELBA 1NNQA 2UXCQ 1JE5A 3MPSA 1SYBA 4LF6L 3U58A 5M5WB 3D0FA 1HJPA 4CKBA 5FLXL 1MSHA 2WAQB 2ICIA 2Q8IB 3AFQA 3IFTA 2NVTH 1X3QA 4RGTA 2M6PA 2F0EA 4DR4L 3CCJA 3GTPH 1FNVA 5HGQA 3HOYB 1H9MA 1GHKA 4CBVA 1S24A 2F0KA 1Y1VB 4CJ0B 3L9AX 3FP9A 4KKSA 5IGCA 1VQ7A 2ERJA 4CDCC 1EIYB 1L1OA 1FL0A 1A3VA 2OTJA 3FEWX 4ZRZA 3OHXC 1PZXA 5M5XB 1W3SA 1HZBA 1SE2A 5BR8Q 5GROA 2DY8A 4QMGA 1EYGA 5M3FL 2EYFA 2CH4W 4KY5A 4DR7Q 3ONAB 3SXHA 3H3VM 2KEDA 4JBMA 1F9RA 4AYBG 5M3FH 4J15A 1Z9FA 1AH9A 2TMPA 3M3YL 3CAMA 4JOIA 5GAHC 1SYEA 2GVAA 1HA5A 1WYDA 2F3WA 3A55A 4IALA 2YU9L 4LUZA 4LWCA 1VS0A 3O13A 4NXNL 1LTID 1V1PA 2G9HD 2JA5B 3HKZE 3M3YH 1H9SA 1Y1VL 5LL6S 1TWGH 1DONA 4RKBA 4IUQA 4B3ML 2YU9H 3I55A 4TRDA 1WVLA 3S2DB 2B63G 4AYBB 4LFCQ 3QQCE 2RSOA 1N34L 1NCVA 3ITPA 1C7YA 5M5XL 1I4PA 4QIWB 1JICA 3DLLA 3UDFA 3LPEB 2NVQL 4QB4A 3U4ZA 3CPFA 2NVXB 2HCIA 3AEVA 3OWFA 2OF1A 4P75A 2Z6KC 3S1QB 3GD7A 5ELEA 3Q6SA 2FJ2A 2NVQH 2B63B 2XRQD 4C3JG 1YJ9A 2KVMA 1SYCA 1TS2A 2WINB 2K4KA 3CRKC 4KTAA 1JWMD 2KENA 1KNEA 1IBML 2F0TA 2JK8A 3A7LA 3PGZA 2WAQE 3T4AC 3SVMA 2F0FA 2MGSA 3V96A 3S2DL 1VQNA 1HRJA 1RKNA 2BH8A 5H1SE 4F88A 2LKVA 3A44A 2EVBA 4BA2I 2EYHA 2K7VA 1KC8C 5COYA 1PH5A 3KYXA 4C3JB 3KF8A 1JWUD 4A75A 2PZUA 4DV5Q 1VF7A 3S2DH 1V1PB 2WKCA 4XQJA 2KUMA 1H9SB 5KYIA 4K0KL 2PMZE 1PH4A 1C4QA 3T53B 2NVXL 2TSSA 4H7BA 4DK3C 4DNIA 1T5EA 2JEAI 1SE3A 3PSIA 5D65A 1CSPA 3HOXL 4L63B 1Q86C 1PFMA 1SMYD 1WJJA 2B2YA 1LYLA 1YNND 4A4IA 1BQQT 2NVXH 1SNQA 2OWOA 1F9SA 3S1NH 1WTWA 2F0QA 1VQ9A 1HPCA 3HOXH 1D1KA 2ICEC 3K7UC 2G9DA 5NUCA 4FVMA 5LMNQ 3TBIB 2APOB 4PZ8A 2XJPA 2EY4E 1BUVT 4C56C 4UP9A 1I50B 4RCOA 5C0XI 2PCFB 4JV5Q 1EY4A 3A5UA 2YYZA 1L2FA 3T56B 4FF3A 4XIGS 3J81i 2F0HA 4C3JL 1VZGA 1N32L 2A68D 1STBA 3CQZL 3HJWB 3KK7A 5TSSA 3KYUA 4KMUC 5L37A 4GKJQ 4AYBE 4AI3A 1JOQA 4X66Q 1NMFA 1U4LA 3RZDB 1HQMC 4ZUJA 1DJRD 4N9TA 5C6AA 4C3JH 1BBXC 4FF1A 3K35A 3CMEA 3CQZH 1BKBA 4A3IL 3MEHA 1GHJA 2F0NA 3KF8B 3W2DA 4N8FA 1EYDA 4CKEA 4PMCA 3VR3A 2E2HH 3OTOQ 5IYDL 4YIJA 2K5QA 2ZT9C 2M6OA 5HURA 1Y1WG 1ZYRC 2RDVA 1PFBA 4A3IH 4KLKA 1RDVA 5IP7L 1FNUA 4HIMA 4JI0Q 3MTSA 4YWLA 1E2ZA 2JA8G 2RBMA 1XYIA 2R92G 5IYDH 4G6BA 3I72A 2F0PA 1W6KA 5C4HA 3CCSA 2DSXA 1TXYA 3JC66 5IP7H 1JMCA 5C5MA 3BZKA 1SYDA 1K28A 1PTOB 3DEPA 4JI4L 1M8AA 3S1RL 1GM5A 1Y1WB 6RXNA 4YY3L 1RWDA 4A76A 1BBWA 3K81C 3K59A 4KKUA 1V9PA 2JA8B 3I4LA 4POGA 4G7ZC 2B8GA 2R92B 2Y0SG 2F4VQ 1BCPF 2MO0A 3S1RH 2A19A 4FO2A 2PQAA 5IE8A 3H3VH 5GAEC 3J81j 3GTGL 5C0XJ 4JI3L 3MWYW 3DM1A 2HDLA 4OWXB 1EIGA 5EQ0A 1SE4A 1PRTC 2M9VA 1VCIA 2WB1G 2FFKB 4GLXA 3ND8A 3W1GA 2V3BB 2EY5A 1AZQA 3RZOH 3VA5A 3AFPA 3GTGH 5EKLA 4FXGC 2NZ1D 4H44C 1QCVA 4OO1I 2Y0SB 1X9NA 2XRSD 1UE7A 5EPLA 3ER0A 3PKIA 4ZN3B 4BWGB 3CC2A 1E2VA 4HSPA 4AQYQ 1JT8A 2VY3A 4DN4M 5DNFA 5M3MG 1Y1WL 2UXDQ 3KJPA 1LV9A 1EYCA 1K83H 2JA7G 5CV4A 3R2TA 3EVQA 5CBEE 3PO2G 3G48A 2WB1B 4V0BA 4OWWB 3D4RA 1EZ8A 3NTHA 1B9NA 1YUXA 2AQCA 3SK8A 1BFYA 1DGSA 3KYWA 1GVPA 1U4PA 3DEOA 1EIHA 4ME3A 4LF7Q 2NN6I 4M8AA 3FHWA 1U0LA 3BJUA 1YNXA 4KD4A 1XNQQ 3HZXA 1WJVA 3WDNA 3Q0AA 4DV2Q 3I4OA 1OXXK 3TP6A 1K8GA 2JA7B 4CKCA 3KYHC 1VQPA 3PO2B 1Y14B 2PQAB 2F0MA 3MVVA 1WTVA 1F9PA 3TEHB 3HG9A 1XMQL 3KF6A 1SLJA 1R0GA 2F0DA 4XDXA 2F0LA 4CJ2C 1LTAD 4KN4C 1UAPA 1SXTA 3CCLA 3WWVA 1N33Q 1ZKOA 1I6HB 4A3JG 5JEAH 4DR6Q 1ICFB 5IT9E 2YTVA 4RFBA 1O78A 4X3SA 5FLML 3LWRB 4ALPA 3SK6A 4L5SA 5EBDA 1SROA 4JI1L 2PO4A 1Q46A 5EINC 1MIUA 1EZ6A 3M4OB 1HHVA 1YK4A 2N78A 4XQQA 1XJVA 5FLMH 3ULPA 4C2M1 2YTYA 1PHJA 2NZHA 2DJGC 1YBYA 2N3SA 4YCUA 3JAMi 5C44B 3GTKB 1JOKA 3DWAA 1XPRA 2B2TC 5M3ML 4A3JB 1PFYA 1LTGD 1SMMA 1VZIA 3KOJA 1PA6A 4GNXC 3PO3G 4R4OA 1ML0D 1X3EA 5LL6X 4DV7Q 3MC0B 1MJCA 1T9HA 5M3MH 3C2PA 1VMCA 5I4DA 1TR5A 4HMIA 2XJUA 1YNJD 2D2CC 3A8JE 2UU9L 4JAEA 5GQOA 3SR1A 3QIAA 1I6HL 2M2LA 4F87A 4DXGA 1K0SA 3KYVA 5K2ME 1I94Q 1VQ5A 5JJLA 2SDFA 2K28A 2CKAA 5KEEA 1EEID 1B44D 5ELCA 1YITA 4FXKC 5CV7A 2RDHA 2D9UA 3I73A 1PH7A 3PO3B 4TVAB 4JI2Q 1JORA 1I6HH 5IGBA 4NKLA 3M4OL 3OIQA 5EGTA 4X62Q 5EKIA 1B53A 2ZM6Q 5C3XA 2H1EA 4A3LL 5FK9C 2F0UA 5FJ8L 1SMYC 4IO9A 3CU7A 2MPMA 4HJ5A 2NZOA 1BXTA 3M4OH 2F4IA 3GTJL 2N88A 5C3EG 3MSUA 4A3KH 4A3LH 5DAUA 1J8IA 2RF4A 5FJ8H 4E6IA 2ATWA 1RYTA 3T51B 3PF5A 5IOCA 3GTJH 3LWOB 5EIOC 1HFNA 2F0OA 3A0JA 1DYQA 3NQIA 2SNMA 1KXLA 1C0AA 2K5DA 1B4OA 2K14A 2X6GA 4LFBL 1B13A 2K04A 2KHJA 1ET9A 1SNMA 1II3A 1CTMA 3CP0A 1CQVA 4NXMQ 5E7NA 4J6HA 3PO3L 5C3EB 4H02A 5T1IA 4Q5VA 2BE5D 3S2HB 3BDLA 3D6WA 4K2KA 2A6HD 2AKWB 1RIPA 3ULLA 1JYBA 1HH2P 3HFZB 1SNOA 1LKMA 1SYFA 3H09A 1KAWA 3KDFA 3RUZA 2MO1A 3VR2A 5JVG3 2XSCA 3STBC 1X3PA 3HRZC 1WCMG 1L0YB 3I7FA 4FYDA 2E2JB 1R9TB 3H15A 1HNXQ 1CA6A 3R3OA 4JI6L 5CMDA 2F0GA 4ZLTF 4IQZA 5IODA 2JJQA 1A2UA 1PZJD 1QYBA 4ZUIA 2J0TD 2O2LD 1QUQA 5JJZA 3T1YL 1HTPA 1Q7YC 5I6YA 2Z1CA 4C2MB 3CKIB 4FF2A 1K3RA 2KA7A 1IL8A 1WCMB 1EQTA 2QDBA 3E6ZX 1TWCB 3OW2A 1L0WA 5RXNA 1HXYD 5BN4A 2XJVA 4DV6L 3GTOL 1CADA 3CF5A 1XXGA 2C35B 2FXQA 1D5MC 1S3OA 4A3CG 2UXBQ 4TKOB 1LTTD 3IAYA 1TWHB 1AE2A 3GTOH 1ENFA 4UAIA 5KRUA 1F2YA 4IUNA 4HIDA 3VR6A 3H9BA 4K5WA 3I4NG 4DR1Q 1MI2A 4ZKCB 3QG1A 3LWUA 4JAFA 2RA4A 2F0SA 4ZYSA 1R9TL 2XWJB 4JOIC 4M1UB 2KCTA 2B2VA 5LMUL 1X32A 1E1TA 4BY1G 5IP9G 4Z9CB 3KDFB 1V1QA 2VXWA 3MZ5A 1R9TH 4JAGA 1X54A 4IUUA 1MKHA 1ASYA 1RF2D 4RMFA 5C3WA 1LT4D 3I4NB 1O7LA 1WCML 1TWCL 3PKJA 2NYDA 2KCMA 5GAGC 3T1HQ 4QQBX 1BNZA 1QUQB 2G5DA 5FKAC 4BY1B 2GA4B 5GAEc 1S5CD 1TWCH 5LMNW 1IKMA 1Q1EA 2AUJD 2B2UA 1BOSA 5K5PA 5DLQE 1R0JA 2ZJPA 5C5LA 1PDQA 2IX0A 2AHOB 1WTRA 1TS4A 4RGMA 1TU2B 5LHY1 1G8ZD 3N6RA 5JPMC 4L5QA 3H97A 5D3IB 5KIXA 2ID0A 2RVLA 3LX0A 1R0HA 5DM63 4DV0L 2D62A 2R93L 1N9WA 2CW0D 1XNRQ 2WIIB 1B70B 4HMJA 3DXJC 4A3CL 2WACA 2L0ZA 3SE0A 3HOWG 1A2TA 1DOKA 2K50A 1TS5A 1T9PA 1BCPD 2H5XA 2NVTB 3ZJYC 5DM71 3GTPB 5CR3A 4A3DL 2R93H 3U4VA 2EYLA 4IZ8A 2JI2A 1VQFA 1VQKA 5M5YL 1Y8NB 3NP8A 3B0AB 4A3CH 2PNRC 4AR3A 1VQMA 4XT1B 1DD2A 1G6PA 4JI5Q 1N8RC 3G4SA 4MN3A 1VQ6A 4DR7L 2RHQB 5M3FG 2BOSA 2PZWA 4BY1L 1LTLA 1UE1A 4A3DH 1JJCB 3CRLC 4L5TA 4DPGA 5CBAE 4A3BL 1A3TA 1NSNS 2IX3A 3BU2A 4R9WA 5M5YH 3F2BA 1EQQA 1DOMA 3ZYYX 4GKKQ 4HAEA 2GVBA 5D14A 3HOWB 3HJYB 4OHJA 4BY1H 2QEXA 1OXSC 1EU4A 3GO5A 4A3BH 5IWAQ 4NMZA 4B3RQ 2N49A 1I4XA 2F0VA 2KCNA 1EWCA 1PTOC 1Q12A 5M3FB 2CVRA 3GTLL 4KN7C 2FHTA 4OWTB 3TREA 1IBLQ 4R8IA 3C46A 2B2WA 3EA6A 2NVTL 1YNJC 4P72A 1JJ2A 1HR0L 3GTPL 3GP7A 3DWQA 2VB2X 4IN3A 3M3YB 3GTLH 2IHEA 3LWEA 1TWGB 5MLC3 1GOZA 2YU9B 5A35A 1UE5A 3S17L 4K8IA 2ES2A 2XN9C 4DXFA 3OSOA 1YIJA 2E5LL 4AI1A 4AR4A 1SFOL 1GUGA 1LT3D 3HOWL 4DV1Q 4Y7NL 1C9OA 3S17H 1NUCA 1RODA 3MXGA 1E1OA 1BQ9A 5EPJA 1SFOH 4NDXA 3HOWH 1RCVD 2HD3A 1WFQA 3A8IE 4Y7NH 5T1GA 2NVQB 2LSSA 2H12A 1VQEA 1A8VA 4TSSA 4DR2L 4HJAA 2QF7A 2QCPX 3B6YA 4RXNA 5IGFA 1I6VC 3J80c 1NXGA 4LF4L 1MHWC 2B5ID 4AHYA 1LKOA 4LF5L 4MNOA 1TWGL 4B9XA 3AMUA 4JCVE 3OPOA 3SS2A 3EFXD 1NR4A 2NUCA 3I4ML 3LWPB 1FGUA 2BE5C 5FLXE 3QB3A 3M85A 1KDCA 3JC63 3A56A 3HOUL 2PQEA 4KI0A 1DZ1A 3J80L 2QKIC 3HOXG 2AUKA 4B3SQ 5KNBA 3I4MH 1CA5A 3RN5A 4P71A 4Q0FA 2AQ3B 2K05A 4DV4Q 2LS01 2NTSA 4TPUA 2KBNA 3HOUH 2UUAQ 5E3FA 3PUYA 4QF4A 2PMZP 1JOOA 2L12A 1B2JA 3UE0A 2R7ZH 8RXNA 3UI2A 3C1FA 3S1NB 1BR9A 1EOVA 2I5HA 4LF9Q 1L1OB 3HOXB 2A6EC 1S5BD 2A74C 4JBWA 1ESRA 5E4XA 3TSSA 2Q2TA 1AW7A 5AJ3Q 4X6AL 3NENA 4GN4B 3RMHA 2FMMA 1ICWA 3D4DA 3NBHA 3UE1A 3J7A5 4G4KA 4DR5L 3CCVA 3NPPA 1H9JA 2AQ1B 2K03A 2EE1A 4X6AH 1K73C 4LHLA 3E9HA 4LJZC 1U4RA 4TVMA 3WOFA 4DR4Q 4A3IG 2AWOA 2C6AA 3BVMA 3BZDB 3R8BA 4CGYB 2KKDA 3JR7A 1GUSA 4A3EL 2NVYB 5IYDG 3S24A 3H0GG 2JA9A 3RLNA 3CQZB 1LTRD 2SOBA 5IP7G 1KQSA 1SNPA 2XTIA 3HAXC 4FXDA 1XTDA 2E74C 4ILWA 3RLFA 4A3EH 2E2HB 3S1NL 3FPUB 2CFMA 1LTBD 1KIXA 4DUYL 4O1NA 2RKSA 4A3IB 3PUZA 4JI7L 1T9OA 5MFZA 3K6OA 2EJGC 2OCEA 1IYVA 2ERSA 2JI1A 4CJ1B 3H0GB 4UHVA 5KNDA 1TS3A 1PV4A 4U68A 4A3ML 4H13C 1CT1D 1DCZA 1SMXA 4UPAA 1QQTA 5A2QL 1S2ZA 4NXNQ 1FJGL 3P1HA 1K8AC 1Z47A 2Q2UA 1CKOA 4BXXG 2NVYL 3PMFA 4FDBA 2Z4HA 2Z8LA 3NBHB 4DR3L 4A3MH 4B3MQ 4K2LA 2VQFL 3GV6A 1TQOA 4FP5D 4OXPA 4IPDA 2FMCA 3S1RB 4EQNA 1A0IA 1N34Q 2EIFA 2E2HL 3OIPA 2NVYH 4A3GH 1B50A 1VF5C 2CW0C 4GLVB 5DEHA 5IY0A 4QIWE 3CC7A 2PW7A 2VQEL 1X55A 3HOZG 4RGOS 1EY9A 4AHWA 1E3PA 4UP7A 1WD1A 3K5NA 1S40A 3RZOB 2L15A 3NE5B 4X65L 2KHSA 4OGQC 3H0GL 4L8JA 3GTGB 1HNWL 5E4WC 2R61A 4OIKA 2F0IA 3K7AB 5I2YA 5GADC 2Q2IA 2L0CA 1CFMA 5KNCA 2RFKB 5G3LD 1DXMA 2QDLA 1F77A 3H0GH 5J22A 5EKKA 1IBMQ 4IPCA 4PNYA 1NR2A 1SBBB 1VZHA 1K83B 2I07B 3HOZB 1V8QA 4K14A 3T16A 1KHIA 1KL9A 5AFWA 3J81c 3ICEA 3ULJA 4F8MA 3PIP3 4HJ8A 4LF8L 4BBRL 1IKLA 4OX9L 3NWTA 1D1IA 5JEAG 2R7FA 4K0KQ 4ODGA 1YZ6A 2UUBL 3A8KE 1FNWA 4O42A 3RZOL 4BXXL 4EGVA 3RNUA 3H6MA 4BBRH 3J81L 3GTMH 3L7ZC 2PYAA 1Z7TA 3QOLA 1PFWA 3MXNA 3MXPA 5FO9B 2KN9A 5FLMG 1XMOL 3K7AL 4WORA 1ASZA 4BXXH 1E7ZA 1PVOA 1DVBA 3R93A 4DAPA 1MGSA 2PVXA 1OXVA 2ZXRA 2VUML 1K83L 3HOZL 3KLSA 3G6EA 3K7AH 1GD7A 2AQ2B 1YHBA 5IT9c 3FDJA 2JN4A 3L0OA 3ERSX 4WFN3 3RN2A 2VUMH 3S1MB 3HOZH 1HZ9A 1N32Q 2P5ZX 4RHSA 3H91A 1F2LA 3KLSX 1D2BA 1YEZA 5I9OA 4UP8A 5IIFA 1U9RA 2IL8A 3S16B 4JYAL 3L3OC 1F2ZA 5IYCL 4G7HC 3UDIA 5C4XH 1I3QB 5M3MB 4L5RC 3RZ6A 2WP8J 2ZTEA 5FO7B 1MSGA 1G6ZA 1JJGA 4DA2A 2Q8RE 4XGHA 3HGBA 5IYCH 2ENBA 5JVH3 1YI2A 3I8ZA 4A3LG 2VB3X 2N55A 3S14L 3U50C 4A3KG 5FJ8G 1UUPA 3MXNB 1IROA 4QGUA 1DM0B 2V0FA 5I6WA 2Z3RB 5C0XH 1PRTF 1FD7D 3NELA 3S14H 2DUDA 5IGGA 3NQTA 4JI4Q 2E8GA 1A15A 2K33A 2B2VC 4C3IG 3F1ZA 1HA6A 3GTQL 4LFAL 3SDZA 1WTPA 5GAHc 1JB3A 1N36L 3TZDA 4A3KB 2HIVA 4XXBB 3S16L 3RD4A 3K5LA 3PUVA 4G7OC 4B8CD 1KDAA 4GN5A 1I3QL 2R3ZA 5CORA 3GTJB 3GTQH 3S1ML 1P16A 4KHPL 3FPPA 4HEDA 3UDGA 3S16H 1A63A 2OQ0A 3A7AB 4B3TL 4JI3Q 2O5JD 2LMCB 1VQCA 1MD2D 1CAAA 5JPNC 1BVSA 4AHXA 1I3QH 4C3IB 3CCRA 1LLRD 2BA0A 3S1MH 1HUNA 1BO0A 1K3BC 2B2UC 1KABA 3M4PA 3MQKB 1AP0A 2Y0SE 4XTCS 1RB9A 4K9FA 3FKIG 4ID6A 4E6YA 1S5DD 1PFVA 4RGNA 4GOPA 2O5IC 3KF6B 2ZIXA 1HZCA 2F3IA 3NTKA 4YCVA 2ZJRA 3IFDA 4GLAC 2WB1E 1PFUA 1G2TA 1NTGA 4A3KL 3CW2C 2MJ8A 1TWFB 2VNUD 1STHA 2O4XA 1YNNC 1SSOA 3BYTB 4O2DA 3JAMc 1G2SA 1D7QA 3FKIB 3Q8DA 3URYA 4GS7D 3DMUA 4JBJA 2OXPA 4K5XA 4C3IL 2XVSA 3KLRA 4APVA 1S5FD
chains in the Genus database with same CATH topology
3A5ZB 2LXJA 5AI3A 1XMQQ 4C3IH 2HHHL 1SR3A 3GDEA 3J7Y1 4HIKA 1CKMA 2AWNA 1P8LA 5EAYA 4IJLA 2D0PA 4JI1Q 3CCQA 4X64L 3S15H 2UUCL 3K80C 4DV3L 1H95A 4GOPB 2JA6H 1YV1A 1VQIA 2JE6I 1O7IA 1TWFH 1KD1C 4C3HH 2CQOA 2E2IH 3QVDA 4POFA 1NY4A 3FKIH 1DX8A 2V0EA 5AN9H 1XPOA 1Q81C 1YHQA 3PIP1 5MGNA 1L1OC 2UU9Q 2Z3QB 5J3BA 4IFDG 2R93G 4O0AA 4YHHL 2F52A 4TQUS 3HOVG 3M7NA 5C4JH 2A1AA 4A3DG 2A69D 4NPSA 4QY7A 1D8LA 4QL5A 1PYBA 2R7DA 3B08B 3I2ZA 1HNZL 1IBKL 4A3BG 1QZGA 4WFN1 3TRZA 4PZ6A 2MNAA 1SRUA 4DUZL 2RCNA 1KRSA 1W2BA 3BZCA 2IHFA 1QZHA 1WI5A 4A3FH 1QVGA 1IXRA 1J5EL 5JJKA 4LFBQ 4HJ9A 3PIPA 2UXCL 1X56A 1G51A 1RYQA 1B71A 2XJTA 1BBUA 2B3GA 5JVH1 2M4YA 1GO3E 3CPWA 2K5NA 4JI6Q 1ODHA 4WJ3M 1IZ6A 5BR8L 3PIOA 3P2AA 3T1YQ 1LUZA 4YWKA 3HOVH 1NE3A 4DAYB 3LNLA 1S72A 2I5MX 4Y52H 1Z92B 1FVIA 1M90C 3EN2A 3M4QA 4PZ7A 3KFUA 1CKNA 4LHNA 1SMWA 2A8VA 1EWIA 1VQBA 2ZTCA 3I4MG 3HOUG 4LFCL 1X3FA 2KHIA 2C6BA 2R7ZG 2OQKA 1S30A 3RR5A 3PV0A 4EQ5A 1AE3A 1EIFA 2CR8A 1TWAH 1ZRPA 2WFWA 4BY7H 4A93H 3RLOA 1UE6A 4AHZA 2B29A 4IOCA 4AI0A 4R4TA 1SMUA 4EX5A 4DV0Q 5K36G 1CKNB 1CSQA 4RG1A 4DV5L 4A3EG 1PH8A 1CUKA 3KLWA 4AH6A 1PH1A 1IL2A 4ZN1B 4PMWA 1RL2A 2JA5G 1VQOA 5JVG1 1IRNA 5H1Sc 3IU3I 4DK6C 1VCXA 2PVEA 3J7Z1 5LMNL 4JI8Q 1VQDA 1OTCA 2EQSA 3IRBA 5M5WH 4JV5L 4GS3A 4A3MG 1IW7D 4KHZA 1Q82C 4YCWA 3W1BA 2HIXA 1GKHA 4GKJL 3JC62 3HOYH 4A3GG 4X66L 1YJWA 4UY81 1Y1VH 1HR0Q 4IPHA 4LF6Q 1WOCA 3PZAA 1EQRA 3PUWA 3H3VI 5M5XH 3OTOL 1X6OA 2E5LQ 4JI0L 1HZAA 1NBWA 2PNHA 3I56A 3CMAA 2IT1A 1E22A 1NMGA 1LKPA 2JA5H 2JQOA 4DR2Q 3OYYA 5IYBG 1PH3A 4LF4Q 4HJ7A 2R6GA 4LF5Q 2F4VL 7RXNA 2JEBI 3KJOA 4BBRG 4IJHA 2Z0SA 4R4CA 4PG3A 2IX1A 5DM61 3TS0A 2CWPA 1VQ4A 2PPTA 3S1QH 2CKZB 2B63H 4JBKA 1FHHA 4AQYL 2VUMG 2UXDL 3AQQA 5GAGc 5MFPA 1IU5A 1Q1BA 1KRTA 4IPGA 1I5FA 4AI2A 4LF7L 4GOPC 5C4XG 4DR5Q 1XNQL 4DV2L 2M4VA 3STBD 1PH9A 5IYCG 2JI3A 3VDYA 3AYHB 4LNQA 3ZG6A 4JC0A 2GN5A 1SE8A 1NJIC 5C0XG 3SGIA 5IYBH 1N33L 1BRFA 4DR6L 1OXUA 4DUYQ 1I50H 4JI7Q 2AMCB 4HIOA 2VZAA 3L2PA 3G71A 1PH6A 3RZDH 1PH2A 1X65A 2VL6A 3WWNB 5JEAJ 1FJGQ 1BQ8A 1OXTA 2K5VA 3TS2A 2DGYA 4DV7L 3CCUA 2GMGA 4DR3Q 2VQFQ 2N8NA 1IYJB 2Z6KA 4GN3B 4V196 2HQLA 1I94L 5HY6A 1E8JA 3HKSA 2VQEQ 3RYGA 4P73A 4JI2L 1T9QA 1R0IA 3M9BA 1QVFA 4X62L 4LUOA 2ALYB 2ZM6L 1YVCA 1BE7A 1E24A 4X65Q 2I0QA 1HNWQ 4DKAC 1Y1WH 4R4IA 2RHSB 2QGQA 1VQAA 4BA1I 2JA8H 2R92H 3NFPI 2Q2HA 1XPUA 1VQ8A 3F2CA 4LW1A 2CKCA 4OO1G 1VQJA 2QA4A 4YY3Q 3RZTA 2MQHA 3VPBE 4LF8Q 5C44G 2VS1A 3K8AA 4OX9Q 2ZTDA 4NXML 2UUBQ 1YK5A 3W5OA 2ZJQA 1XMOQ 2JA6G 2NN6G 1K9MC 2LCQA 1EUJA 1EFWA 1HNXL 1X3GA 3CC4A 3E0EA 2K52A 1V43A 1UEBA 3F8TA 1Q8KA 2JA7H 3PO2H 4JADA 2MFIA 3PF4A 1J6QA 4JYAQ 2UXBL 3CXCA 1U5KA 2K5HA 2MS3A 1B7YB 4MZ9A 3TQYA 4DR1L 3KYYA 5MF6A 2OTLA 2CCZA 1M1KC 3EIVA 4QJFA 1PYSB 1R0FA 2J9UB 3CCEA 5C44H 3GTKH 2PI2A 2PSMC 4A3JH 4IFDI 4A3FG 4OONA 1VQHA 1YHAA 3EBEA 3T1HL 4LFAQ 1N36Q 1SN8A 3PCOB 4LUVA 1UWVA 3D31A 4AR5A 2XJQA 1VQLA 4KHPQ 3UDXA 1B2OA 4B3TQ 3PO3H 4WJ4A 4NB3A 3PUXA 2K75A 1OWBA 2I5LX 4AIMA 1XNRL 3NEMA 4R4QA 1HR0W 2BA1A 3F2DA 3CCMA 2A6ED 3PWFA 2IY5B 4JI5L 5GADc 2V1CC 5JJIA 3P8BA 4GKKL 3DM3A 4BBSG 3PIO1 5C3EH 2HT1A 5IWAL 3S2HH 4B3RL 4IFDJ 2XJSA 1OWCA 3A74A 1IU6A 1IBLL 2ASBA 2HHHQ 3LGJA 2E2JH 2VW9A 5ELNA 4DAMA 4U671 4IOAA 5ELOA 2BH2A 2YV5A 4GNXA 4X64Q 2UUCQ 4C2MH 4DV3Q 1YJNA 2EXDA 4DV1L 3K0XA 1WCMH 4BY7G 1H7VA 1RDGA 4A93G 4JG2A 4P74A 4MTNA 1QVCA 1B8AA 3HKZG 1K0RA 2K2DA 1TWHH 3J7ZC 2XGTA 3CD6A 4AR6A 4DV6Q 2XJRA 2LXKA 1LM0A 2CWAA 4YHHQ 2QL0A 1A62A 1VQGA 4BBSH 1MJEA 3WWLA 4YWMA 1FHMA 3I4NH 4B3SL 1PFSA 2PI2E 4UY8C 3MEFA 5LMUQ 4DV4L 1C09A 1HNZQ 2YTXA 2UUAL 1IBKQ 4GNXB 4JI8L 3E9IA 2WAQG 5IP9H 2AYJA 2D0OA 4DUZQ 5FLXc 1G291 4R1JA 3HOYG 4LF9L 1NXEA 1JB7A 5AI2A 1YUZA 1Y1VG 2HR5A 3J80i 5AJ3L 1J5EQ 1NNQA 2UXCQ 1JE5A 3MPSA 4LF6L 3U58A 3D0FA 1HJPA 3AFQA 2NVTH 2M6PA 4DR4L 3CCJA 3GTPH 5HGQA 1S24A 3FP9A 1VQ7A 2ERJA 1EIYB 1L1OA 1FL0A 2OTJA 1W3SA 1HZBA 5BR8Q 5GROA 1EYGA 4DR7Q 4JBMA 4AYBG 5M3FH 4J15A 1Z9FA 1AH9A 3CAMA 4JOIA 5GAHC 2GVAA 1WYDA 4LUZA 4LWCA 1VS0A 4NXNL 3HKZE 3M3YH 1TWGH 4B3ML 2YU9H 3I55A 2B63G 4LFCQ 3QQCE 1N34L 1C7YA 3DLLA 3UDFA 3LPEB 3U4ZA 3CPFA 3AEVA 4P75A 2Z6KC 3GD7A 2NVQH 1YJ9A 2K4KA 2KENA 1IBML 2JK8A 3PGZA 2WAQE 1VQNA 2BH8A 5H1SE 3A44A 4BA2I 1KC8C 1PH5A 3KYXA 4A75A 4DV5Q 3S2DH 4K0KL 2PMZE 1PH4A 4DK3C 4DNIA 3PSIA 1CSPA 1Q86C 1WJJA 1LYLA 4A4IA 2NVXH 2OWOA 3S1NH 1VQ9A 3HOXH 3K7UC 5LMNQ 4PZ8A 2XJPA 4UP9A 5C0XI 4JV5Q 3A5UA 2YYZA 1L2FA 4XIGS 3J81i 1VZGA 1N32L 2A68D 4GKJQ 3KYUA 4AYBE 4AI3A 4X66Q 1NMFA 4C3JH 3K35A 3CMEA 3CQZH 1BKBA 3KF8B 2E2HH 3OTOQ 2M6OA 1Y1WG 2RDVA 4A3IH 4KLKA 1RDVA 4HIMA 4JI0Q 4YWLA 2JA8G 2R92G 5IYDH 4G6BA 3CCSA 2DSXA 1TXYA 3JC66 5IP7H 1JMCA 3BZKA 4JI4L 1GM5A 6RXNA 4YY3L 1RWDA 4A76A 1BBWA 3K81C 1V9PA 4POGA 2Y0SG 2F4VQ 3S1RH 2MO0A 2A19A 2PQAA 5IE8A 3H3VH 5GAEC 3J81j 5C0XJ 4JI3L 4OWXB 1VCIA 2WB1G 4GLXA 3W1GA 2V3BB 3RZOH 3AFPA 3GTGH 1QCVA 4OO1I 1X9NA 1UE7A 3ER0A 3PKIA 4ZN3B 3CC2A 1JT8A 4AQYQ 2VY3A 5M3MG 2UXDQ 3KJPA 2JA7G 1K83H 3PO2G 3G48A 4OWWB 1YUXA 1BFYA 1DGSA 3KYWA 1GVPA 4ME3A 4LF7Q 2NN6I 3FHWA 1U0LA 3BJUA 1YNXA 1XNQQ 1WJVA 4DV2Q 3I4OA 1OXXK 1K8GA 3KYHC 1VQPA 1Y14B 2PQAB 3TEHB 1XMQL 3KF6A 1SLJA 1R0GA 3CCLA 3WWVA 1N33Q 4A3JG 4DR6Q 2YTVA 4ALPA 4L5SA 1SROA 4JI1L 1Q46A 5EINC 1MIUA 1YK4A 2N78A 1XJVA 5FLMH 3ULPA 2YTYA 1PHJA 2NZHA 2N3SA 1YBYA 4YCUA 3JAMi 1XPRA 1SMMA 1VZIA 3KOJA 1PA6A 4GNXC 3PO3G 4R4OA 1X3EA 4DV7Q 1MJCA 1T9HA 5M3MH 2XJUA 2UU9L 4JAEA 5GQOA 3KYVA 5K2ME 1I94Q 1VQ5A 5JJLA 2CKAA 1YITA 1PH7A 4TVAB 4JI2Q 1I6HH 4X62Q 2ZM6Q 4IO9A 4HJ5A 2NZOA 3M4OH 5C3EG 3MSUA 4A3KH 4A3LH 2RF4A 5FJ8H 2ATWA 1RYTA 3PF5A 3GTJH 5EIOC 3A0JA 1KXLA 1C0AA 2K14A 4LFBL 1B13A 2KHJA 3CP0A 4NXMQ 5E7NA 4H02A 2BE5D 2A6HD 2AKWB 1RIPA 3ULLA 1JYBA 1HH2P 3HFZB 1LKMA 1KAWA 3KDFA 2MO1A 3STBC 1WCMG 3I7FA 3H15A 1HNXQ 4JI6L 2JJQA 1QYBA 1QUQA 3T1YL 1Q7YC 1K3RA 3OW2A 1L0WA 5RXNA 2XJVA 4DV6L 1CADA 3CF5A 2C35B 2FXQA 1S3OA 4A3CG 2UXBQ 1AE2A 3GTOH 4HIDA 3I4NG 4DR1Q 4JAFA 4JOIC 2KCTA 5LMUL 1E1TA 4BY1G 5IP9G 3KDFB 1V1QA 1R9TH 4JAGA 1X54A 1MKHA 1ASYA 4RMFA 3PKJA 2NYDA 2KCMA 5GAGC 3T1HQ 4QQBX 1QUQB 5GAEc 1TWCH 5LMNW 1Q1EA 5DLQE 1R0JA 2ZJPA 2IX0A 2AHOB 4L5QA 2ID0A 1R0HA 4DV0L 2D62A 1N9WA 1XNRQ 1B70B 2L0ZA 3HOWG 2K50A 1T9PA 2H5XA 3ZJYC 5DM71 2R93H 3U4VA 2JI2A 1VQFA 1VQKA 3B0AB 4A3CH 4AR3A 1VQMA 1G6PA 4JI5Q 1N8RC 3G4SA 1VQ6A 4DR7L 2RHQB 5M3FG 1LTLA 1UE1A 4A3DH 1JJCB 4L5TA 4DPGA 5M5YH 3BU2A 3F2BA 1EQQA 4GKKQ 2GVBA 4BY1H 2QEXA 1OXSC 3GO5A 4A3BH 5IWAQ 4B3RQ 2N49A 1Q12A 4OWTB 3TREA 1IBLQ 4P72A 1JJ2A 1HR0L 3GTLH 2IHEA 5MLC3 1UE5A 2ES2A 1YIJA 2E5LL 4AI1A 4AR4A 4DV1Q 1C9OA 3S17H 1E1OA 1BQ9A 1SFOH 3HOWH 1WFQA 4Y7NH 2LSSA 2H12A 1VQEA 1A8VA 4DR2L 4HJAA 3B6YA 4RXNA 3J80c 1NXGA 4LF4L 2B5ID 4AHYA 1LKOA 4LF5L 4MNOA 4JCVE 3SS2A 1FGUA 3M85A 3JC63 4KI0A 3HOXG 4B3SQ 3I4MH 3RN5A 4P71A 4DV4Q 4TPUA 2KBNA 3HOUH 2UUAQ 3PUYA 1B2JA 3UE0A 2R7ZH 8RXNA 1EOVA 2I5HA 4LF9Q 1L1OB 4JBWA 2Q2TA 5AJ3Q 3NENA 4GN4B 3UE1A 3J7A5 4DR5L 3CCVA 4X6AH 1K73C 4LHLA 3E9HA 4TVMA 4DR4Q 4A3IG 2AWOA 2C6AA 2KKDA 5IYDG 3S24A 3H0GG 2JA9A 3RLNA 5IP7G 1KQSA 2XTIA 1XTDA 3RLFA 4A3EH 2CFMA 1KIXA 4DUYL 3PUZA 4JI7L 1T9OA 5MFZA 2OCEA 2ERSA 2JI1A 1PV4A 1SMXA 4UPAA 1S2ZA 4NXNQ 1FJGL 1K8AC 1Z47A 2Q2UA 1CKOA 4BXXG 4FDBA 3NBHB 4DR3L 4A3MH 4B3MQ 2VQFL 4OXPA 4IPDA 1A0IA 1N34Q 2EIFA 2NVYH 4A3GH 4GLVB 5IY0A 4QIWE 3CC7A 2VQEL 1X55A 3HOZG 1S40A 4AHWA 1E3PA 4UP7A 2L15A 4X65L 1HNWL 5GADC 2Q2IA 3H0GH 1IBMQ 4IPCA 1VZHA 1KHIA 1KL9A 3J81c 3ICEA 3ULJA 4HJ8A 4LF8L 4OX9L 5JEAG 2R7FA 4K0KQ 1YZ6A 2UUBL 3RNUA 4BBRH 3GTMH 3L7ZC 2PYAA 2KN9A 5FLMG 1XMOL 1ASZA 4BXXH 1E7ZA 1PVOA 1DVBA 2PVXA 1OXVA 3G6EA 3K7AH 1GD7A 1YHBA 5IT9c 3L0OA 3ERSX 3RN2A 2VUMH 3HOZH 1HZ9A 1N32Q 1YEZA 4UP8A 4JYAL 3UDIA 5C4XH 4L5RC 3RZ6A 2WP8J 2ZTEA 1JJGA 4XGHA 5IYCH 1YI2A 4A3LG 3U50C 4A3KG 5FJ8G 3MXNB 1IROA 4QGUA 2V0FA 2Z3RB 3NELA 3S14H 2DUDA 4JI4Q 2E8GA 3F1ZA 4LFAL 5GAHc 1N36L 2HIVA 4XXBB 3PUVA 4B8CD 4GN5A 3GTQH 1P16A 4KHPL 3UDGA 3S16H 1A63A 2OQ0A 4B3TL 4JI3Q 2O5JD 1VQCA 1CAAA 1BVSA 4AHXA 1I3QH 3CCRA 2BA0A 3S1MH 3M4PA 2Y0SE 4XTCS 1RB9A 4K9FA 3FKIG 4E6YA 4GOPA 3KF6B 2ZIXA 1HZCA 2F3IA 4YCVA 2ZJRA 4GLAC 2WB1E 1NTGA 3CW2C 2VNUD 4O2DA 3JAMc 1D7QA 3Q8DA 4GS7D 4JBJA 4APVA 2JEAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH6 A;  3A5Z B;  2LXJ A;  3HOW G;  2K50 A;  4P75 A;  3RZD H;  1T9P A;  2Z6K C;  1PH2 A;  2H5X A;  5AI3 A;  3GD7 A;  3ZJY C;  1X65 A;  1XMQ Q;  2VL6 A;  2NVQ H;  2R93 H;  3U4V A;  1YJ9 A;  5JEA J;  1FJG Q;  4C3I H;  1VQF A;  1VQK A;  2HHH L;  2K4K A;  1SR3 A;  1BQ8 A;  1OXT A;  2K5V A;  4AR3 A;  1VQM A;  2KEN A;  2DGY A;  4DV7 L;  3TS2 A;  4JI5 Q;  1G6P A;  3GDE A;  3G4S A;  3CCU A;  2GMG A;  1CKM A;  2AWN A;  4HIK A;  4DR3 Q;  2JK8 A;  2VQF Q;  1IBM L;  1VQ6 A;  3PGZ A;  1P8L A;  2RHQ B;  4DR7 L;  2WAQ E;  5M3F G;  2N8N A;  1LTL A;  1UE1 A;  5EAY A;  4A3D H;  1JJC B;  4L5T A;  4DPG A;  5M5Y H;  1IYJ B;  3BU2 A;  2Z6K A;  4GN3 B;  3F2B A;  1EQQ A;  2HQL A;  4IJL A;  1I94 L;  1VQN A;  4GKK Q;  2BH8 A;  2D0P A;  4JI1 Q;  2GVB A;  5H1S E;  3CCQ A;  3A44 A;  4X64 L;  4BA2 I;  3S15 H;  2UUC L;  1KC8 C;  4BY1 H;  5HY6 A;  2QEX A;  1PH5 A;  1E8J A;  3HKS A;  1OXS C;  3GO5 A;  3KYX A;  3RYG A;  3K80 C;  2VQE Q;  4DV3 L;  4A3B H;  4P73 A;  5IWA Q;  1H95 A;  4JI2 L;  4GOP B;  2JA6 H;  4A75 A;  1YV1 A;  1VQI A;  4B3R Q;  4DV5 Q;  1T9Q A;  1R0I A;  3M9B A;  1QVF A;  4X62 L;  2JE6 I;  2N49 A;  1O7I A;  1TWF H;  2ALY B;  1YVC A;  4LUO A;  1BE7 A;  1E24 A;  2CQO A;  4C3H H;  4X65 Q;  2PMZ E;  2ZM6 L;  1PH4 A;  2E2I H;  3QVD A;  2I0Q A;  1HNW Q;  1Q12 A;  4DK3 C;  4POF A;  4DNI A;  1NY4 A;  4OWT B;  3TRE A;  3FKI H;  4DKA C;  1DX8 A;  1Y1W H;  3PSI A;  1IBL Q;  4R4I A;  1CSP A;  2RHS B;  2JEA I;  1Q86 C;  1XPO A;  1WJJ A;  2QGQ A;  4P72 A;  1VQA A;  1JJ2 A;  1HR0 L;  4BA1 I;  2JA8 H;  1Q81 C;  1LYL A;  4A4I A;  2NVX H;  2R92 H;  1YHQ A;  2OWO A;  3S1N H;  3GTL H;  2IHE A;  1VQ9 A;  2Q2H A;  1XPU A;  1VQ8 A;  1L1O C;  2UU9 Q;  3HOX H;  3K7U C;  5J3B A;  5LMN Q;  1UE5 A;  2ES2 A;  3F2C A;  4LW1 A;  4IFD G;  4OO1 G;  1VQJ A;  2R93 G;  4PZ8 A;  4O0A A;  4YHH L;  2F52 A;  4YY3 Q;  2QA4 A;  1YIJ A;  3RZT A;  2E5L L;  2MQH A;  4AR4 A;  4UP9 A;  5C0X I;  4LF8 Q;  4JV5 Q;  4TQU S;  3A5U A;  3HOV G;  3M7N A;  4DV1 Q;  2YYZ A;  5C4J H;  5C44 G;  1L2F A;  2VS1 A;  3K8A A;  1C9O A;  2ZTD A;  4OX9 Q;  3S17 H;  4XIG S;  3J81 i;  4NXM L;  2A1A A;  4A3D G;  1N32 L;  2UUB Q;  1E1O A;  4NPS A;  4QY7 A;  1D8L A;  1BQ9 A;  4GKJ Q;  1SFO H;  3KYU A;  4QL5 A;  3HOW H;  1PYB A;  2R7D A;  4AYB E;  4X66 Q;  1YK5 A;  1WFQ A;  3I2Z A;  3W5O A;  1NMF A;  4Y7N H;  1HNZ L;  4C3J H;  1IBK L;  2ZJQ A;  2LSS A;  1VQE A;  3CME A;  1XMO Q;  1A8V A;  4A3B G;  1QZG A;  4DR2 L;  4HJA A;  2JA6 G;  3CQZ H;  1BKB A;  2NN6 G;  1K9M C;  3B6Y A;  2LCQ A;  4RXN A;  3TRZ A;  3KF8 B;  4PZ6 A;  3J80 c;  1SRU A;  2MNA A;  1EUJ A;  4DUZ L;  1EFW A;  4LF4 L;  2E2H H;  1LKO A;  4LF5 L;  1HNX L;  3OTO Q;  2RCN A;  1KRS A;  1X3G A;  1W2B A;  3CC4 A;  3BZC A;  2IHF A;  3E0E A;  4MNO A;  1QZH A;  1Y1W G;  1WI5 A;  4JCV E;  2RDV A;  4A3F H;  1IXR A;  3SS2 A;  1V43 A;  1UEB A;  2K52 A;  4KLK A;  1RDV A;  4A3I H;  1QVG A;  1J5E L;  5JJK A;  4HIM A;  4JI0 Q;  3F8T A;  4LFB Q;  4HJ9 A;  1FGU A;  4YWL A;  3PIP A;  2JA8 G;  1Q8K A;  2R92 G;  2UXC L;  5IYD H;  3M85 A;  3JC6 3;  1X56 A;  4KI0 A;  3HOX G;  2JA7 H;  3CCS A;  2DSX A;  1G51 A;  1TXY A;  3JC6 6;  4B3S Q;  5IP7 H;  3I4M H;  1JMC A;  3PO2 H;  3BZK A;  3RN5 A;  1B71 A;  2MFI A;  4P71 A;  3PF4 A;  4DV4 Q;  4JI4 L;  1BBU A;  4TPU A;  2KBN A;  1J6Q A;  1GM5 A;  2UUA Q;  3HOU H;  2B3G A;  2M4Y A;  3PUY A;  6RXN A;  4YY3 L;  4JYA Q;  1RWD A;  4A76 A;  3CXC A;  2UXB L;  1U5K A;  1GO3 E;  3CPW A;  1BBW A;  3K81 C;  1V9P A;  1B2J A;  2K5H A;  2MS3 A;  3UE0 A;  4POG A;  2R7Z H;  8RXN A;  1B7Y B;  2K5N A;  2Y0S G;  4MZ9 A;  1KD1 C;  4JI6 Q;  3S1R H;  2MO0 A;  2F4V Q;  1EOV A;  3TQY A;  2I5H A;  4DR1 L;  2A19 A;  2PQA A;  3KYY A;  4LF9 Q;  1L1O B;  5IE8 A;  3H3V H;  2OTL A;  2CCZ A;  4JBW A;  5GAE C;  2Q2T A;  4WJ3 M;  1IZ6 A;  5AJ3 Q;  1M1K C;  5BR8 L;  3NEN A;  4GN4 B;  3J81 j;  3EIV A;  5C0X J;  3PIO A;  4QJF A;  3T1Y Q;  1PYS B;  4JI3 L;  1R0F A;  1LUZ A;  4OWX B;  3UE1 A;  3J7A 5;  4YWK A;  3HOV H;  1NE3 A;  4DAY B;  1VCI A;  2WB1 G;  3CCE A;  4DR5 L;  3W1G A;  5C44 H;  2V3B B;  3CCV A;  4GLX A;  3GTK H;  3RZO H;  2IY5 B;  2PI2 A;  4B3R L;  1S72 A;  3AFP A;  2I5M X;  1K73 C;  3GTG H;  4X6A H;  4A3J H;  1QCV A;  3E9H A;  4IFD I;  4OO1 I;  4Y52 H;  1X9N A;  1FVI A;  1M90 C;  4DR4 Q;  4A3F G;  4A3I G;  1UE7 A;  2AWO A;  4OON A;  3ER0 A;  2KKD A;  1VQH A;  3EN2 A;  3M4Q A;  1YHA A;  3EBE A;  4PZ7 A;  3CC2 A;  3T1H L;  4LFA Q;  5IYD G;  4AQY Q;  1JT8 A;  2VY3 A;  3S24 A;  1N36 Q;  3H0G G;  1CKN A;  5M3M G;  3KFU A;  2UXD Q;  1SMW A;  2JA9 A;  1EWI A;  1SN8 A;  3PCO B;  4LUV A;  3KJP A;  2A8V A;  3RLN A;  1K83 H;  1VQB A;  2JA7 G;  2ZTC A;  1UWV A;  5IP7 G;  1KQS A;  3I4M G;  2XTI A;  3PO2 G;  3G48 A;  1XTD A;  3D31 A;  3RLF A;  4A3E H;  4AR5 A;  4OWW B;  1VQL A;  3HOU G;  2CFM A;  4KHP Q;  3UDX A;  1YUX A;  4LFC L;  4DUY L;  1B2O A;  1X3F A;  1BFY A;  1DGS A;  3KYW A;  2KHI A;  1GVP A;  4B3T Q;  3PUZ A;  4JI7 L;  4ME3 A;  3PO3 H;  1T9O A;  4LF7 Q;  2NN6 I;  3FHW A;  1U0L A;  3BJU A;  4WJ4 A;  1YNX A;  4NB3 A;  4A93 G;  2R7Z G;  1XNQ Q;  2OCE A;  3PUX A;  2K75 A;  4DV2 Q;  3I4O A;  2OQK A;  1OXX K;  2I5L X;  1S30 A;  4AIM A;  1XNR L;  3NEM A;  1K8G A;  4R4Q A;  3RR5 A;  3PV0 A;  3KYH C;  1VQP A;  1HR0 W;  1Y14 B;  1PV4 A;  2BA1 A;  2PQA B;  4EQ5 A;  1AE3 A;  1SMX A;  4UPA A;  3TEH B;  1XMQ L;  3KF6 A;  1SLJ A;  1R0G A;  1S2Z A;  4NXN Q;  1EIF A;  1FJG L;  3F2D A;  3CCM A;  1Z47 A;  1K8A C;  3S2D H;  1TWA H;  2Q2U A;  1CKO A;  3CCL A;  3PWF A;  1ZRP A;  4JI5 L;  4FDB A;  3WWV A;  1N33 Q;  4BXX G;  2WFW A;  3NBH B;  4DR3 L;  4A3M H;  4B3M Q;  2VQF L;  4A3J G;  4BY7 H;  2V1C C;  4A93 H;  4DR6 Q;  4OXP A;  4IPD A;  2YTV A;  5JJI A;  3RLO A;  1A0I A;  4ALP A;  1UE6 A;  2B29 A;  1N34 Q;  2EIF A;  4IOC A;  2NVY H;  4GKK L;  4A3G H;  4GLV B;  4R4T A;  1SRO A;  4JI1 L;  4L5S A;  1Q46 A;  3DM3 A;  5IY0 A;  1SMU A;  4QIW E;  1MIU A;  3CC7 A;  4BBS G;  1YK4 A;  4EX5 A;  2N78 A;  2VQE L;  4DV0 Q;  5FLM H;  5C3E H;  1XJV A;  1X55 A;  2HT1 A;  5IWA L;  2YTY A;  3ULP A;  1PHJ A;  3HOZ G;  3S2H H;  2NZH A;  5K36 G;  1S40 A;  1CKN B;  1CSQ A;  1E3P A;  4RG1 A;  2N3S A;  1YBY A;  4UP7 A;  2L15 A;  4YCU A;  3JAM i;  4DV5 L;  1CUK A;  3KLW A;  4A3E G;  1PH8 A;  4X65 L;  1XPR A;  1HNW L;  3A74 A;  4AH6 A;  1PH1 A;  1IL2 A;  1SMM A;  3KOJ A;  1PA6 A;  1IU6 A;  4GNX C;  1IBL L;  3PO3 G;  2ASB A;  4PMW A;  5GAD C;  2Q2I A;  1RL2 A;  2HHH Q;  4R4O A;  2JA5 G;  1X3E A;  1VQO A;  4DV7 Q;  1MJC A;  1IRN A;  3H0G H;  1T9H A;  5M3M H;  3LGJ A;  1IBM Q;  2E2J H;  4IPC A;  2VW9 A;  4DK6 C;  2UU9 L;  1VCX A;  2PVE A;  5GQO A;  1KIX A;  5ELN A;  4DAM A;  3KYV A;  1KHI A;  1KL9 A;  1I94 Q;  1VQ5 A;  4IOA A;  5ELO A;  5LMN L;  2BH2 A;  5JJL A;  2YV5 A;  4GNX A;  3J81 c;  4X64 Q;  4JI8 Q;  3ICE A;  4IFD J;  1VQD A;  3ULJ A;  1YIT A;  1OTC A;  2UUC Q;  2EQS A;  4C2M H;  3IRB A;  4HJ8 A;  4DV3 Q;  1YJN A;  1PH7 A;  2EXD A;  5M5W H;  4TVA B;  4JI2 Q;  4LF8 L;  4GS3 A;  4JV5 L;  1I6H H;  4A3M G;  4DV1 L;  1N8R C;  3K0X A;  1WCM H;  4OX9 L;  4X62 Q;  1H7V A;  1RDG A;  4KHZ A;  5JEA G;  4YCW A;  2ZM6 Q;  1Q82 C;  2R7F A;  4JG2 A;  4P74 A;  4K0K Q;  1YZ6 A;  2UUB L;  4MTN A;  3W1B A;  2HIX A;  4IO9 A;  1GKH A;  4GKJ L;  3RNU A;  3JC6 2;  3HOY H;  4A3G G;  4BBR H;  3GTM H;  3L7Z C;  4X66 L;  1YJW A;  1QVC A;  2NZO A;  2PYA A;  4HJ5 A;  3M4O H;  1B8A A;  1Y1V H;  3HKZ G;  1K0R A;  1HR0 Q;  2K2D A;  2KN9 A;  4IPH A;  4LF6 Q;  1TWH H;  1WOC A;  5FLM G;  5C3E G;  4A3K H;  1XMO L;  4A3L H;  2RF4 A;  5FJ8 H;  1ASZ A;  4BXX H;  1E7Z A;  1RYT A;  2ATW A;  1PVO A;  3PZA A;  1DVB A;  1EQR A;  3PUW A;  2XGT A;  3J7Z C;  3PF5 A;  3CD6 A;  3H3V I;  4AR6 A;  2PVX A;  3GTJ H;  1OXV A;  4DV6 Q;  5M5X H;  3OTO L;  2LXK A;  3A0J A;  3G6E A;  3K7A H;  1LM0 A;  1GD7 A;  2CWA A;  4YHH Q;  1KXL A;  1X6O A;  1YHB A;  5IT9 c;  2K14 A;  2E5L Q;  1C0A A;  2QL0 A;  1A62 A;  4JI0 L;  4LFB L;  3L0O A;  1B13 A;  2KHJ A;  3ERS X;  1VQG A;  1HZA A;  4BBS H;  3RN2 A;  1NBW A;  1MJE A;  2VUM H;  3CP0 A;  3HOZ H;  4NXM Q;  5E7N A;  1HZ9 A;  4H02 A;  1N32 Q;  4YWM A;  1FHM A;  2AKW B;  4B3S L;  3I4N H;  1PFS A;  2PI2 E;  2PNH A;  1RIP A;  1YEZ A;  3ULL A;  1JYB A;  4UY8 C;  1HH2 P;  3HFZ B;  3MEF A;  5LMU Q;  4UP8 A;  1LKM A;  4DV4 L;  1C09 A;  1KAW A;  3I56 A;  3CMA A;  1HNZ Q;  3KDF A;  2YTX A;  2MO1 A;  1IBK Q;  2IT1 A;  2UUA L;  1E22 A;  1NMG A;  4JI8 L;  4GNX B;  3E9I A;  1LKP A;  2JA5 H;  2JQO A;  3STB C;  4DR2 Q;  4JYA L;  3OYY A;  2WAQ G;  5IP9 H;  4K0K L;  1WCM G;  5IYB G;  2D0O A;  3I7F A;  3UDI A;  5C4X H;  1PH3 A;  4LF4 Q;  3RZ6 A;  4DUZ Q;  5FLX c;  4L5R C;  1G29 1;  2WP8 J;  2R6G A;  4R1J A;  3H15 A;  2ZTE A;  4HJ7 A;  1HNX Q;  4JI6 L;  4LF5 Q;  2F4V L;  3HOY G;  4LF9 L;  7RXN A;  2JEB I;  3KJO A;  1JJG A;  4BBR G;  1JB7 A;  5IYC H;  2JJQ A;  1QYB A;  1YI2 A;  5AI2 A;  1YUZ A;  1Y1V G;  2HR5 A;  3J80 i;  5AJ3 L;  4IJH A;  1J5E Q;  1QUQ A;  2Z0S A;  4R4C A;  4A3L G;  3U50 C;  4A3K G;  3T1Y L;  1NNQ A;  1Q7Y C;  5FJ8 G;  1JE5 A;  2UXC Q;  3MPS A;  4LF6 L;  3MXN B;  1IRO A;  4QGU A;  3U58 A;  3D0F A;  4PG3 A;  1HJP A;  2IX1 A;  3TS0 A;  1K3R A;  3OW2 A;  3AFQ A;  1L0W A;  5RXN A;  2CWP A;  1VQ4 A;  3NEL A;  4DV6 L;  3S14 H;  2DUD A;  2NVT H;  1CAD A;  3S1Q H;  4JI4 Q;  4DR4 L;  3CCJ A;  2CKZ B;  2E8G A;  2B63 H;  3GTP H;  5HGQ A;  3CF5 A;  4JBK A;  1FHH A;  2C35 B;  2FXQ A;  3F1Z A;  1S24 A;  1S3O A;  4A3C G;  2UXB Q;  4AQY L;  4LFA L;  2VUM G;  3FP9 A;  1N36 L;  1AE2 A;  3GTO H;  2UXD L;  3AQQ A;  2HIV A;  1VQ7 A;  4HID A;  3PUV A;  3I4N G;  1EIY B;  4DR1 Q;  1L1O A;  1FL0 A;  1IU5 A;  4GN5 A;  2OTJ A;  1Q1B A;  1KRT A;  3GTQ H;  4JOI C;  1P16 A;  1W3S A;  1HZB A;  2KCT A;  5BR8 Q;  4IPG A;  4KHP L;  3UDG A;  1I5F A;  5GRO A;  1EYG A;  5LMU L;  3S16 H;  1A63 A;  2OQ0 A;  4B3T L;  1E1T A;  4BY1 G;  4JI3 Q;  1VQC A;  4LF7 L;  5IP9 G;  1CAA A;  3KDF B;  4GOP C;  1BVS A;  1I3Q H;  4DR7 Q;  5C4X G;  1V1Q A;  4DR5 Q;  3CCR A;  1R9T H;  1XNQ L;  1X54 A;  2BA0 A;  3S1M H;  4DV2 L;  1MKH A;  1ASY A;  4JBM A;  4RMF A;  4AYB G;  5M3F H;  3M4P A;  4J15 A;  3STB D;  1Z9F A;  2Y0S E;  1AH9 A;  4XTC S;  1PH9 A;  3CAM A;  1RB9 A;  4JOI A;  5IYC G;  5GAH C;  4K9F A;  2GVA A;  3FKI G;  3VDY A;  1WYD A;  3AYH B;  4LNQ A;  2KCM A;  5GAG C;  4LUZ A;  4LWC A;  3T1H Q;  4JC0 A;  4QQB X;  1VS0 A;  4BY7 G;  4NXN L;  4GOP A;  2GN5 A;  3KF6 B;  1QUQ B;  1SE8 A;  1HZC A;  2F3I A;  1NJI C;  3HKZ E;  3M3Y H;  5C0X G;  4YCV A;  3SGI A;  5IYB H;  2ZJR A;  1N33 L;  1TWG H;  1TWC H;  5LMN W;  1Q1E A;  4GLA C;  2WB1 E;  4B3M L;  1BRF A;  2YU9 H;  3I55 A;  1NTG A;  4DR6 L;  5DLQ E;  1OXU A;  3CW2 C;  1R0J A;  2ZJP A;  2VNU D;  2IX0 A;  2AHO B;  2B63 G;  4O2D A;  4LFC Q;  4DUY Q;  1N34 L;  1C7Y A;  4L5Q A;  1I50 H;  3JAM c;  4JI7 Q;  4A3C H;  1D7Q A;  2ID0 A;  3Q8D A;  1R0H A;  2AMC B;  3DLL A;  4DV0 L;  3UDF A;  4JBJ A;  4HIO A;  2D62 A;  1N9W A;  3U4Z A;  3CPF A;  2VZA A;  3L2P A;  1XNR Q;  4APV A;  1B70 B;  3G71 A;  3AEV A; 
#chains in the Genus database with same CATH topology
 3A5Z B;  2LXJ A;  2SEB D;  5AI3 A;  1XMQ Q;  4KJN A;  2A68 C;  1XX8 A;  5EJW A;  4C3I H;  4N9P A;  2HHH L;  1SR3 A;  3OW7 A;  2QEJ C;  3GDE A;  3J7Y 1;  4HIK A;  1CKM A;  2AWN A;  1P8L A;  3GV3 A;  3GTO B;  1BCP B;  5C4J B;  5EAY A;  4OIJ A;  2JA6 L;  4IJL A;  2EY1 A;  4H0L C;  2Z4I A;  1TWF L;  2D0P A;  4JI1 Q;  4C3H L;  2XWB B;  3CCQ A;  2E2I L;  1AEX A;  4X64 L;  3S15 H;  2UUC L;  3K80 C;  1CHQ D;  2OT2 A;  4DV3 L;  3FKI L;  1H95 A;  2RSN A;  4GOP B;  2JA6 H;  1YV1 A;  1VQI A;  2NN6 H;  2EY2 A;  2JE6 I;  1O7I A;  1TWF H;  2EYO A;  3K57 A;  1KD1 C;  4C3H H;  2CQO A;  5CV8 A;  3TME A;  2E2I H;  3QVD A;  4ZAI A;  4NP5 A;  1STE A;  4POF A;  1NY4 A;  5IGD A;  3FKI H;  1DX8 A;  1LT6 D;  4K5V A;  2V0E A;  5AN9 H;  1ILQ A;  1XPO A;  3Q22 A;  1Q81 C;  1EOT A;  1YHQ A;  3PIP 1;  2HCC A;  5MGN A;  1L1O C;  2UU9 Q;  2AUS B;  2Z3Q B;  4WRD A;  5C4J L;  2M00 A;  5J3B A;  1S4Z A;  4IFD G;  2R93 G;  3LWQ B;  5JAV A;  4KY7 A;  2KOL A;  4O0A A;  2F52 A;  1C48 A;  4YHH L;  1PZK D;  4TQU S;  3HOV G;  3M7N A;  5C4J H;  2NWG A;  2HQE A;  3BS1 A;  1WTX A;  2A1A A;  4A3D G;  4EQO A;  2A69 D;  1SAP A;  4NPS A;  4QY7 A;  1D8L A;  4KJO A;  3TP8 A;  3MHB A;  4QL5 A;  3A54 A;  1PYB A;  2R7D A;  5G3L F;  3B08 B;  3I2Z A;  1KTK A;  1M4V A;  4B08 A;  2DY7 A;  1HNZ L;  4DAY A;  1IBK L;  5BN3 A;  2R93 B;  4A3B G;  1QZG A;  4A3F L;  4WFN 1;  1LT5 D;  3TRZ A;  1ENC A;  2A5H A;  4PZ6 A;  1PRT B;  1SRU A;  1WTH A;  2MNA A;  4DUZ L;  3HOV B;  2RCN A;  1KRS A;  1W2B A;  3BZC A;  2IHF A;  4A3D B;  1R4Q B;  1AZP A;  1QZH A;  1HFG A;  1MBY A;  2NBF A;  1CQF A;  1WI5 A;  5M5Y B;  4A3F H;  1QVG A;  1IXR A;  3D8G A;  1J5E L;  5JJK A;  4LFB Q;  4HJ9 A;  3VR5 A;  3PIP A;  2JSO A;  1KNA A;  2IPK D;  3P75 A;  2UXC L;  1X56 A;  4DNR B;  4A3B B;  3NK9 A;  1G51 A;  1RYQ A;  2BDN A;  1IHZ A;  1EY5 A;  1B71 A;  2XJT A;  4MIU A;  1EY7 A;  2PZT A;  4X3K A;  1BBU A;  4PV1 C;  2B3G A;  5JVH 1;  2M4Y A;  3V2T A;  1GO3 E;  3CPW A;  2K5N A;  3TP7 A;  4JI6 Q;  3GTL B;  2Z9H A;  3HOV L;  1ODH A;  3H3V C;  3W3A A;  4WJ3 M;  1IZ6 A;  4IFD H;  4KKT A;  5BR8 L;  3NUC A;  1CM9 A;  3PIO A;  3GQB A;  1ONL A;  4Y52 L;  3P2A A;  3T1Y Q;  1STG A;  1LUZ A;  3ERO A;  4HCE A;  4YWK A;  1NE3 A;  4DAY B;  3HOV H;  2EOT A;  1VDZ A;  3LNL A;  1TWA B;  1S72 A;  3S17 B;  2I5M X;  3N52 A;  2ZXO A;  2QW7 A;  4Y52 H;  1Z92 B;  1FVI A;  1M90 C;  4K6D A;  1SFO B;  2E75 C;  1HTL D;  3EN2 A;  3M4Q A;  2F3V A;  4PZ7 A;  4Y7N B;  2K5W A;  2B2Y C;  3QR8 A;  3KFU A;  1CKN A;  4LHN A;  1SMW A;  1ZYR D;  1EWI A;  2A8V A;  1D5X C;  1VQB A;  2ZTC A;  4MTK A;  3I4M G;  3P7J A;  1GUO A;  2FIN B;  3HOU G;  4LFC L;  1X3F A;  2KHI A;  3H94 A;  1JC7 A;  4DK1 A;  2C6B A;  3SEB A;  4J8Q A;  2R7Z G;  1QNK A;  2OQK A;  1ZEQ X;  1S30 A;  3MFG A;  1TWA L;  3PV0 A;  3RR5 A;  2KEC A;  4CDD C;  3I4M B;  4IUV A;  4XYQ A;  3HKZ P;  4EQ5 A;  4BY7 L;  1JCK B;  4A93 L;  1AE3 A;  3NWS A;  1FR3 A;  3HOU B;  1EIF A;  2CR8 A;  1TWA H;  4DFA A;  1ZRP A;  3M4Y A;  2WFW A;  2E2D C;  2JXM B;  1LTS D;  4FF4 A;  4BY7 H;  2R7Z B;  4ZCK A;  4ZK9 B;  4A93 H;  3RLO A;  3SK4 A;  1PRT D;  1UE6 A;  4RWS C;  4UDU C;  4AHZ A;  2B29 A;  4IOC A;  3CHB D;  4AI0 A;  4R4T A;  4QUF A;  5FOB B;  1SMU A;  4EX5 A;  1STY A;  4DV0 Q;  1I4G A;  3NHH A;  5K36 G;  1RTO A;  4HR7 B;  1CKN B;  1CSQ A;  4RG1 A;  4DV5 L;  4A3E G;  4KHV A;  1PH8 A;  1CUK A;  3KLW A;  2PMZ B;  4DU9 A;  1TVX A;  2KJX A;  1C8C A;  4AH6 A;  1QJO A;  1PH1 A;  1IL2 A;  4LMQ D;  4ZN1 B;  1PTO F;  1D5Z C;  5J1Z A;  4PMW A;  2WAQ P;  4CDE C;  1RL2 A;  2JA5 G;  2A6H C;  1VQO A;  5JVG 1;  1IRN A;  5H1S c;  1Q3L A;  2LFN A;  3IU3 I;  2A73 B;  1J9O A;  2RDF A;  4DK6 C;  1VCX A;  2PVE A;  5M5W L;  3J7Z 1;  4LAA A;  3D3R A;  4A3E B;  2R7Z L;  1KLG D;  5LMN L;  4BS9 A;  3BYY B;  1SNC A;  4HN7 A;  4JI8 Q;  1VQD A;  2CH4 A;  2X69 A;  1OTC A;  2B8F A;  2EQS A;  5ISR A;  3IRB A;  3HOY L;  5M5W H;  4JV5 L;  4GS3 A;  4A3M G;  2DN8 A;  4OL7 A;  2KCC A;  1IW7 D;  4KHZ A;  1Q82 C;  4YCW A;  4KD3 A;  5ELF A;  1STN A;  1TKW B;  2NB0 A;  3W1B A;  2HIX A;  1GKH A;  3F2U A;  4GKJ L;  3JC6 2;  3HOY H;  4A3G G;  5CV6 A;  4X66 L;  1B9M A;  1YJW A;  1EL0 A;  1TY0 A;  4UY8 1;  1Y1V H;  5BN5 A;  1HR0 Q;  4IPH A;  3NXW A;  4LF6 Q;  1WOC A;  4DGZ A;  3PZA A;  1EQR A;  3PUW A;  3H3V I;  2EYJ A;  4A3M B;  1F2M A;  4J1M A;  3KUP A;  5M5X H;  4B9W A;  3OTO L;  2HVY C;  1BF4 A;  1GJX A;  3I91 A;  1B1Z A;  1X6O A;  2E5L Q;  4A3G B;  4JI0 L;  2PW5 A;  3J80 E;  2A69 C;  1HZA A;  1NBW A;  4AYB P;  2BCO A;  5K36 H;  2JA5 L;  2K1B A;  2PNH A;  4QIW P;  3KBG A;  1I4R A;  2MP1 A;  1P7P A;  3I56 A;  2EJF C;  3CMA A;  2L4N A;  1SDF A;  3AB9 A;  2IT1 A;  1E22 A;  1NMG A;  1A6X A;  1LKP A;  2HDM A;  2I46 A;  2JQO A;  4PQX A;  3U9O A;  4DR2 Q;  2JA5 H;  3OYY A;  1VMP A;  5IYB G;  4NW2 A;  1PH3 A;  4LF4 Q;  1A3U A;  4ME5 A;  2R6G A;  4HJ7 A;  4LF5 Q;  2F4V L;  1PLF A;  7RXN A;  2JEB I;  3VA7 A;  3KJO A;  4BBR G;  4IJH A;  2Z0S A;  3VR4 A;  3K5M A;  4R4C A;  3S1Q L;  3J7A V;  2K32 A;  2ZXP A;  2B63 L;  4IUR A;  4A3G L;  5EPK A;  2NYZ D;  4PG3 A;  2IX1 A;  1LAC A;  1QIL A;  5DM6 1;  5KGU A;  3TS0 A;  2IJ0 A;  3J7A F;  4C1N K;  2CWP A;  2V4D A;  1VQ4 A;  2PPT A;  1Q90 A;  3S1Q H;  3BVZ A;  3FVQ A;  2CKZ B;  2B63 H;  4JBK A;  3EJI A;  1FHH A;  4BBR B;  3GTM B;  1RTN A;  3G6J B;  3T13 A;  4MHE A;  4AQY L;  1PXU A;  2VUM G;  1E0B A;  2UXD L;  1BCP C;  3AQQ A;  1Y8O B;  1BDO A;  5GAG c;  4CDF C;  5MFP A;  1IU5 A;  3NTI A;  3HS0 C;  1Q1B A;  3VYS A;  3KBX A;  5D3D A;  1KRT A;  2F1M A;  4IPG A;  2J7Z A;  1I5F A;  3ERQ A;  4AI2 A;  4LF7 L;  4GOP C;  5C4X G;  4DR5 Q;  1XNQ L;  1XTC D;  2VUM B;  4DV2 L;  1O80 A;  1NNX A;  2M4V A;  3STB D;  1PH9 A;  1SND A;  5IYC G;  5IYB L;  5A2Q E;  2JI3 A;  3VDY A;  3AYH B;  1HCZ A;  4LNQ A;  2E76 C;  3ZG6 A;  4JC0 A;  2KQ3 A;  1K8M A;  2GN5 A;  1SE8 A;  1NJI C;  3GTM L;  2LY7 A;  5C0X G;  3SGI A;  5IYB H;  1N33 L;  1I50 L;  1F9Q A;  3BDO A;  4I7A A;  5C4X B;  1BRF A;  4DR6 L;  1OXU A;  2CQA A;  4XXE A;  2HUG A;  1V1O A;  4DUY Q;  3I3C A;  3TDQ A;  1I50 H;  5CYU A;  4JI7 Q;  3VYU A;  1W6J A;  3D6C A;  1EFI D;  1KDB A;  5FO8 B;  3RZD L;  1GUT A;  1SJE D;  2AMC B;  2L5T A;  4HIO A;  2VZA A;  2NTT A;  3L2P A;  3G71 A;  4K6L A;  4ZQ3 A;  1PH6 A;  4ABN A;  2X6L A;  5EBC A;  2IWH A;  1SEB D;  3RZD H;  1PH2 A;  3S14 B;  1X65 A;  1G91 A;  2VL6 A;  3PIO 3;  3C3L A;  3WWN B;  1TY2 A;  5JEA J;  1FJG Q;  1D6E C;  5M9O A;  1BQ8 A;  1OXT A;  2K5V A;  3TS2 A;  2DGY A;  4DV7 L;  3MXU A;  2GMG A;  3CCU A;  4DR3 Q;  2VQF Q;  1S5E D;  4EVO A;  4FNF A;  3FRP B;  2N8N A;  3NSW A;  1LO5 D;  5C4Z A;  4I65 A;  5C4X L;  1IYJ B;  1EEF D;  1QWY A;  1XWE A;  2Z6K A;  4GN3 B;  2Q8T A;  4V19 6;  2HQL A;  1CZW A;  3BG3 A;  1E2W A;  5IT9 L;  1I94 L;  2WV6 D;  4OEL B;  3GTQ B;  1FGB D;  3QO2 A;  5HY6 A;  1E8J A;  3HKS A;  1EY8 A;  3RYG A;  2VQE Q;  4P73 A;  4JI2 L;  1UNS A;  1CZG A;  1T9Q A;  1R0I A;  3M9B A;  1QVF A;  4X62 L;  4LUO A;  1EY0 A;  2ALY B;  1CHP D;  1YVC A;  4U67 3;  1BE7 A;  1E24 A;  4X65 Q;  2ZM6 L;  3J81 E;  2I0Q A;  2JA8 L;  1HNW Q;  2R92 L;  3FDT A;  1PTO H;  3VYR A;  4DKA C;  3D4W A;  1Y1W H;  1F4L A;  2RHS B;  4R4I A;  3OOC A;  4DK0 A;  2QGQ A;  1VQA A;  4K8J A;  4BA1 I;  2JA8 H;  1ESF A;  2Y0S P;  2R92 H;  1STA A;  3NFP I;  4LK1 C;  3FMC A;  2Q2H A;  1XPU A;  4DAV A;  1VQ8 A;  2L1B A;  1GUN A;  4S3S A;  1OO9 B;  4X3T A;  3LWV B;  3F2C A;  4LW1 A;  2CKC A;  4OO1 G;  1VQJ A;  1K8O A;  3BDC A;  2QA4 A;  4YY3 Q;  1IW7 C;  3RZT A;  3OMC A;  2MQH A;  3R2I A;  2WB1 P;  3VPB E;  4LF8 Q;  4WJW A;  2EY6 A;  4RHR A;  4JVZ A;  3IL8 A;  5C44 G;  2VS1 A;  3K8A A;  4OX9 Q;  2ZTD A;  4NXM L;  2UUB Q;  1SYG A;  1AFP A;  3K58 A;  5DM7 3;  1QE6 A;  1YK5 A;  3W5O A;  1T5X D;  2PYK A;  3EQL C;  2K01 A;  3X3N A;  4EQP A;  2ZJQ A;  1XMO Q;  1KLU D;  2XIW A;  1WTO A;  5I2X A;  2JA6 G;  2NN6 G;  1K9M C;  4RCN A;  2LCQ A;  1GUW A;  2EPB A;  4C3H G;  1EUJ A;  1EFW A;  5CV5 A;  2CHB D;  1HNX L;  5HGT A;  1X3G A;  3LNN A;  3CC4 A;  3E0E A;  2DJF C;  2JA7 L;  2K52 A;  1V43 A;  1UEB A;  4KK7 A;  3AU7 A;  3PO2 L;  2DNE A;  1LAB A;  3F8T A;  1QCB D;  1Q8K A;  1PTO D;  3S15 B;  4RA8 A;  2EXZ A;  3K5O A;  3E3X A;  3MA2 B;  2EYM A;  2JA7 H;  2JA6 B;  4XT3 B;  4XQN A;  3PO2 H;  4C1N I;  3M7G A;  4C3H B;  4JAD A;  2MFI A;  2E2I B;  3PF4 A;  2EZV A;  3OWE B;  3BVG A;  1J6Q A;  4DNT B;  1PYW D;  4JYA Q;  2KEE A;  1I4Q A;  2UXB L;  3MFY A;  3CXC A;  1U5K A;  2K5H A;  2MS3 A;  2JP1 A;  1B7Y B;  4MZ9 A;  3H9C A;  5J39 A;  2EJM A;  3TQY A;  4DR1 L;  1QOH A;  3G7L A;  5CGK A;  3KYY A;  1U4M A;  3QJY A;  5MF6 A;  5C44 L;  2OTL A;  3GTK L;  2CCZ A;  1KAA A;  4OO1 H;  4IUT A;  3JAM L;  1M1K C;  3EIV A;  4A3J L;  4QJF A;  1PYS B;  1R0F A;  3S9W A;  4RKL A;  2J9U B;  3CCE A;  5C44 H;  3GTK H;  1JR0 D;  3S15 L;  3DUZ A;  2PI2 A;  2PSM C;  4GZY C;  4RAU C;  3HP3 A;  4A3J H;  2IW3 A;  4IFD I;  2L55 A;  3V05 A;  3E5S A;  4A3F G;  2JYO A;  4OON A;  2B2W C;  1VQH A;  1YHA A;  3EBE A;  3T1H L;  4LFA Q;  4PMB A;  1N36 Q;  2C9O A;  1SN8 A;  3PCO B;  4LUV A;  1EYA A;  1UWV A;  3D31 A;  4HCS A;  4KY6 A;  4AR5 A;  2MUY A;  2XJQ A;  4IUP A;  1VQL A;  4KHP Q;  3UDX A;  1B2O A;  4B3T Q;  1IYU A;  4A3F B;  1R4P B;  3PO3 H;  3J7Y W;  4WJ4 A;  4NB3 A;  2RQX A;  3PUX A;  2K75 A;  1OWB A;  3HEJ A;  2I5L X;  4AIM A;  1XNR L;  3NEM A;  4R4Q A;  3JAM E;  4JPB W;  4RH6 A;  1HR0 W;  2BA1 A;  4HTH A;  2F03 A;  4V19 0;  1B3A A;  4HSV A;  4ZKB B;  1PFN A;  5I9P A;  3F2D A;  2EYP A;  3MAQ A;  2A6E D;  3CCM A;  3PWF A;  2IY5 B;  4JI5 L;  2EDG A;  3TZU A;  5ELD A;  1Q8I A;  1HUM A;  5GAD c;  1PZI D;  2V1C C;  5JJI A;  5C3E L;  3P8B A;  5CC4 A;  3S2H L;  1QNU A;  1L0X B;  3Q23 A;  4GKK L;  3DM3 A;  1H9K A;  1JWS D;  2Z6B A;  3VYT A;  4BBS G;  4QUC A;  3PIO 1;  5C3E H;  2HT1 A;  5IWA L;  2BDO A;  3S2H H;  1GXD C;  4B3R L;  4IFD J;  2WKD A;  1TT2 A;  1WTQ A;  3PL5 A;  2XJS A;  3DHQ A;  4R8N A;  1OWC A;  3I90 A;  2E2J L;  3A74 A;  1O7Y A;  1IU6 A;  1IBL L;  2ASB A;  4CHT B;  2HHH Q;  2QIL A;  2MHV A;  5E1F A;  3LGJ A;  2OEO A;  2E2J H;  4BBS B;  2VW9 A;  1CI3 M;  3C1E A;  4N8X 1;  4F7X A;  3SHL A;  2B2T A;  3OMG A;  1QB5 D;  5ELN A;  1AN8 A;  4DAM A;  2C5C A;  1B2T A;  4U67 1;  4IOA A;  5ELO A;  2XNA C;  2BH2 A;  2YV5 A;  4GNX A;  1SJH D;  3K0Y A;  4X64 Q;  2UUC Q;  3H99 A;  4G57 A;  4C2M H;  4DV3 Q;  1YJN A;  5JOB A;  1ENA A;  2EXD A;  4DV1 L;  1QG7 A;  3K0X A;  1WCM H;  4BY7 G;  1H7V A;  1RDG A;  3ND9 A;  4A93 G;  4JG2 A;  4P74 A;  1RDP D;  1TWH L;  3WOE A;  2PPB C;  4MTN A;  3U9S A;  4L6T B;  4DF7 A;  1EY6 A;  1QVC A;  1H9R A;  1B8A A;  4P2C B;  2DNC A;  3HKZ G;  1K0R A;  2K2D A;  1B3Q A;  1TWH H;  3SK5 A;  1PMR A;  1RD9 D;  4QCL A;  1JQY D;  3J7Z C;  2XGT A;  2D5D A;  1EQV A;  3CD6 A;  4AR6 A;  3IKJ A;  1EWH A;  3P20 A;  1UEA B;  4BBS L;  4OEM B;  4DV6 Q;  2XJR A;  3TN2 A;  4A93 B;  4BY7 B;  3PQI A;  2LXK A;  1I4H A;  1LM0 A;  2CWA A;  2RCF A;  4YHH Q;  3I4N L;  2QL0 A;  2J4X A;  1A62 A;  2B39 A;  2K6A A;  1JE4 A;  1RJT A;  1VQG A;  4BBS H;  1MJE A;  3HKZ B;  1Y8P B;  3WWL A;  2L11 A;  4XYO A;  3DWP A;  1RHP A;  5CV9 A;  1WD0 A;  4YWM A;  1FHM A;  4ULL A;  4B3S L;  3I4N H;  2O5J C;  4JW0 A;  1PFS A;  5IP9 L;  2PI2 E;  4I7Z C;  1NAP A;  4UY8 C;  3QOJ A;  3TP5 A;  3MEF A;  5LMU Q;  4DV4 L;  1C09 A;  1EU3 A;  2F0J A;  2H4O A;  1HNZ Q;  2YTX A;  2UUA L;  1IBK Q;  1Y69 U;  1FYC A;  2L9H A;  1DOL A;  2RDG A;  4JI8 L;  3E9I A;  5F2D A;  4GNX B;  1ZXT A;  4KV6 A;  2WAQ G;  5IP9 H;  2AYJ A;  2D0O A;  5KYL A;  5IGE A;  4DUZ Q;  5FLX c;  1ILP A;  1G29 1;  4R1J A;  1Z6H A;  1ET6 A;  3E0J A;  2SNS A;  3NBI A;  3HOY G;  4JK1 C;  4LF9 L;  1NXE A;  2F0W A;  1JB7 A;  4X3U A;  1CK1 A;  1HQR D;  3QWN A;  3Q24 A;  5AI2 A;  1YUZ A;  1Y1V G;  2HR5 A;  3J80 i;  5AJ3 L;  1J5E Q;  1TII D;  1O7Z A;  3X3M A;  3I70 A;  5ELB A;  1NNQ A;  2UXC Q;  1JE5 A;  3MPS A;  1SYB A;  4LF6 L;  3U58 A;  5M5W B;  3D0F A;  1HJP A;  4CKB A;  5FLX L;  1MSH A;  2WAQ B;  2ICI A;  2Q8I B;  3AFQ A;  3IFT A;  2NVT H;  1X3Q A;  4RGT A;  2M6P A;  2F0E A;  4DR4 L;  3CCJ A;  3GTP H;  1FNV A;  5HGQ A;  3HOY B;  1H9M A;  1GHK A;  4CBV A;  1S24 A;  2F0K A;  1Y1V B;  4CJ0 B;  3L9A X;  3FP9 A;  4KKS A;  5IGC A;  1VQ7 A;  2ERJ A;  4CDC C;  1EIY B;  1L1O A;  1FL0 A;  1A3V A;  2OTJ A;  3FEW X;  4ZRZ A;  3OHX C;  1PZX A;  5M5X B;  1W3S A;  1HZB A;  1SE2 A;  5BR8 Q;  5GRO A;  2DY8 A;  4QMG A;  1EYG A;  5M3F L;  2EYF A;  2CH4 W;  4KY5 A;  4DR7 Q;  3ONA B;  3SXH A;  3H3V M;  2KED A;  4JBM A;  1F9R A;  4AYB G;  5M3F H;  4J15 A;  1Z9F A;  1AH9 A;  2TMP A;  3M3Y L;  3CAM A;  4JOI A;  5GAH C;  1SYE A;  2GVA A;  1HA5 A;  1WYD A;  2F3W A;  3A55 A;  4IAL A;  2YU9 L;  4LUZ A;  4LWC A;  1VS0 A;  3O13 A;  4NXN L;  1LTI D;  1V1P A;  2G9H D;  2JA5 B;  3HKZ E;  3M3Y H;  1H9S A;  1Y1V L;  5LL6 S;  1TWG H;  1DON A;  4RKB A;  4IUQ A;  4B3M L;  2YU9 H;  3I55 A;  4TRD A;  1WVL A;  3S2D B;  2B63 G;  4AYB B;  4LFC Q;  3QQC E;  2RSO A;  1N34 L;  1NCV A;  3ITP A;  1C7Y A;  5M5X L;  1I4P A;  4QIW B;  1JIC A;  3DLL A;  3UDF A;  3LPE B;  2NVQ L;  4QB4 A;  3U4Z A;  3CPF A;  2NVX B;  2HCI A;  3AEV A;  3OWF A;  2OF1 A;  4P75 A;  2Z6K C;  3S1Q B;  3GD7 A;  5ELE A;  3Q6S A;  2FJ2 A;  2NVQ H;  2B63 B;  2XRQ D;  4C3J G;  1YJ9 A;  2KVM A;  1SYC A;  1TS2 A;  2WIN B;  2K4K A;  3CRK C;  4KTA A;  1JWM D;  2KEN A;  1KNE A;  1IBM L;  2F0T A;  2JK8 A;  3A7L A;  3PGZ A;  2WAQ E;  3T4A C;  3SVM A;  2F0F A;  2MGS A;  3V96 A;  3S2D L;  1VQN A;  1HRJ A;  1RKN A;  2BH8 A;  5H1S E;  4F88 A;  2LKV A;  3A44 A;  2EVB A;  4BA2 I;  2EYH A;  2K7V A;  1KC8 C;  5COY A;  1PH5 A;  3KYX A;  4C3J B;  3KF8 A;  1JWU D;  4A75 A;  2PZU A;  4DV5 Q;  1VF7 A;  3S2D H;  1V1P B;  2WKC A;  4XQJ A;  2KUM A;  1H9S B;  5KYI A;  4K0K L;  2PMZ E;  1PH4 A;  1C4Q A;  3T53 B;  2NVX L;  2TSS A;  4H7B A;  4DK3 C;  4DNI A;  1T5E A;  2JEA I;  1SE3 A;  3PSI A;  5D65 A;  1CSP A;  3HOX L;  4L63 B;  1Q86 C;  1PFM A;  1SMY D;  1WJJ A;  2B2Y A;  1LYL A;  1YNN D;  4A4I A;  1BQQ T;  2NVX H;  1SNQ A;  2OWO A;  1F9S A;  3S1N H;  1WTW A;  2F0Q A;  1VQ9 A;  1HPC A;  3HOX H;  1D1K A;  2ICE C;  3K7U C;  2G9D A;  5NUC A;  4FVM A;  5LMN Q;  3TBI B;  2APO B;  4PZ8 A;  2XJP A;  2EY4 E;  1BUV T;  4C56 C;  4UP9 A;  1I50 B;  4RCO A;  5C0X I;  2PCF B;  4JV5 Q;  1EY4 A;  3A5U A;  2YYZ A;  1L2F A;  3T56 B;  4FF3 A;  4XIG S;  3J81 i;  2F0H A;  4C3J L;  1VZG A;  1N32 L;  2A68 D;  1STB A;  3CQZ L;  3HJW B;  3KK7 A;  5TSS A;  3KYU A;  4KMU C;  5L37 A;  4GKJ Q;  4AYB E;  4AI3 A;  1JOQ A;  4X66 Q;  1NMF A;  1U4L A;  3RZD B;  1HQM C;  4ZUJ A;  1DJR D;  4N9T A;  5C6A A;  4C3J H;  1BBX C;  4FF1 A;  3K35 A;  3CME A;  3CQZ H;  1BKB A;  4A3I L;  3MEH A;  1GHJ A;  2F0N A;  3KF8 B;  3W2D A;  4N8F A;  1EYD A;  4CKE A;  4PMC A;  3VR3 A;  2E2H H;  3OTO Q;  5IYD L;  4YIJ A;  2K5Q A;  2ZT9 C;  2M6O A;  5HUR A;  1Y1W G;  1ZYR C;  2RDV A;  1PFB A;  4A3I H;  4KLK A;  1RDV A;  5IP7 L;  1FNU A;  4HIM A;  4JI0 Q;  3MTS A;  4YWL A;  1E2Z A;  2JA8 G;  2RBM A;  1XYI A;  2R92 G;  5IYD H;  4G6B A;  3I72 A;  2F0P A;  1W6K A;  5C4H A;  3CCS A;  2DSX A;  1TXY A;  3JC6 6;  5IP7 H;  1JMC A;  5C5M A;  3BZK A;  1SYD A;  1K28 A;  1PTO B;  3DEP A;  4JI4 L;  1M8A A;  3S1R L;  1GM5 A;  1Y1W B;  6RXN A;  4YY3 L;  1RWD A;  4A76 A;  1BBW A;  3K81 C;  3K59 A;  4KKU A;  1V9P A;  2JA8 B;  3I4L A;  4POG A;  4G7Z C;  2B8G A;  2R92 B;  2Y0S G;  2F4V Q;  1BCP F;  2MO0 A;  3S1R H;  2A19 A;  4FO2 A;  2PQA A;  5IE8 A;  3H3V H;  5GAE C;  3J81 j;  3GTG L;  5C0X J;  4JI3 L;  3MWY W;  3DM1 A;  2HDL A;  4OWX B;  1EIG A;  5EQ0 A;  1SE4 A;  1PRT C;  2M9V A;  1VCI A;  2WB1 G;  2FFK B;  4GLX A;  3ND8 A;  3W1G A;  2V3B B;  2EY5 A;  1AZQ A;  3RZO H;  3VA5 A;  3AFP A;  3GTG H;  5EKL A;  4FXG C;  2NZ1 D;  4H44 C;  1QCV A;  4OO1 I;  2Y0S B;  1X9N A;  2XRS D;  1UE7 A;  5EPL A;  3ER0 A;  3PKI A;  4ZN3 B;  4BWG B;  3CC2 A;  1E2V A;  4HSP A;  4AQY Q;  1JT8 A;  2VY3 A;  4DN4 M;  5DNF A;  5M3M G;  1Y1W L;  2UXD Q;  3KJP A;  1LV9 A;  1EYC A;  1K83 H;  2JA7 G;  5CV4 A;  3R2T A;  3EVQ A;  5CBE E;  3PO2 G;  3G48 A;  2WB1 B;  4V0B A;  4OWW B;  3D4R A;  1EZ8 A;  3NTH A;  1B9N A;  1YUX A;  2AQC A;  3SK8 A;  1BFY A;  1DGS A;  3KYW A;  1GVP A;  1U4P A;  3DEO A;  1EIH A;  4ME3 A;  4LF7 Q;  2NN6 I;  4M8A A;  3FHW A;  1U0L A;  3BJU A;  1YNX A;  4KD4 A;  1XNQ Q;  3HZX A;  1WJV A;  3WDN A;  3Q0A A;  4DV2 Q;  3I4O A;  1OXX K;  3TP6 A;  1K8G A;  2JA7 B;  4CKC A;  3KYH C;  1VQP A;  3PO2 B;  1Y14 B;  2PQA B;  2F0M A;  3MVV A;  1WTV A;  1F9P A;  3TEH B;  3HG9 A;  1XMQ L;  3KF6 A;  1SLJ A;  1R0G A;  2F0D A;  4XDX A;  2F0L A;  4CJ2 C;  1LTA D;  4KN4 C;  1UAP A;  1SXT A;  3CCL A;  3WWV A;  1N33 Q;  1ZKO A;  1I6H B;  4A3J G;  5JEA H;  4DR6 Q;  1ICF B;  5IT9 E;  2YTV A;  4RFB A;  1O78 A;  4X3S A;  5FLM L;  3LWR B;  4ALP A;  3SK6 A;  4L5S A;  5EBD A;  1SRO A;  4JI1 L;  2PO4 A;  1Q46 A;  5EIN C;  1MIU A;  1EZ6 A;  3M4O B;  1HHV A;  1YK4 A;  2N78 A;  4XQQ A;  1XJV A;  5FLM H;  3ULP A;  4C2M 1;  2YTY A;  1PHJ A;  2NZH A;  2DJG C;  1YBY A;  2N3S A;  4YCU A;  3JAM i;  5C44 B;  3GTK B;  1JOK A;  3DWA A;  1XPR A;  2B2T C;  5M3M L;  4A3J B;  1PFY A;  1LTG D;  1SMM A;  1VZI A;  3KOJ A;  1PA6 A;  4GNX C;  3PO3 G;  4R4O A;  1ML0 D;  1X3E A;  5LL6 X;  4DV7 Q;  3MC0 B;  1MJC A;  1T9H A;  5M3M H;  3C2P A;  1VMC A;  5I4D A;  1TR5 A;  4HMI A;  2XJU A;  1YNJ D;  2D2C C;  3A8J E;  2UU9 L;  4JAE A;  5GQO A;  3SR1 A;  3QIA A;  1I6H L;  2M2L A;  4F87 A;  4DXG A;  1K0S A;  3KYV A;  5K2M E;  1I94 Q;  1VQ5 A;  5JJL A;  2SDF A;  2K28 A;  2CKA A;  5KEE A;  1EEI D;  1B44 D;  5ELC A;  1YIT A;  4FXK C;  5CV7 A;  2RDH A;  2D9U A;  3I73 A;  1PH7 A;  3PO3 B;  4TVA B;  4JI2 Q;  1JOR A;  1I6H H;  5IGB A;  4NKL A;  3M4O L;  3OIQ A;  5EGT A;  4X62 Q;  5EKI A;  1B53 A;  2ZM6 Q;  5C3X A;  2H1E A;  4A3L L;  5FK9 C;  2F0U A;  5FJ8 L;  1SMY C;  4IO9 A;  3CU7 A;  2MPM A;  4HJ5 A;  2NZO A;  1BXT A;  3M4O H;  2F4I A;  3GTJ L;  2N88 A;  5C3E G;  3MSU A;  4A3K H;  4A3L H;  5DAU A;  1J8I A;  2RF4 A;  5FJ8 H;  4E6I A;  2ATW A;  1RYT A;  3T51 B;  3PF5 A;  5IOC A;  3GTJ H;  3LWO B;  5EIO C;  1HFN A;  2F0O A;  3A0J A;  1DYQ A;  3NQI A;  2SNM A;  1KXL A;  1C0A A;  2K5D A;  1B4O A;  2K14 A;  2X6G A;  4LFB L;  1B13 A;  2K04 A;  2KHJ A;  1ET9 A;  1SNM A;  1II3 A;  1CTM A;  3CP0 A;  1CQV A;  4NXM Q;  5E7N A;  4J6H A;  3PO3 L;  5C3E B;  4H02 A;  5T1I A;  4Q5V A;  2BE5 D;  3S2H B;  3BDL A;  3D6W A;  4K2K A;  2A6H D;  2AKW B;  1RIP A;  3ULL A;  1JYB A;  1HH2 P;  3HFZ B;  1SNO A;  1LKM A;  1SYF A;  3H09 A;  1KAW A;  3KDF A;  3RUZ A;  2MO1 A;  3VR2 A;  5JVG 3;  2XSC A;  3STB C;  1X3P A;  3HRZ C;  1WCM G;  1L0Y B;  3I7F A;  4FYD A;  2E2J B;  1R9T B;  3H15 A;  1HNX Q;  1CA6 A;  3R3O A;  4JI6 L;  5CMD A;  2F0G A;  4ZLT F;  4IQZ A;  5IOD A;  2JJQ A;  1A2U A;  1PZJ D;  1QYB A;  4ZUI A;  2J0T D;  2O2L D;  1QUQ A;  5JJZ A;  3T1Y L;  1HTP A;  1Q7Y C;  5I6Y A;  2Z1C A;  4C2M B;  3CKI B;  4FF2 A;  1K3R A;  2KA7 A;  1IL8 A;  1WCM B;  1EQT A;  2QDB A;  3E6Z X;  1TWC B;  3OW2 A;  1L0W A;  5RXN A;  1HXY D;  5BN4 A;  2XJV A;  4DV6 L;  3GTO L;  1CAD A;  3CF5 A;  1XXG A;  2C35 B;  2FXQ A;  1D5M C;  1S3O A;  4A3C G;  2UXB Q;  4TKO B;  1LTT D;  3IAY A;  1TWH B;  1AE2 A;  3GTO H;  1ENF A;  4UAI A;  5KRU A;  1F2Y A;  4IUN A;  4HID A;  3VR6 A;  3H9B A;  4K5W A;  3I4N G;  4DR1 Q;  1MI2 A;  4ZKC B;  3QG1 A;  3LWU A;  4JAF A;  2RA4 A;  2F0S A;  4ZYS A;  1R9T L;  2XWJ B;  4JOI C;  4M1U B;  2KCT A;  2B2V A;  5LMU L;  1X32 A;  1E1T A;  4BY1 G;  5IP9 G;  4Z9C B;  3KDF B;  1V1Q A;  2VXW A;  3MZ5 A;  1R9T H;  4JAG A;  1X54 A;  4IUU A;  1MKH A;  1ASY A;  1RF2 D;  4RMF A;  5C3W A;  1LT4 D;  3I4N B;  1O7L A;  1WCM L;  1TWC L;  3PKJ A;  2NYD A;  2KCM A;  5GAG C;  3T1H Q;  4QQB X;  1BNZ A;  1QUQ B;  2G5D A;  5FKA C;  4BY1 B;  2GA4 B;  5GAE c;  1S5C D;  1TWC H;  5LMN W;  1IKM A;  1Q1E A;  2AUJ D;  2B2U A;  1BOS A;  5K5P A;  5DLQ E;  1R0J A;  2ZJP A;  5C5L A;  1PDQ A;  2IX0 A;  2AHO B;  1WTR A;  1TS4 A;  4RGM A;  1TU2 B;  5LHY 1;  1G8Z D;  3N6R A;  5JPM C;  4L5Q A;  3H97 A;  5D3I B;  5KIX A;  2ID0 A;  2RVL A;  3LX0 A;  1R0H A;  5DM6 3;  4DV0 L;  2D62 A;  2R93 L;  1N9W A;  2CW0 D;  1XNR Q;  2WII B;  1B70 B;  4HMJ A;  3DXJ C;  4A3C L;  2WAC A;  2L0Z A;  3SE0 A;  3HOW G;  1A2T A;  1DOK A;  2K50 A;  1TS5 A;  1T9P A;  1BCP D;  2H5X A;  2NVT B;  3ZJY C;  5DM7 1;  3GTP B;  5CR3 A;  4A3D L;  2R93 H;  3U4V A;  2EYL A;  4IZ8 A;  2JI2 A;  1VQF A;  1VQK A;  5M5Y L;  1Y8N B;  3NP8 A;  3B0A B;  4A3C H;  2PNR C;  4AR3 A;  1VQM A;  4XT1 B;  1DD2 A;  1G6P A;  4JI5 Q;  1N8R C;  3G4S A;  4MN3 A;  1VQ6 A;  4DR7 L;  2RHQ B;  5M3F G;  2BOS A;  2PZW A;  4BY1 L;  1LTL A;  1UE1 A;  4A3D H;  1JJC B;  3CRL C;  4L5T A;  4DPG A;  5CBA E;  4A3B L;  1A3T A;  1NSN S;  2IX3 A;  3BU2 A;  4R9W A;  5M5Y H;  3F2B A;  1EQQ A;  1DOM A;  3ZYY X;  4GKK Q;  4HAE A;  2GVB A;  5D14 A;  3HOW B;  3HJY B;  4OHJ A;  4BY1 H;  2QEX A;  1OXS C;  1EU4 A;  3GO5 A;  4A3B H;  5IWA Q;  4NMZ A;  4B3R Q;  2N49 A;  1I4X A;  2F0V A;  2KCN A;  1EWC A;  1PTO C;  1Q12 A;  5M3F B;  2CVR A;  3GTL L;  4KN7 C;  2FHT A;  4OWT B;  3TRE A;  1IBL Q;  4R8I A;  3C46 A;  2B2W A;  3EA6 A;  2NVT L;  1YNJ C;  4P72 A;  1JJ2 A;  1HR0 L;  3GTP L;  3GP7 A;  3DWQ A;  2VB2 X;  4IN3 A;  3M3Y B;  3GTL H;  2IHE A;  3LWE A;  1TWG B;  5MLC 3;  1GOZ A;  2YU9 B;  5A35 A;  1UE5 A;  3S17 L;  4K8I A;  2ES2 A;  2XN9 C;  4DXF A;  3OSO A;  1YIJ A;  2E5L L;  4AI1 A;  4AR4 A;  1SFO L;  1GUG A;  1LT3 D;  3HOW L;  4DV1 Q;  4Y7N L;  1C9O A;  3S17 H;  1NUC A;  1ROD A;  3MXG A;  1E1O A;  1BQ9 A;  5EPJ A;  1SFO H;  4NDX A;  3HOW H;  1RCV D;  2HD3 A;  1WFQ A;  3A8I E;  4Y7N H;  5T1G A;  2NVQ B;  2LSS A;  2H12 A;  1VQE A;  1A8V A;  4TSS A;  4DR2 L;  4HJA A;  2QF7 A;  2QCP X;  3B6Y A;  4RXN A;  5IGF A;  1I6V C;  3J80 c;  1NXG A;  4LF4 L;  1MHW C;  2B5I D;  4AHY A;  1LKO A;  4LF5 L;  4MNO A;  1TWG L;  4B9X A;  3AMU A;  4JCV E;  3OPO A;  3SS2 A;  3EFX D;  1NR4 A;  2NUC A;  3I4M L;  3LWP B;  1FGU A;  2BE5 C;  5FLX E;  3QB3 A;  3M85 A;  1KDC A;  3JC6 3;  3A56 A;  3HOU L;  2PQE A;  4KI0 A;  1DZ1 A;  3J80 L;  2QKI C;  3HOX G;  2AUK A;  4B3S Q;  5KNB A;  3I4M H;  1CA5 A;  3RN5 A;  4P71 A;  4Q0F A;  2AQ3 B;  2K05 A;  4DV4 Q;  2LS0 1;  2NTS A;  4TPU A;  2KBN A;  3HOU H;  2UUA Q;  5E3F A;  3PUY A;  4QF4 A;  2PMZ P;  1JOO A;  2L12 A;  1B2J A;  3UE0 A;  2R7Z H;  8RXN A;  3UI2 A;  3C1F A;  3S1N B;  1BR9 A;  1EOV A;  2I5H A;  4LF9 Q;  1L1O B;  3HOX B;  2A6E C;  1S5B D;  2A74 C;  4JBW A;  1ESR A;  5E4X A;  3TSS A;  2Q2T A;  1AW7 A;  5AJ3 Q;  4X6A L;  3NEN A;  4GN4 B;  3RMH A;  2FMM A;  1ICW A;  3D4D A;  3NBH A;  3UE1 A;  3J7A 5;  4G4K A;  4DR5 L;  3CCV A;  3NPP A;  1H9J A;  2AQ1 B;  2K03 A;  2EE1 A;  4X6A H;  1K73 C;  4LHL A;  3E9H A;  4LJZ C;  1U4R A;  4TVM A;  3WOF A;  4DR4 Q;  4A3I G;  2AWO A;  2C6A A;  3BVM A;  3BZD B;  3R8B A;  4CGY B;  2KKD A;  3JR7 A;  1GUS A;  4A3E L;  2NVY B;  5IYD G;  3S24 A;  3H0G G;  2JA9 A;  3RLN A;  3CQZ B;  1LTR D;  2SOB A;  5IP7 G;  1KQS A;  1SNP A;  2XTI A;  3HAX C;  4FXD A;  1XTD A;  2E74 C;  4ILW A;  3RLF A;  4A3E H;  2E2H B;  3S1N L;  3FPU B;  2CFM A;  1LTB D;  1KIX A;  4DUY L;  4O1N A;  2RKS A;  4A3I B;  3PUZ A;  4JI7 L;  1T9O A;  5MFZ A;  3K6O A;  2EJG C;  2OCE A;  1IYV A;  2ERS A;  2JI1 A;  4CJ1 B;  3H0G B;  4UHV A;  5KND A;  1TS3 A;  1PV4 A;  4U68 A;  4A3M L;  4H13 C;  1CT1 D;  1DCZ A;  1SMX A;  4UPA A;  1QQT A;  5A2Q L;  1S2Z A;  4NXN Q;  1FJG L;  3P1H A;  1K8A C;  1Z47 A;  2Q2U A;  1CKO A;  4BXX G;  2NVY L;  3PMF A;  4FDB A;  2Z4H A;  2Z8L A;  3NBH B;  4DR3 L;  4A3M H;  4B3M Q;  4K2L A;  2VQF L;  3GV6 A;  1TQO A;  4FP5 D;  4OXP A;  4IPD A;  2FMC A;  3S1R B;  4EQN A;  1A0I A;  1N34 Q;  2EIF A;  2E2H L;  3OIP A;  2NVY H;  4A3G H;  1B50 A;  1VF5 C;  2CW0 C;  4GLV B;  5DEH A;  5IY0 A;  4QIW E;  3CC7 A;  2PW7 A;  2VQE L;  1X55 A;  3HOZ G;  4RGO S;  1EY9 A;  4AHW A;  1E3P A;  4UP7 A;  1WD1 A;  3K5N A;  1S40 A;  3RZO B;  2L15 A;  3NE5 B;  4X65 L;  2KHS A;  4OGQ C;  3H0G L;  4L8J A;  3GTG B;  1HNW L;  5E4W C;  2R61 A;  4OIK A;  2F0I A;  3K7A B;  5I2Y A;  5GAD C;  2Q2I A;  2L0C A;  1CFM A;  5KNC A;  2RFK B;  5G3L D;  1DXM A;  2QDL A;  1F77 A;  3H0G H;  5J22 A;  5EKK A;  1IBM Q;  4IPC A;  4PNY A;  1NR2 A;  1SBB B;  1VZH A;  1K83 B;  2I07 B;  3HOZ B;  1V8Q A;  4K14 A;  3T16 A;  1KHI A;  1KL9 A;  5AFW A;  3J81 c;  3ICE A;  3ULJ A;  4F8M A;  3PIP 3;  4HJ8 A;  4LF8 L;  4BBR L;  1IKL A;  4OX9 L;  3NWT A;  1D1I A;  5JEA G;  2R7F A;  4K0K Q;  4ODG A;  1YZ6 A;  2UUB L;  3A8K E;  1FNW A;  4O42 A;  3RZO L;  4BXX L;  4EGV A;  3RNU A;  3H6M A;  4BBR H;  3J81 L;  3GTM H;  3L7Z C;  2PYA A;  1Z7T A;  3QOL A;  1PFW A;  3MXN A;  3MXP A;  5FO9 B;  2KN9 A;  5FLM G;  1XMO L;  3K7A L;  4WOR A;  1ASZ A;  4BXX H;  1E7Z A;  1PVO A;  1DVB A;  3R93 A;  4DAP A;  1MGS A;  2PVX A;  1OXV A;  2ZXR A;  2VUM L;  1K83 L;  3HOZ L;  3KLS A;  3G6E A;  3K7A H;  1GD7 A;  2AQ2 B;  1YHB A;  5IT9 c;  3FDJ A;  2JN4 A;  3L0O A;  3ERS X;  4WFN 3;  3RN2 A;  2VUM H;  3S1M B;  3HOZ H;  1HZ9 A;  1N32 Q;  2P5Z X;  4RHS A;  3H91 A;  1F2L A;  3KLS X;  1D2B A;  1YEZ A;  5I9O A;  4UP8 A;  5IIF A;  1U9R A;  2IL8 A;  3S16 B;  4JYA L;  3L3O C;  1F2Z A;  5IYC L;  4G7H C;  3UDI A;  5C4X H;  1I3Q B;  5M3M B;  4L5R C;  3RZ6 A;  2WP8 J;  2ZTE A;  5FO7 B;  1MSG A;  1G6Z A;  1JJG A;  4DA2 A;  2Q8R E;  4XGH A;  3HGB A;  5IYC H;  2ENB A;  5JVH 3;  1YI2 A;  3I8Z A;  4A3L G;  2VB3 X;  2N55 A;  3S14 L;  3U50 C;  4A3K G;  5FJ8 G;  1UUP A;  3MXN B;  1IRO A;  4QGU A;  1DM0 B;  2V0F A;  5I6W A;  2Z3R B;  5C0X H;  1PRT F;  1FD7 D;  3NEL A;  3S14 H;  2DUD A;  5IGG A;  3NQT A;  4JI4 Q;  2E8G A;  1A15 A;  2K33 A;  2B2V C;  4C3I G;  3F1Z A;  1HA6 A;  3GTQ L;  4LFA L;  3SDZ A;  1WTP A;  5GAH c;  1JB3 A;  1N36 L;  3TZD A;  4A3K B;  2HIV A;  4XXB B;  3S16 L;  3RD4 A;  3K5L A;  3PUV A;  4G7O C;  4B8C D;  1KDA A;  4GN5 A;  1I3Q L;  2R3Z A;  5COR A;  3GTJ B;  3GTQ H;  3S1M L;  1P16 A;  4KHP L;  3FPP A;  4HED A;  3UDG A;  3S16 H;  1A63 A;  2OQ0 A;  3A7A B;  4B3T L;  4JI3 Q;  2O5J D;  2LMC B;  1VQC A;  1MD2 D;  1CAA A;  5JPN C;  1BVS A;  4AHX A;  1I3Q H;  4C3I B;  3CCR A;  1LLR D;  2BA0 A;  3S1M H;  1HUN A;  1BO0 A;  1K3B C;  2B2U C;  1KAB A;  3M4P A;  3MQK B;  1AP0 A;  2Y0S E;  4XTC S;  1RB9 A;  4K9F A;  3FKI G;  4ID6 A;  4E6Y A;  1S5D D;  1PFV A;  4RGN A;  4GOP A;  2O5I C;  3KF6 B;  2ZIX A;  1HZC A;  2F3I A;  3NTK A;  4YCV A;  2ZJR A;  3IFD A;  4GLA C;  2WB1 E;  1PFU A;  1G2T A;  1NTG A;  4A3K L;  3CW2 C;  2MJ8 A;  1TWF B;  2VNU D;  1STH A;  2O4X A;  1YNN C;  1SSO A;  3BYT B;  4O2D A;  3JAM c;  1G2S A;  1D7Q A;  3FKI B;  3Q8D A;  3URY A;  4GS7 D;  3DMU A;  4JBJ A;  2OXP A;  4K5X A;  4C3I L;  2XVS A;  3KLR A;  4APV A;  1S5F D; 
#chains in the Genus database with same CATH homology
 3A5Z B;  2LXJ A;  5AI3 A;  1XMQ Q;  4C3I H;  2HHH L;  1SR3 A;  3GDE A;  3J7Y 1;  4HIK A;  1CKM A;  2AWN A;  1P8L A;  5EAY A;  4IJL A;  2D0P A;  4JI1 Q;  3CCQ A;  4X64 L;  3S15 H;  2UUC L;  3K80 C;  4DV3 L;  1H95 A;  4GOP B;  2JA6 H;  1YV1 A;  1VQI A;  2JE6 I;  1O7I A;  1TWF H;  1KD1 C;  4C3H H;  2CQO A;  2E2I H;  3QVD A;  4POF A;  1NY4 A;  3FKI H;  1DX8 A;  2V0E A;  5AN9 H;  1XPO A;  1Q81 C;  1YHQ A;  3PIP 1;  5MGN A;  1L1O C;  2UU9 Q;  2Z3Q B;  5J3B A;  4IFD G;  2R93 G;  4O0A A;  4YHH L;  2F52 A;  4TQU S;  3HOV G;  3M7N A;  5C4J H;  2A1A A;  4A3D G;  2A69 D;  4NPS A;  4QY7 A;  1D8L A;  4QL5 A;  1PYB A;  2R7D A;  3B08 B;  3I2Z A;  1HNZ L;  1IBK L;  4A3B G;  1QZG A;  4WFN 1;  3TRZ A;  4PZ6 A;  2MNA A;  1SRU A;  4DUZ L;  2RCN A;  1KRS A;  1W2B A;  3BZC A;  2IHF A;  1QZH A;  1WI5 A;  4A3F H;  1QVG A;  1IXR A;  1J5E L;  5JJK A;  4LFB Q;  4HJ9 A;  3PIP A;  2UXC L;  1X56 A;  1G51 A;  1RYQ A;  1B71 A;  2XJT A;  1BBU A;  2B3G A;  5JVH 1;  2M4Y A;  1GO3 E;  3CPW A;  2K5N A;  4JI6 Q;  1ODH A;  4WJ3 M;  1IZ6 A;  5BR8 L;  3PIO A;  3P2A A;  3T1Y Q;  1LUZ A;  4YWK A;  3HOV H;  1NE3 A;  4DAY B;  3LNL A;  1S72 A;  2I5M X;  4Y52 H;  1Z92 B;  1FVI A;  1M90 C;  3EN2 A;  3M4Q A;  4PZ7 A;  3KFU A;  1CKN A;  4LHN A;  1SMW A;  2A8V A;  1EWI A;  1VQB A;  2ZTC A;  3I4M G;  3HOU G;  4LFC L;  1X3F A;  2KHI A;  2C6B A;  2R7Z G;  2OQK A;  1S30 A;  3RR5 A;  3PV0 A;  4EQ5 A;  1AE3 A;  1EIF A;  2CR8 A;  1TWA H;  1ZRP A;  2WFW A;  4BY7 H;  4A93 H;  3RLO A;  1UE6 A;  4AHZ A;  2B29 A;  4IOC A;  4AI0 A;  4R4T A;  1SMU A;  4EX5 A;  4DV0 Q;  5K36 G;  1CKN B;  1CSQ A;  4RG1 A;  4DV5 L;  4A3E G;  1PH8 A;  1CUK A;  3KLW A;  4AH6 A;  1PH1 A;  1IL2 A;  4ZN1 B;  4PMW A;  1RL2 A;  2JA5 G;  1VQO A;  5JVG 1;  1IRN A;  5H1S c;  3IU3 I;  4DK6 C;  1VCX A;  2PVE A;  3J7Z 1;  5LMN L;  4JI8 Q;  1VQD A;  1OTC A;  2EQS A;  3IRB A;  5M5W H;  4JV5 L;  4GS3 A;  4A3M G;  1IW7 D;  4KHZ A;  1Q82 C;  4YCW A;  3W1B A;  2HIX A;  1GKH A;  4GKJ L;  3JC6 2;  3HOY H;  4A3G G;  4X66 L;  1YJW A;  4UY8 1;  1Y1V H;  1HR0 Q;  4IPH A;  4LF6 Q;  1WOC A;  3PZA A;  1EQR A;  3PUW A;  3H3V I;  5M5X H;  3OTO L;  1X6O A;  2E5L Q;  4JI0 L;  1HZA A;  1NBW A;  2PNH A;  3I56 A;  3CMA A;  2IT1 A;  1E22 A;  1NMG A;  1LKP A;  2JA5 H;  2JQO A;  4DR2 Q;  3OYY A;  5IYB G;  1PH3 A;  4LF4 Q;  4HJ7 A;  2R6G A;  4LF5 Q;  2F4V L;  7RXN A;  2JEB I;  3KJO A;  4BBR G;  4IJH A;  2Z0S A;  4R4C A;  4PG3 A;  2IX1 A;  5DM6 1;  3TS0 A;  2CWP A;  1VQ4 A;  2PPT A;  3S1Q H;  2CKZ B;  2B63 H;  4JBK A;  1FHH A;  4AQY L;  2VUM G;  2UXD L;  3AQQ A;  5GAG c;  5MFP A;  1IU5 A;  1Q1B A;  1KRT A;  4IPG A;  1I5F A;  4AI2 A;  4LF7 L;  4GOP C;  5C4X G;  4DR5 Q;  1XNQ L;  4DV2 L;  2M4V A;  3STB D;  1PH9 A;  5IYC G;  2JI3 A;  3VDY A;  3AYH B;  4LNQ A;  3ZG6 A;  4JC0 A;  2GN5 A;  1SE8 A;  1NJI C;  5C0X G;  3SGI A;  5IYB H;  1N33 L;  1BRF A;  4DR6 L;  1OXU A;  4DUY Q;  1I50 H;  4JI7 Q;  2AMC B;  4HIO A;  2VZA A;  3L2P A;  3G71 A;  1PH6 A;  3RZD H;  1PH2 A;  1X65 A;  2VL6 A;  3WWN B;  5JEA J;  1FJG Q;  1BQ8 A;  1OXT A;  2K5V A;  3TS2 A;  2DGY A;  4DV7 L;  3CCU A;  2GMG A;  4DR3 Q;  2VQF Q;  2N8N A;  1IYJ B;  2Z6K A;  4GN3 B;  4V19 6;  2HQL A;  1I94 L;  5HY6 A;  1E8J A;  3HKS A;  2VQE Q;  3RYG A;  4P73 A;  4JI2 L;  1T9Q A;  1R0I A;  3M9B A;  1QVF A;  4X62 L;  4LUO A;  2ALY B;  2ZM6 L;  1YVC A;  1BE7 A;  1E24 A;  4X65 Q;  2I0Q A;  1HNW Q;  4DKA C;  1Y1W H;  4R4I A;  2RHS B;  2QGQ A;  1VQA A;  4BA1 I;  2JA8 H;  2R92 H;  3NFP I;  2Q2H A;  1XPU A;  1VQ8 A;  3F2C A;  4LW1 A;  2CKC A;  4OO1 G;  1VQJ A;  2QA4 A;  4YY3 Q;  3RZT A;  2MQH A;  3VPB E;  4LF8 Q;  5C44 G;  2VS1 A;  3K8A A;  4OX9 Q;  2ZTD A;  4NXM L;  2UUB Q;  1YK5 A;  3W5O A;  2ZJQ A;  1XMO Q;  2JA6 G;  2NN6 G;  1K9M C;  2LCQ A;  1EUJ A;  1EFW A;  1HNX L;  1X3G A;  3CC4 A;  3E0E A;  2K52 A;  1V43 A;  1UEB A;  3F8T A;  1Q8K A;  2JA7 H;  3PO2 H;  4JAD A;  2MFI A;  3PF4 A;  1J6Q A;  4JYA Q;  2UXB L;  3CXC A;  1U5K A;  2K5H A;  2MS3 A;  1B7Y B;  4MZ9 A;  3TQY A;  4DR1 L;  3KYY A;  5MF6 A;  2OTL A;  2CCZ A;  1M1K C;  3EIV A;  4QJF A;  1PYS B;  1R0F A;  2J9U B;  3CCE A;  5C44 H;  3GTK H;  2PI2 A;  2PSM C;  4A3J H;  4IFD I;  4A3F G;  4OON A;  1VQH A;  1YHA A;  3EBE A;  3T1H L;  4LFA Q;  1N36 Q;  1SN8 A;  3PCO B;  4LUV A;  1UWV A;  3D31 A;  4AR5 A;  2XJQ A;  1VQL A;  4KHP Q;  3UDX A;  1B2O A;  4B3T Q;  3PO3 H;  4WJ4 A;  4NB3 A;  3PUX A;  2K75 A;  1OWB A;  2I5L X;  4AIM A;  1XNR L;  3NEM A;  4R4Q A;  1HR0 W;  2BA1 A;  3F2D A;  3CCM A;  2A6E D;  3PWF A;  2IY5 B;  4JI5 L;  5GAD c;  2V1C C;  5JJI A;  3P8B A;  4GKK L;  3DM3 A;  4BBS G;  3PIO 1;  5C3E H;  2HT1 A;  5IWA L;  3S2H H;  4B3R L;  4IFD J;  2XJS A;  1OWC A;  3A74 A;  1IU6 A;  1IBL L;  2ASB A;  2HHH Q;  3LGJ A;  2E2J H;  2VW9 A;  5ELN A;  4DAM A;  4U67 1;  4IOA A;  5ELO A;  2BH2 A;  2YV5 A;  4GNX A;  4X64 Q;  2UUC Q;  4C2M H;  4DV3 Q;  1YJN A;  2EXD A;  4DV1 L;  3K0X A;  1WCM H;  4BY7 G;  1H7V A;  1RDG A;  4A93 G;  4JG2 A;  4P74 A;  4MTN A;  1QVC A;  1B8A A;  3HKZ G;  1K0R A;  2K2D A;  1TWH H;  3J7Z C;  2XGT A;  3CD6 A;  4AR6 A;  4DV6 Q;  2XJR A;  2LXK A;  1LM0 A;  2CWA A;  4YHH Q;  2QL0 A;  1A62 A;  1VQG A;  4BBS H;  1MJE A;  3WWL A;  4YWM A;  1FHM A;  3I4N H;  4B3S L;  1PFS A;  2PI2 E;  4UY8 C;  3MEF A;  5LMU Q;  4DV4 L;  1C09 A;  1HNZ Q;  2YTX A;  2UUA L;  1IBK Q;  4GNX B;  4JI8 L;  3E9I A;  2WAQ G;  5IP9 H;  2AYJ A;  2D0O A;  4DUZ Q;  5FLX c;  1G29 1;  4R1J A;  3HOY G;  4LF9 L;  1NXE A;  1JB7 A;  5AI2 A;  1YUZ A;  1Y1V G;  2HR5 A;  3J80 i;  5AJ3 L;  1J5E Q;  1NNQ A;  2UXC Q;  1JE5 A;  3MPS A;  4LF6 L;  3U58 A;  3D0F A;  1HJP A;  3AFQ A;  2NVT H;  2M6P A;  4DR4 L;  3CCJ A;  3GTP H;  5HGQ A;  1S24 A;  3FP9 A;  1VQ7 A;  2ERJ A;  1EIY B;  1L1O A;  1FL0 A;  2OTJ A;  1W3S A;  1HZB A;  5BR8 Q;  5GRO A;  1EYG A;  4DR7 Q;  4JBM A;  4AYB G;  5M3F H;  4J15 A;  1Z9F A;  1AH9 A;  3CAM A;  4JOI A;  5GAH C;  2GVA A;  1WYD A;  4LUZ A;  4LWC A;  1VS0 A;  4NXN L;  3HKZ E;  3M3Y H;  1TWG H;  4B3M L;  2YU9 H;  3I55 A;  2B63 G;  4LFC Q;  3QQC E;  1N34 L;  1C7Y A;  3DLL A;  3UDF A;  3LPE B;  3U4Z A;  3CPF A;  3AEV A;  4P75 A;  2Z6K C;  3GD7 A;  2NVQ H;  1YJ9 A;  2K4K A;  2KEN A;  1IBM L;  2JK8 A;  3PGZ A;  2WAQ E;  1VQN A;  2BH8 A;  5H1S E;  3A44 A;  4BA2 I;  1KC8 C;  1PH5 A;  3KYX A;  4A75 A;  4DV5 Q;  3S2D H;  4K0K L;  2PMZ E;  1PH4 A;  4DK3 C;  4DNI A;  3PSI A;  1CSP A;  1Q86 C;  1WJJ A;  1LYL A;  4A4I A;  2NVX H;  2OWO A;  3S1N H;  1VQ9 A;  3HOX H;  3K7U C;  5LMN Q;  4PZ8 A;  2XJP A;  4UP9 A;  5C0X I;  4JV5 Q;  3A5U A;  2YYZ A;  1L2F A;  4XIG S;  3J81 i;  1VZG A;  1N32 L;  2A68 D;  4GKJ Q;  3KYU A;  4AYB E;  4AI3 A;  4X66 Q;  1NMF A;  4C3J H;  3K35 A;  3CME A;  3CQZ H;  1BKB A;  3KF8 B;  2E2H H;  3OTO Q;  2M6O A;  1Y1W G;  2RDV A;  4A3I H;  4KLK A;  1RDV A;  4HIM A;  4JI0 Q;  4YWL A;  2JA8 G;  2R92 G;  5IYD H;  4G6B A;  3CCS A;  2DSX A;  1TXY A;  3JC6 6;  5IP7 H;  1JMC A;  3BZK A;  4JI4 L;  1GM5 A;  6RXN A;  4YY3 L;  1RWD A;  4A76 A;  1BBW A;  3K81 C;  1V9P A;  4POG A;  2Y0S G;  2F4V Q;  3S1R H;  2MO0 A;  2A19 A;  2PQA A;  5IE8 A;  3H3V H;  5GAE C;  3J81 j;  5C0X J;  4JI3 L;  4OWX B;  1VCI A;  2WB1 G;  4GLX A;  3W1G A;  2V3B B;  3RZO H;  3AFP A;  3GTG H;  1QCV A;  4OO1 I;  1X9N A;  1UE7 A;  3ER0 A;  3PKI A;  4ZN3 B;  3CC2 A;  1JT8 A;  4AQY Q;  2VY3 A;  5M3M G;  2UXD Q;  3KJP A;  2JA7 G;  1K83 H;  3PO2 G;  3G48 A;  4OWW B;  1YUX A;  1BFY A;  1DGS A;  3KYW A;  1GVP A;  4ME3 A;  4LF7 Q;  2NN6 I;  3FHW A;  1U0L A;  3BJU A;  1YNX A;  1XNQ Q;  1WJV A;  4DV2 Q;  3I4O A;  1OXX K;  1K8G A;  3KYH C;  1VQP A;  1Y14 B;  2PQA B;  3TEH B;  1XMQ L;  3KF6 A;  1SLJ A;  1R0G A;  3CCL A;  3WWV A;  1N33 Q;  4A3J G;  4DR6 Q;  2YTV A;  4ALP A;  4L5S A;  1SRO A;  4JI1 L;  1Q46 A;  5EIN C;  1MIU A;  1YK4 A;  2N78 A;  1XJV A;  5FLM H;  3ULP A;  2YTY A;  1PHJ A;  2NZH A;  2N3S A;  1YBY A;  4YCU A;  3JAM i;  1XPR A;  1SMM A;  1VZI A;  3KOJ A;  1PA6 A;  4GNX C;  3PO3 G;  4R4O A;  1X3E A;  4DV7 Q;  1MJC A;  1T9H A;  5M3M H;  2XJU A;  2UU9 L;  4JAE A;  5GQO A;  3KYV A;  5K2M E;  1I94 Q;  1VQ5 A;  5JJL A;  2CKA A;  1YIT A;  1PH7 A;  4TVA B;  4JI2 Q;  1I6H H;  4X62 Q;  2ZM6 Q;  4IO9 A;  4HJ5 A;  2NZO A;  3M4O H;  5C3E G;  3MSU A;  4A3K H;  4A3L H;  2RF4 A;  5FJ8 H;  2ATW A;  1RYT A;  3PF5 A;  3GTJ H;  5EIO C;  3A0J A;  1KXL A;  1C0A A;  2K14 A;  4LFB L;  1B13 A;  2KHJ A;  3CP0 A;  4NXM Q;  5E7N A;  4H02 A;  2BE5 D;  2A6H D;  2AKW B;  1RIP A;  3ULL A;  1JYB A;  1HH2 P;  3HFZ B;  1LKM A;  1KAW A;  3KDF A;  2MO1 A;  3STB C;  1WCM G;  3I7F A;  3H15 A;  1HNX Q;  4JI6 L;  2JJQ A;  1QYB A;  1QUQ A;  3T1Y L;  1Q7Y C;  1K3R A;  3OW2 A;  1L0W A;  5RXN A;  2XJV A;  4DV6 L;  1CAD A;  3CF5 A;  2C35 B;  2FXQ A;  1S3O A;  4A3C G;  2UXB Q;  1AE2 A;  3GTO H;  4HID A;  3I4N G;  4DR1 Q;  4JAF A;  4JOI C;  2KCT A;  5LMU L;  1E1T A;  4BY1 G;  5IP9 G;  3KDF B;  1V1Q A;  1R9T H;  4JAG A;  1X54 A;  1MKH A;  1ASY A;  4RMF A;  3PKJ A;  2NYD A;  2KCM A;  5GAG C;  3T1H Q;  4QQB X;  1QUQ B;  5GAE c;  1TWC H;  5LMN W;  1Q1E A;  5DLQ E;  1R0J A;  2ZJP A;  2IX0 A;  2AHO B;  4L5Q A;  2ID0 A;  1R0H A;  4DV0 L;  2D62 A;  1N9W A;  1XNR Q;  1B70 B;  2L0Z A;  3HOW G;  2K50 A;  1T9P A;  2H5X A;  3ZJY C;  5DM7 1;  2R93 H;  3U4V A;  2JI2 A;  1VQF A;  1VQK A;  3B0A B;  4A3C H;  4AR3 A;  1VQM A;  1G6P A;  4JI5 Q;  1N8R C;  3G4S A;  1VQ6 A;  4DR7 L;  2RHQ B;  5M3F G;  1LTL A;  1UE1 A;  4A3D H;  1JJC B;  4L5T A;  4DPG A;  5M5Y H;  3BU2 A;  3F2B A;  1EQQ A;  4GKK Q;  2GVB A;  4BY1 H;  2QEX A;  1OXS C;  3GO5 A;  4A3B H;  5IWA Q;  4B3R Q;  2N49 A;  1Q12 A;  4OWT B;  3TRE A;  1IBL Q;  4P72 A;  1JJ2 A;  1HR0 L;  3GTL H;  2IHE A;  5MLC 3;  1UE5 A;  2ES2 A;  1YIJ A;  2E5L L;  4AI1 A;  4AR4 A;  4DV1 Q;  1C9O A;  3S17 H;  1E1O A;  1BQ9 A;  1SFO H;  3HOW H;  1WFQ A;  4Y7N H;  2LSS A;  2H12 A;  1VQE A;  1A8V A;  4DR2 L;  4HJA A;  3B6Y A;  4RXN A;  3J80 c;  1NXG A;  4LF4 L;  2B5I D;  4AHY A;  1LKO A;  4LF5 L;  4MNO A;  4JCV E;  3SS2 A;  1FGU A;  3M85 A;  3JC6 3;  4KI0 A;  3HOX G;  4B3S Q;  3I4M H;  3RN5 A;  4P71 A;  4DV4 Q;  4TPU A;  2KBN A;  3HOU H;  2UUA Q;  3PUY A;  1B2J A;  3UE0 A;  2R7Z H;  8RXN A;  1EOV A;  2I5H A;  4LF9 Q;  1L1O B;  4JBW A;  2Q2T A;  5AJ3 Q;  3NEN A;  4GN4 B;  3UE1 A;  3J7A 5;  4DR5 L;  3CCV A;  4X6A H;  1K73 C;  4LHL A;  3E9H A;  4TVM A;  4DR4 Q;  4A3I G;  2AWO A;  2C6A A;  2KKD A;  5IYD G;  3S24 A;  3H0G G;  2JA9 A;  3RLN A;  5IP7 G;  1KQS A;  2XTI A;  1XTD A;  3RLF A;  4A3E H;  2CFM A;  1KIX A;  4DUY L;  3PUZ A;  4JI7 L;  1T9O A;  5MFZ A;  2OCE A;  2ERS A;  2JI1 A;  1PV4 A;  1SMX A;  4UPA A;  1S2Z A;  4NXN Q;  1FJG L;  1K8A C;  1Z47 A;  2Q2U A;  1CKO A;  4BXX G;  4FDB A;  3NBH B;  4DR3 L;  4A3M H;  4B3M Q;  2VQF L;  4OXP A;  4IPD A;  1A0I A;  1N34 Q;  2EIF A;  2NVY H;  4A3G H;  4GLV B;  5IY0 A;  4QIW E;  3CC7 A;  2VQE L;  1X55 A;  3HOZ G;  1S40 A;  4AHW A;  1E3P A;  4UP7 A;  2L15 A;  4X65 L;  1HNW L;  5GAD C;  2Q2I A;  3H0G H;  1IBM Q;  4IPC A;  1VZH A;  1KHI A;  1KL9 A;  3J81 c;  3ICE A;  3ULJ A;  4HJ8 A;  4LF8 L;  4OX9 L;  5JEA G;  2R7F A;  4K0K Q;  1YZ6 A;  2UUB L;  3RNU A;  4BBR H;  3GTM H;  3L7Z C;  2PYA A;  2KN9 A;  5FLM G;  1XMO L;  1ASZ A;  4BXX H;  1E7Z A;  1PVO A;  1DVB A;  2PVX A;  1OXV A;  3G6E A;  3K7A H;  1GD7 A;  1YHB A;  5IT9 c;  3L0O A;  3ERS X;  3RN2 A;  2VUM H;  3HOZ H;  1HZ9 A;  1N32 Q;  1YEZ A;  4UP8 A;  4JYA L;  3UDI A;  5C4X H;  4L5R C;  3RZ6 A;  2WP8 J;  2ZTE A;  1JJG A;  4XGH A;  5IYC H;  1YI2 A;  4A3L G;  3U50 C;  4A3K G;  5FJ8 G;  3MXN B;  1IRO A;  4QGU A;  2V0F A;  2Z3R B;  3NEL A;  3S14 H;  2DUD A;  4JI4 Q;  2E8G A;  3F1Z A;  4LFA L;  5GAH c;  1N36 L;  2HIV A;  4XXB B;  3PUV A;  4B8C D;  4GN5 A;  3GTQ H;  1P16 A;  4KHP L;  3UDG A;  3S16 H;  1A63 A;  2OQ0 A;  4B3T L;  4JI3 Q;  2O5J D;  1VQC A;  1CAA A;  1BVS A;  4AHX A;  1I3Q H;  3CCR A;  2BA0 A;  3S1M H;  3M4P A;  2Y0S E;  4XTC S;  1RB9 A;  4K9F A;  3FKI G;  4E6Y A;  4GOP A;  3KF6 B;  2ZIX A;  1HZC A;  2F3I A;  4YCV A;  2ZJR A;  4GLA C;  2WB1 E;  1NTG A;  3CW2 C;  2VNU D;  4O2D A;  3JAM c;  1D7Q A;  3Q8D A;  4GS7 D;  4JBJ A;  4APV A;  2JEA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...