1BFYA

Solution structure of reduced clostridium pasteurianum rubredoxin, nmr, 20 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
54
structure length
54
Chain Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Reduced Clostridium Pasteurianum Rubredoxin
pubmed rcsb
molecule keywords RUBREDOXIN
molecule tags Electron transport
total genus 5
structure length 54
sequence length 54
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 1998-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1bfyA00
3PZAA 2LCQA 1R0GA 5IY0A 2M4YA 1YUXA 1YK4A 3KYWA 7RXNA 1BQ9A 1T9PA 1S24A 1QYBA 1IU5A 1CAAA 2VL6A 1B2OA 1S30A 1BQ8A 1H7VA 2PVEA 3SS2A 4RXNA 1RDGA 1IRNA 1RB9A 3RZTA 1RWDA 4AR6A 1R0FA 1R0JA 5RXNA 1SMUA 3KYUA 4ME3A 2K2DA 1DX8A 1R0IA 4POFA 1ZRPA 1E8JA 5AI3A 1YV1A 2V3BB 1BFYA 1RDVA 1NNQA 2KKDA 1R0HA 1LKMA 1BRFA 1T9OA 4YWLA 1DVBA 4POGA 1LTLA 4AR5A 3RYGA 1B13A 3KYVA 2QL0A 1B71A 1SMWA 1S2ZA 3MPSA 1RYTA 1SMMA 3A44A 2GMGA 4AR3A 1VCXA 2DSXA 2MS3A 2HR5A 1YK5A 3QVDA 3RZ6A 1IU6A 4K9FA 3KYYA 1JYBA 6RXNA 1FHMA 1T9QA 4TPUA 3KYXA 3PWFA 5AI2A 8RXNA 2PYAA 1YUZA 1FHHA 4AR4A 4YWMA 1BE7A 1C09A 1CADA 2KN9A 1LKOA 1B2JA 2PVXA 1LKPA 1IROA 2RDVA 1QCVA
chains in the Genus database with same CATH superfamily
2B63L 3ZG6A 5JVG1 3HOXL 4U671 3J7Y1 2M4YA 3M4OL 3S17L 1YK4A 2XJQA 7RXNA 3QQCE 2NYDA 1S24A 4G6BA 2VL6A 1TWHL 3GTJL 1BQ8A 5M5WL 1H7VA 2APOB 3K35A 2E2HL 2B5ID 1R0JA 3KYUA 4JADA 1TWCL 3H99A 1K83L 2H12A 5EIOC 1Y1WL 5AI3A 1RDVA 3HOUL 4AHWA 5C4JL 5DM61 3J7Z1 1TWFL 4C3JL 1I6HL 1LTLA 1VZHA 1I3QL 4AI2A 1SMWA 1ODHA 3MPSA 4AR3A 2DSXA 4QIWP 4WFN1 4ZN3B 3WWNB 2A69D 3P8BA 2BE5D 3QVDA 1IU6A 5C3EL 4AHYA 4Y52L 4C2M1 5M5XL 1FHMA 3PWFA 8RXNA 5MF6A 2PYAA 3IU3I 3PIP1 1CADA 2JA7L 4BY1L 3HOWL 1LKOA 1Z92B 1NXGA 2V0EA 2PVXA 1LKPA 3HAXC 2RDVA 1QCVA 3PKIA 2LCQA 3LWQB 2JA8L 1R0GA 3VPBE 2JI3A 3KYWA 3LWVB 3HOYL 4A93L 4A3ML 5GAGc 1VZGA 1QYBA 2Z3RB 1CAAA 5K2ME 1S30A 3H0GL 2PVEA 2V0FA 2XJUA 4A3EL 4AR6A 1R0FA 2M6PA 4ME3A 4A3DL 4AI1A 4XGHA 1R0IA 4A3IL 2PMZP 1YV1A 5GADc 1NNQA 2VUML 2O5JD 2YU9L 1BRFA 3S16L 1P7PA 2NVXL 3S1RL 3RYGA 4E6YA 1B71A 2CKCA 5C4XL 5M3ML 3JR7A 3RZOL 4V196 4BY7L 2MS3A 2NVQL 1YK5A 2E2JL 3HJWB 4A3FL 4LHNA 2R92L 1PZXA 3GTQL 3FKIL 6RXNA 2M6OA 3PL5A 3B08B 3LWPB 1T9QA 2HVYC 4TPUA 2RFKB 4A3CL 3KYXA 3HKZP 2NVYL 2XJTA 5MGNA 1YUZA 5DM71 4YWMA 4BBSL 1BE7A 2XJVA 2KN9A 1B2JA 1QQTA 5IP7L 3LPEB 1IROA 4ZN1B 4UY81 3PO3L 5IY0A 2M4VA 2JA6L 3HOVL 5IYDL 1YUXA 3PO2L 1BQ9A 1T9PA 5IYBL 3HJYB 3SS2A 4RXNA 2E2IL 1IRNA 1RWDA 3I4ML 2CKAA 2JI2A 5RXNA 3S15L 4POFA 4A3BL 1ZRPA 1E8JA 4BXXL 1BFYA 2WAQP 2ERSA 1RYQA 1IW7D 5MLC3 2J9UB 3H9CA 1PFVA 4YWLA 2Y0SP 3GTLL 5GAEc 4POGA 3B0AB 4AR5A 4A3JL 2QL0A 3PIO1 1SFOL 3S1QL 3GTML 3P2AA 1TWAL 4TVMA 3A44A 2GMGA 1VCXA 2HR5A 2ERJA 5IYCL 1NXEA 3KYYA 1PFWA 2C6BA 4AI3A 1Y1VL 1WCML 4AHXA 5C44L 3GTPL 3S2DL 3M3YL 4AR4A 4AI0A 2JI1A 3LWRB 2NVTL 3K7AL 1C09A 5FLML 4Y7NL 1R9TL 2EY4E 3GTOL 1PFYA 3PZAA 5M3FL 2PSMC 2A6ED 3S1ML 1IU5A 3GTGL 3PKJA 4XXBB 2AYJA 1B2OA 2A68D 3GTKL 4JAEA 1RDGA 2R7ZL 2ZIXA 2XJPA 3RZDL 1RB9A 3RZTA 1VZIA 4LHLA 4JAFA 1I50L 5IP9L 4BBRL 1SMUA 5MFPA 1OWBA 4AHZA 2K2DA 1DX8A 2L0ZA 4C3HL 2V3BB 1OWCA 3I4NL 3FDJA 2KKDA 1R0HA 1LKMA 2A6HD 4B8CD 2AQCA 4GS7D 1T9OA 4A3LL 1DVBA 5MFZA 5JVH1 1B13A 3KYVA 2PPTA 3LNLA 3NFPI 1S2ZA 1RYTA 2XJSA 1WJVA 1SMMA 5EINC 4A3GL 2XJRA 3CQZL 5AN9H 4AYBP 2Z3QB 5H1Sc 3RZ6A 4K9FA 3MQKB 3WWLA 2AUSB 1JYBA 2R93L 3H3VM 5GAHc 3LWOB 5FJ8L 5AI2A 4A3KL 3H97A 3HOZL 4JAGA 3S14L 2WB1P 3S2HL 4X6AL 5M5YL 4C3IL 2C6AA 2CR8A 1TWGL 1PFUA 3H9BA 3S1NL 1F4LA 2JA5L 3MSUA 1FHHA
chains in the Genus database with same CATH topology
3PZAA 3ZG6A 5JVG1 3PKIA 2LCQA 4U671 1R0GA 5IY0A 3J7Y1 2M4VA 2M4YA 2PSMC 3VPBE 1YUXA 1YK4A 2JI3A 2XJQA 3KYWA 7RXNA 1BQ9A 1T9PA 2A6ED 3QQCE 2NYDA 5GAGc 1S24A 1VZGA 1QYBA 1IU5A 2Z3RB 4G6BA 1CAAA 3PKJA 4XXBB 2AYJA 2VL6A 5K2ME 1B2OA 1S30A 2A68D 1BQ8A 1H7VA 2PVEA 4JAEA 3SS2A 4RXNA 2V0FA 1RDGA 2XJUA 3K35A 1IRNA 2XJPA 2ZIXA 1RB9A 3RZTA 1VZIA 1RWDA 2CKAA 4AR6A 4LHLA 4JAFA 2JI2A 2B5ID 1R0JA 1R0FA 5RXNA 1SMUA 2M6PA 3KYUA 1OWBA 4ME3A 4JADA 4AHZA 2K2DA 5MFPA 1DX8A 4AI1A 4XGHA 1R0IA 4POFA 2H12A 1ZRPA 5EIOC 2L0ZA 5AI3A 1E8JA 1YV1A 2V3BB 1OWCA 5GADc 1BFYA 1RDVA 1NNQA 2KKDA 2ERSA 1R0HA 1LKMA 1RYQA 2A6HD 2O5JD 4AHWA 5DM61 1IW7D 5MLC3 1BRFA 2J9UB 4B8CD 3J7Z1 4GS7D 1T9OA 4YWLA 1DVBA 5GAEc 5MFZA 5JVH1 4POGA 1LTLA 3B0AB 4AR5A 3RYGA 1VZHA 1B13A 3KYVA 2PPTA 2QL0A 4AI2A 4E6YA 3PIO1 1B71A 3LNLA 3NFPI 1SMWA 1ODHA 1S2ZA 2CKCA 3P2AA 3MPSA 1RYTA 2XJSA 1WJVA 4TVMA 1SMMA 3A44A 2GMGA 4AR3A 4V196 1VCXA 2DSXA 5EINC 2MS3A 2HR5A 2XJRA 4ZN3B 4WFN1 2ERJA 3WWNB 1YK5A 5AN9H 4LHNA 2A69D 2Z3QB 3P8BA 5H1Sc 2BE5D 3QVDA 3RZ6A 1IU6A 4K9FA 3WWLA 4AHYA 1NXEA 1JYBA 3KYYA 6RXNA 2C6BA 4AI3A 2M6OA 1FHMA 3B08B 5GAHc 1T9QA 4TPUA 3KYXA 3PWFA 4AHXA 5AI2A 8RXNA 4JAGA 5MF6A 2PYAA 2XJTA 3IU3I 5MGNA 1YUZA 1FHHA 4AI0A 4AR4A 5DM71 4YWMA 3PIP1 2JI1A 1BE7A 1C09A 2XJVA 1CADA 2C6AA 2KN9A 1LKOA 1B2JA 1Z92B 2CR8A 1NXGA 2V0EA 2PVXA 3LPEB 1LKPA 1IROA 4ZN1B 2RDVA 3MSUA 4UY81 1QCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZA A;  2LCQ A;  1R0G A;  5IY0 A;  2M4Y A;  1YUX A;  1YK4 A;  3KYW A;  7RXN A;  1BQ9 A;  1T9P A;  1S24 A;  1QYB A;  1IU5 A;  1CAA A;  2VL6 A;  1B2O A;  1S30 A;  1BQ8 A;  1H7V A;  2PVE A;  3SS2 A;  4RXN A;  1RDG A;  1IRN A;  1RB9 A;  3RZT A;  1RWD A;  4AR6 A;  1R0F A;  1R0J A;  5RXN A;  1SMU A;  3KYU A;  4ME3 A;  2K2D A;  1DX8 A;  1R0I A;  4POF A;  1ZRP A;  1E8J A;  5AI3 A;  1YV1 A;  2V3B B;  1BFY A;  1RDV A;  1NNQ A;  2KKD A;  1R0H A;  1LKM A;  1BRF A;  1T9O A;  4YWL A;  1DVB A;  4POG A;  1LTL A;  4AR5 A;  3RYG A;  1B13 A;  3KYV A;  2QL0 A;  1B71 A;  1SMW A;  1S2Z A;  3MPS A;  1RYT A;  1SMM A;  3A44 A;  2GMG A;  4AR3 A;  1VCX A;  2DSX A;  2MS3 A;  2HR5 A;  1YK5 A;  3QVD A;  3RZ6 A;  1IU6 A;  4K9F A;  3KYY A;  1JYB A;  6RXN A;  1FHM A;  1T9Q A;  4TPU A;  3KYX A;  3PWF A;  5AI2 A;  8RXN A;  2PYA A;  1YUZ A;  1FHH A;  4AR4 A;  4YWM A;  1BE7 A;  1C09 A;  1CAD A;  2KN9 A;  1LKO A;  1B2J A;  2PVX A;  1LKP A;  1IRO A;  2RDV A;  1QCV A; 
#chains in the Genus database with same CATH topology
 2B63 L;  3ZG6 A;  5JVG 1;  3HOX L;  4U67 1;  3J7Y 1;  2M4Y A;  3M4O L;  3S17 L;  1YK4 A;  2XJQ A;  7RXN A;  3QQC E;  2NYD A;  1S24 A;  4G6B A;  2VL6 A;  1TWH L;  3GTJ L;  1BQ8 A;  5M5W L;  1H7V A;  2APO B;  3K35 A;  2E2H L;  2B5I D;  1R0J A;  3KYU A;  4JAD A;  1TWC L;  3H99 A;  1K83 L;  2H12 A;  5EIO C;  1Y1W L;  5AI3 A;  1RDV A;  3HOU L;  4AHW A;  5C4J L;  5DM6 1;  3J7Z 1;  1TWF L;  4C3J L;  1I6H L;  1LTL A;  1VZH A;  1I3Q L;  4AI2 A;  1SMW A;  1ODH A;  3MPS A;  4AR3 A;  2DSX A;  4QIW P;  4WFN 1;  4ZN3 B;  3WWN B;  2A69 D;  3P8B A;  2BE5 D;  3QVD A;  1IU6 A;  5C3E L;  4AHY A;  4Y52 L;  4C2M 1;  5M5X L;  1FHM A;  3PWF A;  8RXN A;  5MF6 A;  2PYA A;  3IU3 I;  3PIP 1;  1CAD A;  2JA7 L;  4BY1 L;  3HOW L;  1LKO A;  1Z92 B;  1NXG A;  2V0E A;  2PVX A;  1LKP A;  3HAX C;  2RDV A;  1QCV A;  3PKI A;  2LCQ A;  3LWQ B;  2JA8 L;  1R0G A;  3VPB E;  2JI3 A;  3KYW A;  3LWV B;  3HOY L;  4A93 L;  4A3M L;  5GAG c;  1VZG A;  1QYB A;  2Z3R B;  1CAA A;  5K2M E;  1S30 A;  3H0G L;  2PVE A;  2V0F A;  2XJU A;  4A3E L;  4AR6 A;  1R0F A;  2M6P A;  4ME3 A;  4A3D L;  4AI1 A;  4XGH A;  1R0I A;  4A3I L;  2PMZ P;  1YV1 A;  5GAD c;  1NNQ A;  2VUM L;  2O5J D;  2YU9 L;  1BRF A;  3S16 L;  1P7P A;  2NVX L;  3S1R L;  3RYG A;  4E6Y A;  1B71 A;  2CKC A;  5C4X L;  5M3M L;  3JR7 A;  3RZO L;  4V19 6;  4BY7 L;  2MS3 A;  2NVQ L;  1YK5 A;  2E2J L;  3HJW B;  4A3F L;  4LHN A;  2R92 L;  1PZX A;  3GTQ L;  3FKI L;  6RXN A;  2M6O A;  3PL5 A;  3B08 B;  3LWP B;  1T9Q A;  2HVY C;  4TPU A;  2RFK B;  4A3C L;  3KYX A;  3HKZ P;  2NVY L;  2XJT A;  5MGN A;  1YUZ A;  5DM7 1;  4YWM A;  4BBS L;  1BE7 A;  2XJV A;  2KN9 A;  1B2J A;  1QQT A;  5IP7 L;  3LPE B;  1IRO A;  4ZN1 B;  4UY8 1;  3PO3 L;  5IY0 A;  2M4V A;  2JA6 L;  3HOV L;  5IYD L;  1YUX A;  3PO2 L;  1BQ9 A;  1T9P A;  5IYB L;  3HJY B;  3SS2 A;  4RXN A;  2E2I L;  1IRN A;  1RWD A;  3I4M L;  2CKA A;  2JI2 A;  5RXN A;  3S15 L;  4POF A;  4A3B L;  1ZRP A;  1E8J A;  4BXX L;  1BFY A;  2WAQ P;  2ERS A;  1RYQ A;  1IW7 D;  5MLC 3;  2J9U B;  3H9C A;  1PFV A;  4YWL A;  2Y0S P;  3GTL L;  5GAE c;  4POG A;  3B0A B;  4AR5 A;  4A3J L;  2QL0 A;  3PIO 1;  1SFO L;  3S1Q L;  3GTM L;  3P2A A;  1TWA L;  4TVM A;  3A44 A;  2GMG A;  1VCX A;  2HR5 A;  2ERJ A;  5IYC L;  1NXE A;  3KYY A;  1PFW A;  2C6B A;  4AI3 A;  1Y1V L;  1WCM L;  4AHX A;  5C44 L;  3GTP L;  3S2D L;  3M3Y L;  4AR4 A;  4AI0 A;  2JI1 A;  3LWR B;  2NVT L;  3K7A L;  1C09 A;  5FLM L;  4Y7N L;  1R9T L;  2EY4 E;  3GTO L;  1PFY A;  3PZA A;  5M3F L;  2PSM C;  2A6E D;  3S1M L;  1IU5 A;  3GTG L;  3PKJ A;  4XXB B;  2AYJ A;  1B2O A;  2A68 D;  3GTK L;  4JAE A;  1RDG A;  2R7Z L;  2ZIX A;  2XJP A;  3RZD L;  1RB9 A;  3RZT A;  1VZI A;  4LHL A;  4JAF A;  1I50 L;  5IP9 L;  4BBR L;  1SMU A;  5MFP A;  1OWB A;  4AHZ A;  2K2D A;  1DX8 A;  2L0Z A;  4C3H L;  2V3B B;  1OWC A;  3I4N L;  3FDJ A;  2KKD A;  1R0H A;  1LKM A;  2A6H D;  4B8C D;  2AQC A;  4GS7 D;  1T9O A;  4A3L L;  1DVB A;  5MFZ A;  5JVH 1;  1B13 A;  3KYV A;  2PPT A;  3LNL A;  3NFP I;  1S2Z A;  1RYT A;  2XJS A;  1WJV A;  1SMM A;  5EIN C;  4A3G L;  2XJR A;  3CQZ L;  5AN9 H;  4AYB P;  2Z3Q B;  5H1S c;  3RZ6 A;  4K9F A;  3MQK B;  3WWL A;  2AUS B;  1JYB A;  2R93 L;  3H3V M;  5GAH c;  3LWO B;  5FJ8 L;  5AI2 A;  4A3K L;  3H97 A;  3HOZ L;  4JAG A;  3S14 L;  2WB1 P;  3S2H L;  4X6A L;  5M5Y L;  4C3I L;  2C6A A;  2CR8 A;  1TWG L;  1PFU A;  3H9B A;  3S1N L;  1F4L A;  2JA5 L;  3MSU A;  1FHH A; 
#chains in the Genus database with same CATH homology
 3PZA A;  3ZG6 A;  5JVG 1;  3PKI A;  2LCQ A;  4U67 1;  1R0G A;  5IY0 A;  3J7Y 1;  2M4V A;  2M4Y A;  2PSM C;  3VPB E;  1YUX A;  1YK4 A;  2JI3 A;  2XJQ A;  3KYW A;  7RXN A;  1BQ9 A;  1T9P A;  2A6E D;  3QQC E;  2NYD A;  5GAG c;  1S24 A;  1VZG A;  1QYB A;  1IU5 A;  2Z3R B;  4G6B A;  1CAA A;  3PKJ A;  4XXB B;  2AYJ A;  2VL6 A;  5K2M E;  1B2O A;  1S30 A;  2A68 D;  1BQ8 A;  1H7V A;  2PVE A;  4JAE A;  3SS2 A;  4RXN A;  2V0F A;  1RDG A;  2XJU A;  3K35 A;  1IRN A;  2XJP A;  2ZIX A;  1RB9 A;  3RZT A;  1VZI A;  1RWD A;  2CKA A;  4AR6 A;  4LHL A;  4JAF A;  2JI2 A;  2B5I D;  1R0J A;  1R0F A;  5RXN A;  1SMU A;  2M6P A;  3KYU A;  1OWB A;  4ME3 A;  4JAD A;  4AHZ A;  2K2D A;  5MFP A;  1DX8 A;  4AI1 A;  4XGH A;  1R0I A;  4POF A;  2H12 A;  1ZRP A;  5EIO C;  2L0Z A;  5AI3 A;  1E8J A;  1YV1 A;  2V3B B;  1OWC A;  5GAD c;  1BFY A;  1RDV A;  1NNQ A;  2KKD A;  2ERS A;  1R0H A;  1LKM A;  1RYQ A;  2A6H D;  2O5J D;  4AHW A;  5DM6 1;  1IW7 D;  5MLC 3;  1BRF A;  2J9U B;  4B8C D;  3J7Z 1;  4GS7 D;  1T9O A;  4YWL A;  1DVB A;  5GAE c;  5MFZ A;  5JVH 1;  4POG A;  1LTL A;  3B0A B;  4AR5 A;  3RYG A;  1VZH A;  1B13 A;  3KYV A;  2PPT A;  2QL0 A;  4AI2 A;  4E6Y A;  3PIO 1;  1B71 A;  3LNL A;  3NFP I;  1SMW A;  1ODH A;  1S2Z A;  2CKC A;  3P2A A;  3MPS A;  1RYT A;  2XJS A;  1WJV A;  4TVM A;  1SMM A;  3A44 A;  2GMG A;  4AR3 A;  4V19 6;  1VCX A;  2DSX A;  5EIN C;  2MS3 A;  2HR5 A;  2XJR A;  4ZN3 B;  4WFN 1;  2ERJ A;  3WWN B;  1YK5 A;  5AN9 H;  4LHN A;  2A69 D;  2Z3Q B;  3P8B A;  5H1S c;  2BE5 D;  3QVD A;  3RZ6 A;  1IU6 A;  4K9F A;  3WWL A;  4AHY A;  1NXE A;  1JYB A;  3KYY A;  6RXN A;  2C6B A;  4AI3 A;  2M6O A;  1FHM A;  3B08 B;  5GAH c;  1T9Q A;  4TPU A;  3KYX A;  3PWF A;  4AHX A;  5AI2 A;  8RXN A;  4JAG A;  5MF6 A;  2PYA A;  2XJT A;  3IU3 I;  5MGN A;  1YUZ A;  1FHH A;  4AI0 A;  4AR4 A;  5DM7 1;  4YWM A;  3PIP 1;  2JI1 A;  1BE7 A;  1C09 A;  2XJV A;  1CAD A;  2C6A A;  2KN9 A;  1LKO A;  1B2J A;  1Z92 B;  2CR8 A;  1NXG A;  2V0E A;  2PVX A;  3LPE B;  1LKP A;  1IRO A;  4ZN1 B;  2RDV A;  3MSU A;  4UY8 1;  1QCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...