1DX8A

Rubredoxin from guillardia theta
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
MEIDEGKYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIKKVIAGFAENQKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a zinc substituted eukaryotic rubredoxin from the cryptomonad alga Guillardia theta.
pubmed doi rcsb
molecule keywords RUBREDOXIN
molecule tags Electron transport
source organism Guillardia theta
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1dx8A00
1B2JA 5AI3A 1S2ZA 7RXNA 1BE7A 3KYVA 3KYYA 1R0IA 2KN9A 8RXNA 1YUXA 1IU5A 1VCXA 1YK4A 4RXNA 1S24A 1LKPA 1R0GA 2LCQA 1SMMA 1S30A 1RDVA 5IY0A 1QCVA 2DSXA 1RWDA 1BRFA 2PYAA 1IRNA 3MPSA 1C09A 1DVBA 4AR4A 1R0JA 2HR5A 2MS3A 1T9PA 2K2DA 2M4YA 3KYUA 1RYTA 1LKMA 3SS2A 1RB9A 1T9OA 2V3BB 3A44A 1IU6A 1B71A 1B13A 3RYGA 3KYXA 2KKDA 4POFA 1YV1A 1JYBA 1NNQA 2GMGA 2RDVA 1IROA 3PWFA 5AI2A 1CADA 1BQ8A 1H7VA 1LTLA 3KYWA 3PZAA 1YUZA 4K9FA 3RZTA 4ME3A 1R0FA 4AR3A 5RXNA 1FHHA 1QYBA 1BFYA 1E8JA 1SMWA 1BQ9A 1LKOA 1CAAA 1DX8A 1YK5A 1B2OA 2PVEA 2VL6A 4AR5A 1SMUA 4YWMA 1RDGA 3QVDA 2QL0A 1R0HA 4TPUA 4AR6A 4YWLA 2PVXA 6RXNA 1FHMA 4POGA 1ZRPA 3RZ6A 1T9QA
chains in the Genus database with same CATH superfamily
1K83L 1TWAL 3M3YL 2L0ZA 1B2JA 3S2HL 5K2ME 1WJVA 3H9BA 1R0IA 4BBRL 4QIWP 1VCXA 1YK4A 3QQCE 1R9TL 2CKCA 4A3IL 1RWDA 1IRNA 3MPSA 3LWRB 1DVBA 4Y52L 5M5YL 1PFVA 2CKAA 3RZDL 2NVQL 2M4YA 5M5WL 1RYTA 2XJTA 3HOVL 1RB9A 1Y1VL 1B71A 4ZN3B 3GTLL 4A3GL 3K35A 2KKDA 4BY7L 1JYBA 2M4VA 1NNQA 2M6OA 2R93L 3PWFA 5AI2A 2VUML 4X6AL 4TVMA 1TWGL 1TWCL 2XJSA 5C4XL 1R0FA 2ERSA 5RXNA 1FHHA 3K7AL 2Z3QB 1BQ9A 3GTKL 4AI0A 5GAGc 3S1RL 1OWBA 2JA6L 5GAHc 4A3DL 3PIO1 4AI2A 4BXXL 4C3JL 5C3EL 2PVXA 1VZIA 3S17L 3LWOB 2E2IL 4C2M1 6RXNA 4C3IL 3LPEB 3HJWB 2A68D 3HOWL 3H3VM 2JA8L 3LNLA 2J9UB 3HJYB 2A6ED 3PO3L 7RXNA 1BE7A 3KYYA 2PSMC 2APOB 3FDJA 5GAEc 2KN9A 5C44L 3CQZL 1YUXA 1IU5A 3S16L 1R0GA 2LCQA 1S30A 5GADc 1RDVA 1IW7D 2XJPA 3IU3I 2A6HD 2AQCA 2HVYC 3J7Z1 2E2JL 1T9PA 4C3HL 2K2DA 2JA5L 1LKMA 2AUSB 2C6AA 3SS2A 3NFPI 2RFKB 5M3ML 3KYXA 3MSUA 4POFA 2ERJA 4JAFA 1BQ8A 1H7VA 4JADA 2C6BA 1SFOL 3I4ML 3KYWA 3PZAA 3GTML 4ME3A 1WCML 1BFYA 1TWFL 3P8BA 1E8JA 1SMWA 5FLML 4V196 1YK5A 3LWVB 5IYDL 1B2OA 3JR7A 5IYBL 2VL6A 4AR5A 1SMUA 4YWMA 1RDGA 3QVDA 3HKZP 1NXGA 2ZIXA 4YWLA 2CR8A 3ZG6A 2R92L 2V0FA 2M6PA 5C4JL 1FHMA 1ZRPA 3P2AA 1T9QA 4A3BL 4AI3A 1F4LA 5EINC 3PL5A 1S2ZA 2NVYL 3KYVA 1I6HL 3GTGL 4AHXA 4A3LL 1PFYA 4RXNA 1S24A 1LKPA 2B5ID 4A3ML 2H12A 1QCVA 1BRFA 2PYAA 3LWPB 2NYDA 4UY81 5M3FL 1RYQA 2PPTA 3S2DL 5AN9H 2V3BB 3A44A 1IU6A 4BY1L 3RYGA 4A3JL 3I4NL 2JI2A 5EIOC 4WFN1 2GMGA 2RDVA 1IROA 1Z92B 4JAGA 2JA7L 2WB1P 4ZN1B 4AYBP 3LWQB 5MFPA 3B08B 4B8CD 3GTJL 3FKIL 1I3QL 1YUZA 4K9FA 4LHNA 3HOZL 1PFWA 5MF6A 1TWHL 5IYCL 1QYBA 2R7ZL 1CAAA 1DX8A 3WWLA 1I50L 2YU9L 3GTQL 2QL0A 2JI1A 4G6BA 3J7Y1 2B63L 4AR6A 3H0GL 2E2HL 3GTOL 4LHLA 4A93L 2XJQA 4POGA 3S1NL 4XXBB 1NXEA 2XJUA 1VZHA 3H99A 4AI1A 3H9CA 3S14L 4AHZA 3HOUL 3PKJA 2O5JD 1QQTA 5AI3A 5JVH1 4AHWA 5MFZA 3S15L 4Y7NL 8RXNA 3MQKB 3M4OL 3PIP1 4BBSL 5MGNA 1SMMA 5IY0A 3RZOL 5M5XL 2DSXA 3HOYL 2JI3A 1C09A 2XJVA 4AR4A 1R0JA 2HR5A 2NVTL 2MS3A 4XGHA 3PO2L 1ODHA 3KYUA 2XJRA 2BE5D 5H1Sc 1T9OA 2WAQP 4E6YA 1B13A 4A3CL 4GS7D 3HOXL 2AYJA 5FJ8L 1YV1A 2Z3RB 5IP7L 1PZXA 5IP9L 1CADA 3PKIA 3WWNB 1P7PA 2PMZP 1LTLA 1PFUA 2Y0SP 3RZTA 4AR3A 3S1ML 4A3KL 1LKOA 4A3FL 4A3EL 3S1QL 2PVEA 3B0AB 1R0HA 2A69D 4U671 4TPUA 2NVXL 5DM71 1VZGA 5MLC3 2V0EA 3H97A 4JAEA 1OWCA 3HAXC 3VPBE 5DM61 3RZ6A 4AHYA 5JVG1 3GTPL 2EY4E 1Y1WL
chains in the Genus database with same CATH topology
1VZHA 4AI1A 3LNLA 4AI3A 5EINC 2J9UB 4AHZA 2L0ZA 1B2JA 3PKJA 2O5JD 2A6ED 5AI3A 1S2ZA 4AHWA 7RXNA 1BE7A 1WJVA 3KYVA 5K2ME 5MFZA 3KYYA 2PSMC 1R0IA 5GAEc 2KN9A 8RXNA 1YUXA 4AHXA 1IU5A 1VCXA 1YK4A 3QQCE 3PIP1 4RXNA 2CKCA 1S24A 1LKPA 1R0GA 2B5ID 2H12A 2LCQA 5MGNA 1SMMA 1S30A 5GADc 1RDVA 5IY0A 1IW7D 1QCVA 2DSXA 1RWDA 1BRFA 2JI3A 2PYAA 1IRNA 2XJPA 3IU3I 3MPSA 1C09A 2A6HD 1DVBA 2XJVA 2NYDA 4AR4A 1R0JA 2HR5A 3J7Z1 2MS3A 1T9PA 4XGHA 4UY81 1ODHA 2K2DA 2CKAA 2M4YA 3KYUA 1RYTA 1LKMA 1RYQA 2PPTA 2XJRA 2XJTA 5AN9H 2C6AA 2BE5D 3SS2A 3NFPI 1RB9A 1T9OA 2V3BB 3A44A 5H1Sc 4E6YA 1IU6A 1B71A 1B13A 4ZN3B 3RYGA 3K35A 4GS7D 2JI2A 2KKDA 3KYXA 3MSUA 4POFA 2AYJA 5EIOC 2ERJA 1YV1A 2Z3RB 1JYBA 4WFN1 2M4VA 1NNQA 2GMGA 2RDVA 1IROA 2M6OA 1Z92B 3PWFA 5AI2A 1CADA 4JAGA 4JAFA 3PKIA 4ZN1B 1BQ8A 3WWNB 4TVMA 5MFPA 3B08B 1H7VA 4B8CD 1LTLA 4JADA 5JVH1 2C6BA 3KYWA 3PZAA 1YUZA 4K9FA 3RZTA 4ME3A 2XJSA 1R0FA 2ERSA 4LHNA 4AR3A 5MF6A 5RXNA 1FHHA 1QYBA 1BFYA 3P8BA 1E8JA 1SMWA 1BQ9A 1LKOA 1CAAA 2Z3QB 4AI0A 5GAGc 4V196 1DX8A 1YK5A 1OWBA 1B2OA 3WWLA 5GAHc 2PVEA 2VL6A 3PIO1 4AR5A 1SMUA 4YWMA 4AI2A 1RDGA 3B0AB 2QL0A 3QVDA 1R0HA 2A69D 2JI1A 4G6BA 4TPUA 4U671 3J7Y1 4AR6A 1NXGA 5DM71 2ZIXA 4YWLA 1VZGA 2PVXA 5MLC3 2CR8A 1VZIA 3ZG6A 2V0EA 2V0FA 4JAEA 4LHLA 1OWCA 6RXNA 2M6PA 1FHMA 2XJQA 1ZRPA 4POGA 3P2AA 3VPBE 3LPEB 3RZ6A 5DM61 1T9QA 4XXBB 1NXEA 4AHYA 2A68D 5JVG1 2XJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2J A;  5AI3 A;  1S2Z A;  7RXN A;  1BE7 A;  3KYV A;  3KYY A;  1R0I A;  2KN9 A;  8RXN A;  1YUX A;  1IU5 A;  1VCX A;  1YK4 A;  4RXN A;  1S24 A;  1LKP A;  1R0G A;  2LCQ A;  1SMM A;  1S30 A;  1RDV A;  5IY0 A;  1QCV A;  2DSX A;  1RWD A;  1BRF A;  2PYA A;  1IRN A;  3MPS A;  1C09 A;  1DVB A;  4AR4 A;  1R0J A;  2HR5 A;  2MS3 A;  1T9P A;  2K2D A;  2M4Y A;  3KYU A;  1RYT A;  1LKM A;  3SS2 A;  1RB9 A;  1T9O A;  2V3B B;  3A44 A;  1IU6 A;  1B71 A;  1B13 A;  3RYG A;  3KYX A;  2KKD A;  4POF A;  1YV1 A;  1JYB A;  1NNQ A;  2GMG A;  2RDV A;  1IRO A;  3PWF A;  5AI2 A;  1CAD A;  1BQ8 A;  1H7V A;  1LTL A;  3KYW A;  3PZA A;  1YUZ A;  4K9F A;  3RZT A;  4ME3 A;  1R0F A;  4AR3 A;  5RXN A;  1FHH A;  1QYB A;  1BFY A;  1E8J A;  1SMW A;  1BQ9 A;  1LKO A;  1CAA A;  1DX8 A;  1YK5 A;  1B2O A;  2PVE A;  2VL6 A;  4AR5 A;  1SMU A;  4YWM A;  1RDG A;  3QVD A;  2QL0 A;  1R0H A;  4TPU A;  4AR6 A;  4YWL A;  2PVX A;  6RXN A;  1FHM A;  4POG A;  1ZRP A;  3RZ6 A;  1T9Q A; 
#chains in the Genus database with same CATH topology
 1K83 L;  1TWA L;  3M3Y L;  2L0Z A;  1B2J A;  3S2H L;  5K2M E;  1WJV A;  3H9B A;  1R0I A;  4BBR L;  4QIW P;  1VCX A;  1YK4 A;  3QQC E;  1R9T L;  2CKC A;  4A3I L;  1RWD A;  1IRN A;  3MPS A;  3LWR B;  1DVB A;  4Y52 L;  5M5Y L;  1PFV A;  2CKA A;  3RZD L;  2NVQ L;  2M4Y A;  5M5W L;  1RYT A;  2XJT A;  3HOV L;  1RB9 A;  1Y1V L;  1B71 A;  4ZN3 B;  3GTL L;  4A3G L;  3K35 A;  2KKD A;  4BY7 L;  1JYB A;  2M4V A;  1NNQ A;  2M6O A;  2R93 L;  3PWF A;  5AI2 A;  2VUM L;  4X6A L;  4TVM A;  1TWG L;  1TWC L;  2XJS A;  5C4X L;  1R0F A;  2ERS A;  5RXN A;  1FHH A;  3K7A L;  2Z3Q B;  1BQ9 A;  3GTK L;  4AI0 A;  5GAG c;  3S1R L;  1OWB A;  2JA6 L;  5GAH c;  4A3D L;  3PIO 1;  4AI2 A;  4BXX L;  4C3J L;  5C3E L;  2PVX A;  1VZI A;  3S17 L;  3LWO B;  2E2I L;  4C2M 1;  6RXN A;  4C3I L;  3LPE B;  3HJW B;  2A68 D;  3HOW L;  3H3V M;  2JA8 L;  3LNL A;  2J9U B;  3HJY B;  2A6E D;  3PO3 L;  7RXN A;  1BE7 A;  3KYY A;  2PSM C;  2APO B;  3FDJ A;  5GAE c;  2KN9 A;  5C44 L;  3CQZ L;  1YUX A;  1IU5 A;  3S16 L;  1R0G A;  2LCQ A;  1S30 A;  5GAD c;  1RDV A;  1IW7 D;  2XJP A;  3IU3 I;  2A6H D;  2AQC A;  2HVY C;  3J7Z 1;  2E2J L;  1T9P A;  4C3H L;  2K2D A;  2JA5 L;  1LKM A;  2AUS B;  2C6A A;  3SS2 A;  3NFP I;  2RFK B;  5M3M L;  3KYX A;  3MSU A;  4POF A;  2ERJ A;  4JAF A;  1BQ8 A;  1H7V A;  4JAD A;  2C6B A;  1SFO L;  3I4M L;  3KYW A;  3PZA A;  3GTM L;  4ME3 A;  1WCM L;  1BFY A;  1TWF L;  3P8B A;  1E8J A;  1SMW A;  5FLM L;  4V19 6;  1YK5 A;  3LWV B;  5IYD L;  1B2O A;  3JR7 A;  5IYB L;  2VL6 A;  4AR5 A;  1SMU A;  4YWM A;  1RDG A;  3QVD A;  3HKZ P;  1NXG A;  2ZIX A;  4YWL A;  2CR8 A;  3ZG6 A;  2R92 L;  2V0F A;  2M6P A;  5C4J L;  1FHM A;  1ZRP A;  3P2A A;  1T9Q A;  4A3B L;  4AI3 A;  1F4L A;  5EIN C;  3PL5 A;  1S2Z A;  2NVY L;  3KYV A;  1I6H L;  3GTG L;  4AHX A;  4A3L L;  1PFY A;  4RXN A;  1S24 A;  1LKP A;  2B5I D;  4A3M L;  2H12 A;  1QCV A;  1BRF A;  2PYA A;  3LWP B;  2NYD A;  4UY8 1;  5M3F L;  1RYQ A;  2PPT A;  3S2D L;  5AN9 H;  2V3B B;  3A44 A;  1IU6 A;  4BY1 L;  3RYG A;  4A3J L;  3I4N L;  2JI2 A;  5EIO C;  4WFN 1;  2GMG A;  2RDV A;  1IRO A;  1Z92 B;  4JAG A;  2JA7 L;  2WB1 P;  4ZN1 B;  4AYB P;  3LWQ B;  5MFP A;  3B08 B;  4B8C D;  3GTJ L;  3FKI L;  1I3Q L;  1YUZ A;  4K9F A;  4LHN A;  3HOZ L;  1PFW A;  5MF6 A;  1TWH L;  5IYC L;  1QYB A;  2R7Z L;  1CAA A;  1DX8 A;  3WWL A;  1I50 L;  2YU9 L;  3GTQ L;  2QL0 A;  2JI1 A;  4G6B A;  3J7Y 1;  2B63 L;  4AR6 A;  3H0G L;  2E2H L;  3GTO L;  4LHL A;  4A93 L;  2XJQ A;  4POG A;  3S1N L;  4XXB B;  1NXE A;  2XJU A;  1VZH A;  3H99 A;  4AI1 A;  3H9C A;  3S14 L;  4AHZ A;  3HOU L;  3PKJ A;  2O5J D;  1QQT A;  5AI3 A;  5JVH 1;  4AHW A;  5MFZ A;  3S15 L;  4Y7N L;  8RXN A;  3MQK B;  3M4O L;  3PIP 1;  4BBS L;  5MGN A;  1SMM A;  5IY0 A;  3RZO L;  5M5X L;  2DSX A;  3HOY L;  2JI3 A;  1C09 A;  2XJV A;  4AR4 A;  1R0J A;  2HR5 A;  2NVT L;  2MS3 A;  4XGH A;  3PO2 L;  1ODH A;  3KYU A;  2XJR A;  2BE5 D;  5H1S c;  1T9O A;  2WAQ P;  4E6Y A;  1B13 A;  4A3C L;  4GS7 D;  3HOX L;  2AYJ A;  5FJ8 L;  1YV1 A;  2Z3R B;  5IP7 L;  1PZX A;  5IP9 L;  1CAD A;  3PKI A;  3WWN B;  1P7P A;  2PMZ P;  1LTL A;  1PFU A;  2Y0S P;  3RZT A;  4AR3 A;  3S1M L;  4A3K L;  1LKO A;  4A3F L;  4A3E L;  3S1Q L;  2PVE A;  3B0A B;  1R0H A;  2A69 D;  4U67 1;  4TPU A;  2NVX L;  5DM7 1;  1VZG A;  5MLC 3;  2V0E A;  3H97 A;  4JAE A;  1OWC A;  3HAX C;  3VPB E;  5DM6 1;  3RZ6 A;  4AHY A;  5JVG 1;  3GTP L;  2EY4 E;  1Y1W L; 
#chains in the Genus database with same CATH homology
 1VZH A;  4AI1 A;  3LNL A;  4AI3 A;  5EIN C;  2J9U B;  4AHZ A;  2L0Z A;  1B2J A;  3PKJ A;  2O5J D;  2A6E D;  5AI3 A;  1S2Z A;  4AHW A;  7RXN A;  1BE7 A;  1WJV A;  3KYV A;  5K2M E;  5MFZ A;  3KYY A;  2PSM C;  1R0I A;  5GAE c;  2KN9 A;  8RXN A;  1YUX A;  4AHX A;  1IU5 A;  1VCX A;  1YK4 A;  3QQC E;  3PIP 1;  4RXN A;  2CKC A;  1S24 A;  1LKP A;  1R0G A;  2B5I D;  2H12 A;  2LCQ A;  5MGN A;  1SMM A;  1S30 A;  5GAD c;  1RDV A;  5IY0 A;  1IW7 D;  1QCV A;  2DSX A;  1RWD A;  1BRF A;  2JI3 A;  2PYA A;  1IRN A;  2XJP A;  3IU3 I;  3MPS A;  1C09 A;  2A6H D;  1DVB A;  2XJV A;  2NYD A;  4AR4 A;  1R0J A;  2HR5 A;  3J7Z 1;  2MS3 A;  1T9P A;  4XGH A;  4UY8 1;  1ODH A;  2K2D A;  2CKA A;  2M4Y A;  3KYU A;  1RYT A;  1LKM A;  1RYQ A;  2PPT A;  2XJR A;  2XJT A;  5AN9 H;  2C6A A;  2BE5 D;  3SS2 A;  3NFP I;  1RB9 A;  1T9O A;  2V3B B;  3A44 A;  5H1S c;  4E6Y A;  1IU6 A;  1B71 A;  1B13 A;  4ZN3 B;  3RYG A;  3K35 A;  4GS7 D;  2JI2 A;  2KKD A;  3KYX A;  3MSU A;  4POF A;  2AYJ A;  5EIO C;  2ERJ A;  1YV1 A;  2Z3R B;  1JYB A;  4WFN 1;  2M4V A;  1NNQ A;  2GMG A;  2RDV A;  1IRO A;  2M6O A;  1Z92 B;  3PWF A;  5AI2 A;  1CAD A;  4JAG A;  4JAF A;  3PKI A;  4ZN1 B;  1BQ8 A;  3WWN B;  4TVM A;  5MFP A;  3B08 B;  1H7V A;  4B8C D;  1LTL A;  4JAD A;  5JVH 1;  2C6B A;  3KYW A;  3PZA A;  1YUZ A;  4K9F A;  3RZT A;  4ME3 A;  2XJS A;  1R0F A;  2ERS A;  4LHN A;  4AR3 A;  5MF6 A;  5RXN A;  1FHH A;  1QYB A;  1BFY A;  3P8B A;  1E8J A;  1SMW A;  1BQ9 A;  1LKO A;  1CAA A;  2Z3Q B;  4AI0 A;  5GAG c;  4V19 6;  1DX8 A;  1YK5 A;  1OWB A;  1B2O A;  3WWL A;  5GAH c;  2PVE A;  2VL6 A;  3PIO 1;  4AR5 A;  1SMU A;  4YWM A;  4AI2 A;  1RDG A;  3B0A B;  2QL0 A;  3QVD A;  1R0H A;  2A69 D;  2JI1 A;  4G6B A;  4TPU A;  4U67 1;  3J7Y 1;  4AR6 A;  1NXG A;  5DM7 1;  2ZIX A;  4YWL A;  1VZG A;  2PVX A;  5MLC 3;  2CR8 A;  1VZI A;  3ZG6 A;  2V0E A;  2V0F A;  4JAE A;  4LHL A;  1OWC A;  6RXN A;  2M6P A;  1FHM A;  2XJQ A;  1ZRP A;  4POG A;  3P2A A;  3VPB E;  3LPE B;  3RZ6 A;  5DM6 1;  1T9Q A;  4XXB B;  1NXE A;  4AHY A;  2A68 D;  5JVG 1;  2XJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...