1E8JA

Solution structure of desulfovibrio gigas zinc rubredoxin, nmr, 20 structures
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
52
structure length
52
Chain Sequence
MDIYVCTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACPVCGASKDAFEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of Desulfovibrio Gigas Rubredoxin: A Model for Studying Protein Stabilization by Compatible Solutes.
pubmed rcsb
molecule keywords RUBREDOXIN
molecule tags Electron transport
source organism Desulfovibrio gigas
total genus 2
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2000-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1e8jA00
2DSXA 1T9PA 8RXNA 1H7VA 2PYAA 4POGA 4AR3A 3SS2A 1S2ZA 1YK5A 1IU5A 5IY0A 2RDVA 1SMUA 3RYGA 5RXNA 3RZTA 1YUZA 1LKPA 3RZ6A 2V3BB 5AI3A 1IRNA 1C09A 1CADA 1FHMA 1B2OA 3KYVA 4YWMA 1DX8A 3PZAA 2LCQA 4K9FA 3PWFA 5AI2A 1CAAA 1RWDA 2GMGA 2PVXA 1R0HA 4ME3A 1R0IA 3QVDA 4YWLA 1ZRPA 4TPUA 1T9QA 2MS3A 1NNQA 1IROA 1BFYA 3KYXA 1SMMA 3KYUA 1RDGA 2HR5A 1QCVA 1RDVA 6RXNA 2VL6A 2KN9A 4RXNA 1E8JA 1BRFA 1DVBA 1SMWA 1LTLA 1VCXA 1B13A 1LKMA 1S24A 1YK4A 1YV1A 3MPSA 1R0FA 4POFA 3KYYA 1RB9A 1BQ9A 1B2JA 2K2DA 7RXNA 4AR6A 3KYWA 2PVEA 1BE7A 1JYBA 1LKOA 1FHHA 2M4YA 1QYBA 2KKDA 1S30A 1R0JA 1YUXA 1B71A 1BQ8A 2QL0A 3A44A 1IU6A 4AR4A 1T9OA 1R0GA 4AR5A 1RYTA
chains in the Genus database with same CATH superfamily
2DSXA 2XJPA 2NVYL 4POGA 3SS2A 1IU5A 5IY0A 2JA7L 5MLC3 3ZG6A 3PL5A 2Y0SP 3H9BA 1LKPA 4AI0A 2V3BB 5FLML 4A3CL 5DM61 3PZAA 2AYJA 3PWFA 5FJ8L 2M6OA 2CKCA 4LHLA 2PVXA 4AI3A 3H9CA 3QVDA 1TWHL 3FKIL 1T9QA 1BFYA 3WWLA 2XJTA 3GTOL 4B8CD 1RDVA 2ERSA 5GADc 5M3FL 3S1RL 1DVBA 2A69D 1LTLA 3S2HL 2PPTA 3MQKB 1LKMA 5IYDL 3LWQB 4A3DL 1PFWA 2JI2A 3P8BA 3H3VM 3KYYA 4A3JL 5IYCL 1RYQA 4BY7L 5EINC 4V196 2B5ID 3KYWA 3PO2L 1LKOA 3PIP1 1TWAL 3B0AB 4C3JL 2JI3A 5IP7L 1YUXA 2H12A 1BQ8A 4AHYA 3S2DL 1IU6A 5C4JL 1RYTA 1I3QL 2V0FA 1T9PA 5IYBL 1IW7D 2XJVA 2O5JD 4WFN1 1YK5A 3IU3I 5M3ML 2HVYC 3RYGA 3RZTA 4JAFA 3HOZL 1Z92B 4GS7D 3RZ6A 1K83L 4E6YA 1FHMA 2C6AA 3KYVA 1PFVA 3H0GL 4K9FA 5AI2A 5C4XL 4ZN1B 2R93L 1CAAA 4XXBB 3H99A 4BXXL 5M5XL 2V0EA 2GMGA 1R0HA 1R0IA 4YWLA 2ZIXA 1ZRPA 4AI2A 2MS3A 2AQCA 4AHWA 5MF6A 1IROA 1ODHA 4Y52L 3KYUA 2EY4E 2M4VA 1RDGA 2HR5A 1QCVA 3GTJL 3S1QL 3RZOL 1Y1VL 2VL6A 2E2IL 2JI1A 3JR7A 4RXNA 2J9UB 2APOB 1WJVA 1WCML 1I6HL 2R92L 3P2AA 4QIWP 3HOYL 2WB1P 1B13A 3J7Y1 1S24A 3MPSA 1R0FA 1RB9A 4C3HL 2NVTL 3LPEB 1SFOL 7RXNA 1BE7A 3I4ML 1FHHA 4A3FL 2M4YA 5AN9H 4C3IL 1QYBA 3S14L 2QL0A 4A3LL 1R0GA 4TVMA 3M3YL 1PFUA 2E2HL 3K7AL 4JAEA 3RZDL 1H7VA 5C44L 3PKJA 4AR3A 4A3BL 2XJQA 5MGNA 1SMUA 2NVXL 2WAQP 2NVQL 2CKAA 4AHZA 3H97A 1YUZA 2C6BA 2AUSB 3I4NL 3FDJA 2A68D 1IRNA 1TWCL 1C09A 1CADA 4YWMA 3HOVL 1DX8A 4A3EL 3HOWL 1RWDA 3GTKL 2YU9L 2Z3RB 4XGHA 1NNQA 1F4LA 5K2ME 1SMMA 3GTQL 6RXNA 4ZN3B 4C2M1 3CQZL 2PMZP 2VUML 1E8JA 2RFKB 4JADA 3WWNB 3LWOB 1Y1WL 3LWVB 3GTLL 1VCXA 4X6AL 3GTGL 1NXGA 1YK4A 4POFA 4UY81 4AI1A 1BQ9A 3GTML 3NFPI 2K2DA 5JVH1 1JYBA 5MFPA 1P7PA 4A3GL 5M5WL 4A3KL 3LWPB 3HAXC 5GAGc 1VZGA 3K35A 1VZHA 2BE5D 4AR5A 1QQTA 3S1NL 8RXNA 3S16L 2PYAA 1S2ZA 5MFZA 4BBRL 4U671 2NYDA 2RDVA 2M6PA 3HJYB 1OWCA 5RXNA 2JA5L 3PIO1 3B08B 5GAEc 1R9TL 2XJSA 2JA8L 5AI3A 4G6BA 2PSMC 3S15L 4Y7NL 1OWBA 1B2OA 3VPBE 2LCQA 3GTPL 5H1Sc 3S1ML 3LNLA 3LWRB 4ME3A 4TPUA 2L0ZA 4AHXA 4AYBP 3KYXA 3HOXL 3MSUA 4JAGA 4LHNA 2JA6L 3J7Z1 1TWGL 2KN9A 1NXEA 3HJWB 2XJUA 5C3EL 3S17L 1PFYA 2B63L 3QQCE 4A3ML 1BRFA 5M5YL 1SMWA 2A6HD 2Z3QB 4A93L 3PO3L 5GAHc 4A3IL 3HKZP 2A6ED 1I50L 1YV1A 4BY1L 4BBSL 1VZIA 3PKIA 1B2JA 2ERJA 3HOUL 4AR6A 2PVEA 5IP9L 2XJRA 5JVG1 2KKDA 1S30A 5DM71 5EIOC 2R7ZL 1R0JA 3M4OL 1B71A 3A44A 4AR4A 1T9OA 1TWFL 2E2JL 1PZXA 2CR8A
chains in the Genus database with same CATH topology
2DSXA 2V0FA 4JAEA 2XJPA 1T9PA 8RXNA 1H7VA 2PYAA 4POGA 1IW7D 2XJVA 3PKJA 3SS2A 4AR3A 4WFN1 1S2ZA 2O5JD 1YK5A 1IU5A 3IU3I 5MFZA 2XJQA 5IY0A 4U671 2NYDA 2RDVA 5MGNA 1SMUA 2M6PA 5MLC3 3ZG6A 2CKAA 3RYGA 1OWCA 5RXNA 4JAFA 3RZTA 1Z92B 4AHZA 1YUZA 3PIO1 3B08B 4GS7D 5GAEc 2XJSA 1LKPA 2C6BA 3RZ6A 4AI0A 2V3BB 5AI3A 4G6BA 2A68D 1IRNA 2PSMC 4E6YA 5DM61 1C09A 1CADA 1FHMA 1B2OA 1OWBA 2C6AA 3KYVA 4YWMA 1RYTA 3PZAA 3VPBE 2LCQA 2AYJA 4K9FA 3PWFA 5AI2A 5H1Sc 4ZN1B 1CAAA 3LNLA 4XXBB 2M6OA 2CKCA 1RWDA 2V0EA 4LHLA 2GMGA 2PVXA 1R0HA 4AI3A 4ME3A 1R0IA 3QVDA 4YWLA 2ZIXA 1ZRPA 4TPUA 2L0ZA 2Z3RB 1T9QA 4AI2A 4XGHA 2MS3A 1NNQA 4AHWA 4AHXA 5MF6A 1IROA 1BFYA 3KYXA 3WWLA 1ODHA 5K2ME 1SMMA 3MSUA 2XJTA 4JAGA 3KYUA 2M4VA 1RDGA 2HR5A 1QCVA 1RDVA 4LHNA 4B8CD 6RXNA 2ERSA 5GADc 4ZN3B 3J7Z1 2VL6A 2KN9A 1NXEA 2XJUA 2JI1A 4RXNA 2J9UB 1WJVA 3QQCE 1E8JA 1BRFA 1DVBA 1SMWA 2A6HD 2Z3QB 2A69D 4JADA 3WWNB 3P2AA 1LTLA 1VCXA 4TVMA 5GAHc 1NXGA 2PPTA 1B13A 1LKMA 2A6ED 3J7Y1 1S24A 1YK4A 1YV1A 3MPSA 2JI2A 1R0FA 4POFA 3P8BA 4UY81 1DX8A 3KYYA 4AI1A 1RB9A 1BQ9A 1VZIA 3PKIA 1B2JA 3LPEB 3NFPI 2ERJA 1RYQA 5EINC 2K2DA 4V196 2B5ID 7RXNA 4AR6A 3KYWA 2PVEA 1BE7A 5JVH1 1JYBA 1LKOA 2XJRA 3PIP1 1FHHA 5MFPA 3B0AB 2M4YA 5AN9H 5GAGc 5JVG1 1QYBA 2JI3A 2KKDA 1S30A 5DM71 1VZGA 3K35A 5EIOC 1R0JA 1YUXA 2H12A 1VZHA 1B71A 1BQ8A 4AHYA 2QL0A 3A44A 1IU6A 4AR4A 1T9OA 1R0GA 2BE5D 4AR5A 2CR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSX A;  1T9P A;  8RXN A;  1H7V A;  2PYA A;  4POG A;  4AR3 A;  3SS2 A;  1S2Z A;  1YK5 A;  1IU5 A;  5IY0 A;  2RDV A;  1SMU A;  3RYG A;  5RXN A;  3RZT A;  1YUZ A;  1LKP A;  3RZ6 A;  2V3B B;  5AI3 A;  1IRN A;  1C09 A;  1CAD A;  1FHM A;  1B2O A;  3KYV A;  4YWM A;  1DX8 A;  3PZA A;  2LCQ A;  4K9F A;  3PWF A;  5AI2 A;  1CAA A;  1RWD A;  2GMG A;  2PVX A;  1R0H A;  4ME3 A;  1R0I A;  3QVD A;  4YWL A;  1ZRP A;  4TPU A;  1T9Q A;  2MS3 A;  1NNQ A;  1IRO A;  1BFY A;  3KYX A;  1SMM A;  3KYU A;  1RDG A;  2HR5 A;  1QCV A;  1RDV A;  6RXN A;  2VL6 A;  2KN9 A;  4RXN A;  1E8J A;  1BRF A;  1DVB A;  1SMW A;  1LTL A;  1VCX A;  1B13 A;  1LKM A;  1S24 A;  1YK4 A;  1YV1 A;  3MPS A;  1R0F A;  4POF A;  3KYY A;  1RB9 A;  1BQ9 A;  1B2J A;  2K2D A;  7RXN A;  4AR6 A;  3KYW A;  2PVE A;  1BE7 A;  1JYB A;  1LKO A;  1FHH A;  2M4Y A;  1QYB A;  2KKD A;  1S30 A;  1R0J A;  1YUX A;  1B71 A;  1BQ8 A;  2QL0 A;  3A44 A;  1IU6 A;  4AR4 A;  1T9O A;  1R0G A;  4AR5 A;  1RYT A; 
#chains in the Genus database with same CATH topology
 2DSX A;  2XJP A;  2NVY L;  4POG A;  3SS2 A;  1IU5 A;  5IY0 A;  2JA7 L;  5MLC 3;  3ZG6 A;  3PL5 A;  2Y0S P;  3H9B A;  1LKP A;  4AI0 A;  2V3B B;  5FLM L;  4A3C L;  5DM6 1;  3PZA A;  2AYJ A;  3PWF A;  5FJ8 L;  2M6O A;  2CKC A;  4LHL A;  2PVX A;  4AI3 A;  3H9C A;  3QVD A;  1TWH L;  3FKI L;  1T9Q A;  1BFY A;  3WWL A;  2XJT A;  3GTO L;  4B8C D;  1RDV A;  2ERS A;  5GAD c;  5M3F L;  3S1R L;  1DVB A;  2A69 D;  1LTL A;  3S2H L;  2PPT A;  3MQK B;  1LKM A;  5IYD L;  3LWQ B;  4A3D L;  1PFW A;  2JI2 A;  3P8B A;  3H3V M;  3KYY A;  4A3J L;  5IYC L;  1RYQ A;  4BY7 L;  5EIN C;  4V19 6;  2B5I D;  3KYW A;  3PO2 L;  1LKO A;  3PIP 1;  1TWA L;  3B0A B;  4C3J L;  2JI3 A;  5IP7 L;  1YUX A;  2H12 A;  1BQ8 A;  4AHY A;  3S2D L;  1IU6 A;  5C4J L;  1RYT A;  1I3Q L;  2V0F A;  1T9P A;  5IYB L;  1IW7 D;  2XJV A;  2O5J D;  4WFN 1;  1YK5 A;  3IU3 I;  5M3M L;  2HVY C;  3RYG A;  3RZT A;  4JAF A;  3HOZ L;  1Z92 B;  4GS7 D;  3RZ6 A;  1K83 L;  4E6Y A;  1FHM A;  2C6A A;  3KYV A;  1PFV A;  3H0G L;  4K9F A;  5AI2 A;  5C4X L;  4ZN1 B;  2R93 L;  1CAA A;  4XXB B;  3H99 A;  4BXX L;  5M5X L;  2V0E A;  2GMG A;  1R0H A;  1R0I A;  4YWL A;  2ZIX A;  1ZRP A;  4AI2 A;  2MS3 A;  2AQC A;  4AHW A;  5MF6 A;  1IRO A;  1ODH A;  4Y52 L;  3KYU A;  2EY4 E;  2M4V A;  1RDG A;  2HR5 A;  1QCV A;  3GTJ L;  3S1Q L;  3RZO L;  1Y1V L;  2VL6 A;  2E2I L;  2JI1 A;  3JR7 A;  4RXN A;  2J9U B;  2APO B;  1WJV A;  1WCM L;  1I6H L;  2R92 L;  3P2A A;  4QIW P;  3HOY L;  2WB1 P;  1B13 A;  3J7Y 1;  1S24 A;  3MPS A;  1R0F A;  1RB9 A;  4C3H L;  2NVT L;  3LPE B;  1SFO L;  7RXN A;  1BE7 A;  3I4M L;  1FHH A;  4A3F L;  2M4Y A;  5AN9 H;  4C3I L;  1QYB A;  3S14 L;  2QL0 A;  4A3L L;  1R0G A;  4TVM A;  3M3Y L;  1PFU A;  2E2H L;  3K7A L;  4JAE A;  3RZD L;  1H7V A;  5C44 L;  3PKJ A;  4AR3 A;  4A3B L;  2XJQ A;  5MGN A;  1SMU A;  2NVX L;  2WAQ P;  2NVQ L;  2CKA A;  4AHZ A;  3H97 A;  1YUZ A;  2C6B A;  2AUS B;  3I4N L;  3FDJ A;  2A68 D;  1IRN A;  1TWC L;  1C09 A;  1CAD A;  4YWM A;  3HOV L;  1DX8 A;  4A3E L;  3HOW L;  1RWD A;  3GTK L;  2YU9 L;  2Z3R B;  4XGH A;  1NNQ A;  1F4L A;  5K2M E;  1SMM A;  3GTQ L;  6RXN A;  4ZN3 B;  4C2M 1;  3CQZ L;  2PMZ P;  2VUM L;  1E8J A;  2RFK B;  4JAD A;  3WWN B;  3LWO B;  1Y1W L;  3LWV B;  3GTL L;  1VCX A;  4X6A L;  3GTG L;  1NXG A;  1YK4 A;  4POF A;  4UY8 1;  4AI1 A;  1BQ9 A;  3GTM L;  3NFP I;  2K2D A;  5JVH 1;  1JYB A;  5MFP A;  1P7P A;  4A3G L;  5M5W L;  4A3K L;  3LWP B;  3HAX C;  5GAG c;  1VZG A;  3K35 A;  1VZH A;  2BE5 D;  4AR5 A;  1QQT A;  3S1N L;  8RXN A;  3S16 L;  2PYA A;  1S2Z A;  5MFZ A;  4BBR L;  4U67 1;  2NYD A;  2RDV A;  2M6P A;  3HJY B;  1OWC A;  5RXN A;  2JA5 L;  3PIO 1;  3B08 B;  5GAE c;  1R9T L;  2XJS A;  2JA8 L;  5AI3 A;  4G6B A;  2PSM C;  3S15 L;  4Y7N L;  1OWB A;  1B2O A;  3VPB E;  2LCQ A;  3GTP L;  5H1S c;  3S1M L;  3LNL A;  3LWR B;  4ME3 A;  4TPU A;  2L0Z A;  4AHX A;  4AYB P;  3KYX A;  3HOX L;  3MSU A;  4JAG A;  4LHN A;  2JA6 L;  3J7Z 1;  1TWG L;  2KN9 A;  1NXE A;  3HJW B;  2XJU A;  5C3E L;  3S17 L;  1PFY A;  2B63 L;  3QQC E;  4A3M L;  1BRF A;  5M5Y L;  1SMW A;  2A6H D;  2Z3Q B;  4A93 L;  3PO3 L;  5GAH c;  4A3I L;  3HKZ P;  2A6E D;  1I50 L;  1YV1 A;  4BY1 L;  4BBS L;  1VZI A;  3PKI A;  1B2J A;  2ERJ A;  3HOU L;  4AR6 A;  2PVE A;  5IP9 L;  2XJR A;  5JVG 1;  2KKD A;  1S30 A;  5DM7 1;  5EIO C;  2R7Z L;  1R0J A;  3M4O L;  1B71 A;  3A44 A;  4AR4 A;  1T9O A;  1TWF L;  2E2J L;  1PZX A;  2CR8 A; 
#chains in the Genus database with same CATH homology
 2DSX A;  2V0F A;  4JAE A;  2XJP A;  1T9P A;  8RXN A;  1H7V A;  2PYA A;  4POG A;  1IW7 D;  2XJV A;  3PKJ A;  3SS2 A;  4AR3 A;  4WFN 1;  1S2Z A;  2O5J D;  1YK5 A;  1IU5 A;  3IU3 I;  5MFZ A;  2XJQ A;  5IY0 A;  4U67 1;  2NYD A;  2RDV A;  5MGN A;  1SMU A;  2M6P A;  5MLC 3;  3ZG6 A;  2CKA A;  3RYG A;  1OWC A;  5RXN A;  4JAF A;  3RZT A;  1Z92 B;  4AHZ A;  1YUZ A;  3PIO 1;  3B08 B;  4GS7 D;  5GAE c;  2XJS A;  1LKP A;  2C6B A;  3RZ6 A;  4AI0 A;  2V3B B;  5AI3 A;  4G6B A;  2A68 D;  1IRN A;  2PSM C;  4E6Y A;  5DM6 1;  1C09 A;  1CAD A;  1FHM A;  1B2O A;  1OWB A;  2C6A A;  3KYV A;  4YWM A;  1RYT A;  3PZA A;  3VPB E;  2LCQ A;  2AYJ A;  4K9F A;  3PWF A;  5AI2 A;  5H1S c;  4ZN1 B;  1CAA A;  3LNL A;  4XXB B;  2M6O A;  2CKC A;  1RWD A;  2V0E A;  4LHL A;  2GMG A;  2PVX A;  1R0H A;  4AI3 A;  4ME3 A;  1R0I A;  3QVD A;  4YWL A;  2ZIX A;  1ZRP A;  4TPU A;  2L0Z A;  2Z3R B;  1T9Q A;  4AI2 A;  4XGH A;  2MS3 A;  1NNQ A;  4AHW A;  4AHX A;  5MF6 A;  1IRO A;  1BFY A;  3KYX A;  3WWL A;  1ODH A;  5K2M E;  1SMM A;  3MSU A;  2XJT A;  4JAG A;  3KYU A;  2M4V A;  1RDG A;  2HR5 A;  1QCV A;  1RDV A;  4LHN A;  4B8C D;  6RXN A;  2ERS A;  5GAD c;  4ZN3 B;  3J7Z 1;  2VL6 A;  2KN9 A;  1NXE A;  2XJU A;  2JI1 A;  4RXN A;  2J9U B;  1WJV A;  3QQC E;  1E8J A;  1BRF A;  1DVB A;  1SMW A;  2A6H D;  2Z3Q B;  2A69 D;  4JAD A;  3WWN B;  3P2A A;  1LTL A;  1VCX A;  4TVM A;  5GAH c;  1NXG A;  2PPT A;  1B13 A;  1LKM A;  2A6E D;  3J7Y 1;  1S24 A;  1YK4 A;  1YV1 A;  3MPS A;  2JI2 A;  1R0F A;  4POF A;  3P8B A;  4UY8 1;  1DX8 A;  3KYY A;  4AI1 A;  1RB9 A;  1BQ9 A;  1VZI A;  3PKI A;  1B2J A;  3LPE B;  3NFP I;  2ERJ A;  1RYQ A;  5EIN C;  2K2D A;  4V19 6;  2B5I D;  7RXN A;  4AR6 A;  3KYW A;  2PVE A;  1BE7 A;  5JVH 1;  1JYB A;  1LKO A;  2XJR A;  3PIP 1;  1FHH A;  5MFP A;  3B0A B;  2M4Y A;  5AN9 H;  5GAG c;  5JVG 1;  1QYB A;  2JI3 A;  2KKD A;  1S30 A;  5DM7 1;  1VZG A;  3K35 A;  5EIO C;  1R0J A;  1YUX A;  2H12 A;  1VZH A;  1B71 A;  1BQ8 A;  4AHY A;  2QL0 A;  3A44 A;  1IU6 A;  4AR4 A;  1T9O A;  1R0G A;  2BE5 D;  4AR5 A;  2CR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...