1E8JA

Solution structure of desulfovibrio gigas zinc rubredoxin, nmr, 20 structures
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
52
structure length
52
Chain Sequence
b'MDIYVCTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACPVCGASKDAFEKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title NMR Structure of Desulfovibrio Gigas Rubredoxin: A Model for Studying Protein Stabilization by Compatible Solutes.
pubmed rcsb
source organism Desulfovibrio gigas
molecule tags Electron transport
total genus 2
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2000-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1e8jA00
6RXNA 1T9PA 1T9QA 1LKMA 4POFA 3KYXA 1QCVA 1C09A 1RB9A 3RZTA 2V3BB 2HR5A 1RDVA 1IU5A 3MPSA 1RDGA 1QYBA 2KN9A 8RXNA 1SMUA 4AR5A 1DVBA 1S24A 1B2OA 4RXNA 5RXNA 1YK5A 2DSXA 2GMGA 1T9OA 1IRNA 1SMMA 1BFYA 5AI3A 2K2DA 1S2ZA 1R0GA 1R0IA 1FHMA 1RYTA 1H7VA 1B13A 4YWLA 1B2JA 1IROA 1R0FA 1E8JA 2QL0A 1JYBA 1FHHA 3KYUA 1IU6A 2M4YA 3KYYA 4TPUA 1R0HA 4AR4A 1LTLA 1S30A 1DX8A 4ME3A 4K9FA 3PZAA 3A44A 1LKPA 1SMWA 2KKDA 1BQ8A 5AI2A 7RXNA 1BE7A 4AR6A 2RDVA 2PVEA 3QVDA 1NNQA 3KYWA 1BRFA 3PWFA 1CADA 4POGA 1YV1A 1R0JA 5IY0A 1BQ9A 1YK4A 3RYGA 2MS3A 1CAAA 1VCXA 3RZ6A 1YUXA 4AR3A 2VL6A 2PYAA 1YUZA 3SS2A 2PVXA 1LKOA 3KYVA 1B71A 1RWDA 1ZRPA 2LCQA 4YWMA
chains in the Genus database with same CATH superfamily
3GTML 2Z3QB 5MLC3 1T9QA 2R93L 4C3IL 2A6ED 3ZG6A 2A69D 3PIP1 1C09A 1RB9A 4LHNA 2HR5A 4C3HL 3MPSA 4AHYA 5H1Sc 2NVTL 2JA7L 3GTPL 5C4XL 3GTJL 1YK5A 2APOB 2DSXA 3LNLA 3J7Z1 2PSMC 5M5YL 4JAFA 1IRNA 3HKZP 2M4VA 3J7Y1 3M4OL 2E2JL 1R0IA 3B08B 3HOWL 2E2IL 2EY4E 4BY7L 3WWNB 3S16L 5GADc 1FHHA 3WWLA 3KYUA 1IU6A 3PL5A 4AR4A 3KYYA 1S30A 4ME3A 2NVYL 3H3VM 2Y0SP 7RXNA 5GAGc 4XGHA 5C4JL 5GAHc 3I4ML 3GTKL 3KYWA 4A93L 1BRFA 2JI1A 2HVYC 1R0JA 5IY0A 4BXXL 3PKIA 2MS3A 3K7AL 3RZ6A 1Z92B 2M6OA 2CKCA 3P2AA 3LWVB 4A3ML 3H0GL 3MSUA 3JR7A 4JADA 1I6HL 3S1NL 2PPTA 3S2HL 1F4LA 2XJPA 1Y1WL 3GTQL 1I50L 3HOYL 2A68D 4AHWA 4B8CD 3RZTA 2V3BB 5MGNA 2H12A 4A3GL 1RDGA 1QYBA 3PO3L 4A3KL 1DVBA 1S24A 1OWBA 1PFVA 4RXNA 1PFUA 5M5XL 2CR8A 5RXNA 2GMGA 2Z3RB 1SMMA 1ODHA 5IYCL 4AYBP 3LWRB 1RYQA 2ERJA 3H9CA 3LWOB 5FLML 4G6BA 3RZDL 3S2DL 4BBSL 3H99A 2JI2A 3GTGL 4A3LL 3HOUL 4XXBB 4JAEA 5FJ8L 3LWQB 1JYBA 2R92L 5EINC 2C6BA 1TWFL 2M4YA 4TPUA 3PKJA 1DX8A 2JA8L 1LKPA 1PZXA 1SMWA 2KKDA 1BQ8A 2AYJA 5M3FL 4AR6A 4Y7NL 2PVEA 1NNQA 4JAGA 3PWFA 1YV1A 1YK4A 4U671 2JI3A 1CAAA 2VL6A 3HOZL 2JA6L 3CQZL 1YUZA 3IU3I 4TVMA 3GTLL 2XJUA 2NVQL 1QQTA 4A3CL 3FKIL 2AUSB 5JVG1 2WAQP 3FDJA 1VZIA 1Y1VL 1LKMA 4POFA 1I3QL 1P7PA 1QCVA 1OWCA 5IP9L 5MFPA 1RDVA 1VZGA 2C6AA 2NVXL 3S1RL 8RXNA 4AR5A 5IP7L 4ZN3B 1R9TL 3PIO1 1T9OA 4BBRL 1IW7D 1PFWA 2XJSA 1WJVA 2XJQA 2K2DA 5AI3A 1S2ZA 1R0GA 2V0FA 3LPEB 3S15L 3H9BA 1TWGL 3M3YL 4YWLA 4C3JL 2PMZP 1K83L 5EIOC 2JA5L 1E8JA 4AI2A 2YU9L 5MF6A 1WCML 1R0HA 2WB1P 5GAEc 1LTLA 4A3JL 3PZAA 4UY81 3A44A 2R7ZL 1TWCL 2ERSA 5K2ME 2B63L 4V196 3LWPB 4POGA 5M5WL 4X6AL 3RYGA 1VZHA 4AI1A 2NYDA 2A6HD 1TWAL 1VCXA 1YUXA 1NXGA 4AR3A 4ZN1B 2RFKB 3SS2A 2PVXA 1LKOA 4A3BL 3KYVA 5MFZA 4Y52L 3I4NL 5IYBL 4A3IL 1RWDA 3QQCE 4YWMA 4GS7D 6RXNA 1T9PA 3HJYB 4AHXA 5M3ML 3K35A 1NXEA 3KYXA 5JVH1 3P8BA 5DM61 4AI3A 1IU5A 4A3FL 2KN9A 2XJRA 1SMUA 3B0AB 4A3DL 3MQKB 1B2OA 4WFN1 3HAXC 4A3EL 3HJWB 2J9UB 3PO2L 2XJVA 1BFYA 2ZIXA 4QIWP 3GTOL 2XJTA 1FHMA 1RYTA 3VPBE 1H7VA 2B5ID 1B13A 3S1QL 1B2JA 3S17L 1IROA 3RZOL 1R0FA 2QL0A 5IYDL 1SFOL 3H97A 3NFPI 4K9FA 2CKAA 2VUML 1PFYA 5AI2A 3S1ML 3S14L 5C44L 1BE7A 2RDVA 2E2HL 2AQCA 3QVDA 1TWHL 1CADA 1BQ9A 2BE5D 4AHZA 2PYAA 4AI0A 4LHLA 2O5JD 2L0ZA 2M6PA 4C2M1 3HOVL 2V0EA 5C3EL 5AN9H 1B71A 5DM71 4E6YA 1ZRPA 2LCQA 3HOXL 4BY1L
chains in the Genus database with same CATH topology
4GS7D 5JVG1 6RXNA 1T9PA 2Z3QB 1VZIA 4AHXA 5MLC3 2XJPA 1T9QA 1LKMA 4POFA 3K35A 1NXEA 2A6ED 3ZG6A 3KYXA 2A69D 2A68D 1QCVA 4AHWA 4B8CD 3P8BA 1C09A 1OWCA 3PIP1 5JVH1 5DM61 1RB9A 3RZTA 2V3BB 2HR5A 4LHNA 4AI3A 5MFPA 5MGNA 1RDVA 1VZGA 2C6AA 1IU5A 3MPSA 2H12A 4AHYA 5H1Sc 1RDGA 1QYBA 2KN9A 2XJRA 8RXNA 1SMUA 4AR5A 3B0AB 1DVBA 1S24A 1OWBA 1B2OA 4RXNA 2CR8A 5RXNA 1YK5A 2DSXA 3LNLA 4WFN1 3J7Z1 4ZN3B 2PSMC 2GMGA 3PIO1 1T9OA 2J9UB 4JAFA 2Z3RB 1IRNA 1SMMA 1ODHA 2M4VA 1IW7D 3J7Y1 2XJVA 1BFYA 2XJSA 1WJVA 2XJQA 2K2DA 2ZIXA 5AI3A 1S2ZA 2V0FA 1RYQA 2XJTA 1FHMA 1RYTA 2ERJA 3LPEB 2B5ID 1R0IA 1R0GA 1B13A 3VPBE 1H7VA 3B08B 4YWLA 4G6BA 1B2JA 2JI2A 1IROA 5EIOC 1R0FA 1E8JA 4AI2A 2QL0A 4XXBB 5MF6A 4JAEA 3WWNB 5GADc 1JYBA 1FHHA 3WWLA 5EINC 2C6BA 3KYUA 1IU6A 2M4YA 3KYYA 4TPUA 1R0HA 4AR4A 3NFPI 1LTLA 3PKJA 1S30A 5GAEc 1DX8A 4ME3A 4K9FA 3PZAA 4UY81 3A44A 2CKAA 1LKPA 1SMWA 2KKDA 1BQ8A 5AI2A 7RXNA 5GAGc 2AYJA 1BE7A 4XGHA 4AR6A 2RDVA 2ERSA 2PVEA 5GAHc 5K2ME 4V196 1NNQA 3QVDA 3KYWA 1BRFA 2JI1A 4JAGA 3PWFA 1CADA 4POGA 1YV1A 1R0JA 5IY0A 1BQ9A 1VZHA 1YK4A 3RYGA 3PKIA 2MS3A 4U671 4AI1A 2JI3A 2A6HD 2BE5D 2NYDA 1CAAA 1VCXA 3RZ6A 1YUXA 1Z92B 2M6OA 1NXGA 2CKCA 2VL6A 3P2AA 4AHZA 4AR3A 4ZN1B 2PYAA 1YUZA 4AI0A 4LHLA 3SS2A 2O5JD 2L0ZA 1LKOA 2PVXA 2M6PA 2V0EA 3KYVA 3IU3I 4TVMA 3MSUA 5MFZA 5AN9H 4JADA 2XJUA 1B71A 5DM71 1RWDA 4E6YA 1ZRPA 2LCQA 3QQCE 2PPTA 4YWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6RXN A;  1T9P A;  1T9Q A;  1LKM A;  4POF A;  3KYX A;  1QCV A;  1C09 A;  1RB9 A;  3RZT A;  2V3B B;  2HR5 A;  1RDV A;  1IU5 A;  3MPS A;  1RDG A;  1QYB A;  2KN9 A;  8RXN A;  1SMU A;  4AR5 A;  1DVB A;  1S24 A;  1B2O A;  4RXN A;  5RXN A;  1YK5 A;  2DSX A;  2GMG A;  1T9O A;  1IRN A;  1SMM A;  1BFY A;  5AI3 A;  2K2D A;  1S2Z A;  1R0G A;  1R0I A;  1FHM A;  1RYT A;  1H7V A;  1B13 A;  4YWL A;  1B2J A;  1IRO A;  1R0F A;  1E8J A;  2QL0 A;  1JYB A;  1FHH A;  3KYU A;  1IU6 A;  2M4Y A;  3KYY A;  4TPU A;  1R0H A;  4AR4 A;  1LTL A;  1S30 A;  1DX8 A;  4ME3 A;  4K9F A;  3PZA A;  3A44 A;  1LKP A;  1SMW A;  2KKD A;  1BQ8 A;  5AI2 A;  7RXN A;  1BE7 A;  4AR6 A;  2RDV A;  2PVE A;  3QVD A;  1NNQ A;  3KYW A;  1BRF A;  3PWF A;  1CAD A;  4POG A;  1YV1 A;  1R0J A;  5IY0 A;  1BQ9 A;  1YK4 A;  3RYG A;  2MS3 A;  1CAA A;  1VCX A;  3RZ6 A;  1YUX A;  4AR3 A;  2VL6 A;  2PYA A;  1YUZ A;  3SS2 A;  2PVX A;  1LKO A;  3KYV A;  1B71 A;  1RWD A;  1ZRP A;  2LCQ A;  4YWM A; 
#chains in the Genus database with same CATH topology
 3GTM L;  2Z3Q B;  5MLC 3;  1T9Q A;  2R93 L;  4C3I L;  2A6E D;  3ZG6 A;  2A69 D;  3PIP 1;  1C09 A;  1RB9 A;  4LHN A;  2HR5 A;  4C3H L;  3MPS A;  4AHY A;  5H1S c;  2NVT L;  2JA7 L;  3GTP L;  5C4X L;  3GTJ L;  1YK5 A;  2APO B;  2DSX A;  3LNL A;  3J7Z 1;  2PSM C;  5M5Y L;  4JAF A;  1IRN A;  3HKZ P;  2M4V A;  3J7Y 1;  3M4O L;  2E2J L;  1R0I A;  3B08 B;  3HOW L;  2E2I L;  2EY4 E;  4BY7 L;  3WWN B;  3S16 L;  5GAD c;  1FHH A;  3WWL A;  3KYU A;  1IU6 A;  3PL5 A;  4AR4 A;  3KYY A;  1S30 A;  4ME3 A;  2NVY L;  3H3V M;  2Y0S P;  7RXN A;  5GAG c;  4XGH A;  5C4J L;  5GAH c;  3I4M L;  3GTK L;  3KYW A;  4A93 L;  1BRF A;  2JI1 A;  2HVY C;  1R0J A;  5IY0 A;  4BXX L;  3PKI A;  2MS3 A;  3K7A L;  3RZ6 A;  1Z92 B;  2M6O A;  2CKC A;  3P2A A;  3LWV B;  4A3M L;  3H0G L;  3MSU A;  3JR7 A;  4JAD A;  1I6H L;  3S1N L;  2PPT A;  3S2H L;  1F4L A;  2XJP A;  1Y1W L;  3GTQ L;  1I50 L;  3HOY L;  2A68 D;  4AHW A;  4B8C D;  3RZT A;  2V3B B;  5MGN A;  2H12 A;  4A3G L;  1RDG A;  1QYB A;  3PO3 L;  4A3K L;  1DVB A;  1S24 A;  1OWB A;  1PFV A;  4RXN A;  1PFU A;  5M5X L;  2CR8 A;  5RXN A;  2GMG A;  2Z3R B;  1SMM A;  1ODH A;  5IYC L;  4AYB P;  3LWR B;  1RYQ A;  2ERJ A;  3H9C A;  3LWO B;  5FLM L;  4G6B A;  3RZD L;  3S2D L;  4BBS L;  3H99 A;  2JI2 A;  3GTG L;  4A3L L;  3HOU L;  4XXB B;  4JAE A;  5FJ8 L;  3LWQ B;  1JYB A;  2R92 L;  5EIN C;  2C6B A;  1TWF L;  2M4Y A;  4TPU A;  3PKJ A;  1DX8 A;  2JA8 L;  1LKP A;  1PZX A;  1SMW A;  2KKD A;  1BQ8 A;  2AYJ A;  5M3F L;  4AR6 A;  4Y7N L;  2PVE A;  1NNQ A;  4JAG A;  3PWF A;  1YV1 A;  1YK4 A;  4U67 1;  2JI3 A;  1CAA A;  2VL6 A;  3HOZ L;  2JA6 L;  3CQZ L;  1YUZ A;  3IU3 I;  4TVM A;  3GTL L;  2XJU A;  2NVQ L;  1QQT A;  4A3C L;  3FKI L;  2AUS B;  5JVG 1;  2WAQ P;  3FDJ A;  1VZI A;  1Y1V L;  1LKM A;  4POF A;  1I3Q L;  1P7P A;  1QCV A;  1OWC A;  5IP9 L;  5MFP A;  1RDV A;  1VZG A;  2C6A A;  2NVX L;  3S1R L;  8RXN A;  4AR5 A;  5IP7 L;  4ZN3 B;  1R9T L;  3PIO 1;  1T9O A;  4BBR L;  1IW7 D;  1PFW A;  2XJS A;  1WJV A;  2XJQ A;  2K2D A;  5AI3 A;  1S2Z A;  1R0G A;  2V0F A;  3LPE B;  3S15 L;  3H9B A;  1TWG L;  3M3Y L;  4YWL A;  4C3J L;  2PMZ P;  1K83 L;  5EIO C;  2JA5 L;  1E8J A;  4AI2 A;  2YU9 L;  5MF6 A;  1WCM L;  1R0H A;  2WB1 P;  5GAE c;  1LTL A;  4A3J L;  3PZA A;  4UY8 1;  3A44 A;  2R7Z L;  1TWC L;  2ERS A;  5K2M E;  2B63 L;  4V19 6;  3LWP B;  4POG A;  5M5W L;  4X6A L;  3RYG A;  1VZH A;  4AI1 A;  2NYD A;  2A6H D;  1TWA L;  1VCX A;  1YUX A;  1NXG A;  4AR3 A;  4ZN1 B;  2RFK B;  3SS2 A;  2PVX A;  1LKO A;  4A3B L;  3KYV A;  5MFZ A;  4Y52 L;  3I4N L;  5IYB L;  4A3I L;  1RWD A;  3QQC E;  4YWM A;  4GS7 D;  6RXN A;  1T9P A;  3HJY B;  4AHX A;  5M3M L;  3K35 A;  1NXE A;  3KYX A;  5JVH 1;  3P8B A;  5DM6 1;  4AI3 A;  1IU5 A;  4A3F L;  2KN9 A;  2XJR A;  1SMU A;  3B0A B;  4A3D L;  3MQK B;  1B2O A;  4WFN 1;  3HAX C;  4A3E L;  3HJW B;  2J9U B;  3PO2 L;  2XJV A;  1BFY A;  2ZIX A;  4QIW P;  3GTO L;  2XJT A;  1FHM A;  1RYT A;  3VPB E;  1H7V A;  2B5I D;  1B13 A;  3S1Q L;  1B2J A;  3S17 L;  1IRO A;  3RZO L;  1R0F A;  2QL0 A;  5IYD L;  1SFO L;  3H97 A;  3NFP I;  4K9F A;  2CKA A;  2VUM L;  1PFY A;  5AI2 A;  3S1M L;  3S14 L;  5C44 L;  1BE7 A;  2RDV A;  2E2H L;  2AQC A;  3QVD A;  1TWH L;  1CAD A;  1BQ9 A;  2BE5 D;  4AHZ A;  2PYA A;  4AI0 A;  4LHL A;  2O5J D;  2L0Z A;  2M6P A;  4C2M 1;  3HOV L;  2V0E A;  5C3E L;  5AN9 H;  1B71 A;  5DM7 1;  4E6Y A;  1ZRP A;  2LCQ A;  3HOX L;  4BY1 L; 
#chains in the Genus database with same CATH homology
 4GS7 D;  5JVG 1;  6RXN A;  1T9P A;  2Z3Q B;  1VZI A;  4AHX A;  5MLC 3;  2XJP A;  1T9Q A;  1LKM A;  4POF A;  3K35 A;  1NXE A;  2A6E D;  3ZG6 A;  3KYX A;  2A69 D;  2A68 D;  1QCV A;  4AHW A;  4B8C D;  3P8B A;  1C09 A;  1OWC A;  3PIP 1;  5JVH 1;  5DM6 1;  1RB9 A;  3RZT A;  2V3B B;  2HR5 A;  4LHN A;  4AI3 A;  5MFP A;  5MGN A;  1RDV A;  1VZG A;  2C6A A;  1IU5 A;  3MPS A;  2H12 A;  4AHY A;  5H1S c;  1RDG A;  1QYB A;  2KN9 A;  2XJR A;  8RXN A;  1SMU A;  4AR5 A;  3B0A B;  1DVB A;  1S24 A;  1OWB A;  1B2O A;  4RXN A;  2CR8 A;  5RXN A;  1YK5 A;  2DSX A;  3LNL A;  4WFN 1;  3J7Z 1;  4ZN3 B;  2PSM C;  2GMG A;  3PIO 1;  1T9O A;  2J9U B;  4JAF A;  2Z3R B;  1IRN A;  1SMM A;  1ODH A;  2M4V A;  1IW7 D;  3J7Y 1;  2XJV A;  1BFY A;  2XJS A;  1WJV A;  2XJQ A;  2K2D A;  2ZIX A;  5AI3 A;  1S2Z A;  2V0F A;  1RYQ A;  2XJT A;  1FHM A;  1RYT A;  2ERJ A;  3LPE B;  2B5I D;  1R0I A;  1R0G A;  1B13 A;  3VPB E;  1H7V A;  3B08 B;  4YWL A;  4G6B A;  1B2J A;  2JI2 A;  1IRO A;  5EIO C;  1R0F A;  1E8J A;  4AI2 A;  2QL0 A;  4XXB B;  5MF6 A;  4JAE A;  3WWN B;  5GAD c;  1JYB A;  1FHH A;  3WWL A;  5EIN C;  2C6B A;  3KYU A;  1IU6 A;  2M4Y A;  3KYY A;  4TPU A;  1R0H A;  4AR4 A;  3NFP I;  1LTL A;  3PKJ A;  1S30 A;  5GAE c;  1DX8 A;  4ME3 A;  4K9F A;  3PZA A;  4UY8 1;  3A44 A;  2CKA A;  1LKP A;  1SMW A;  2KKD A;  1BQ8 A;  5AI2 A;  7RXN A;  5GAG c;  2AYJ A;  1BE7 A;  4XGH A;  4AR6 A;  2RDV A;  2ERS A;  2PVE A;  5GAH c;  5K2M E;  4V19 6;  1NNQ A;  3QVD A;  3KYW A;  1BRF A;  2JI1 A;  4JAG A;  3PWF A;  1CAD A;  4POG A;  1YV1 A;  1R0J A;  5IY0 A;  1BQ9 A;  1VZH A;  1YK4 A;  3RYG A;  3PKI A;  2MS3 A;  4U67 1;  4AI1 A;  2JI3 A;  2A6H D;  2BE5 D;  2NYD A;  1CAA A;  1VCX A;  3RZ6 A;  1YUX A;  1Z92 B;  2M6O A;  1NXG A;  2CKC A;  2VL6 A;  3P2A A;  4AHZ A;  4AR3 A;  4ZN1 B;  2PYA A;  1YUZ A;  4AI0 A;  4LHL A;  3SS2 A;  2O5J D;  2L0Z A;  1LKO A;  2PVX A;  2M6P A;  2V0E A;  3KYV A;  3IU3 I;  4TVM A;  3MSU A;  5MFZ A;  5AN9 H;  4JAD A;  2XJU A;  1B71 A;  5DM7 1;  1RWD A;  4E6Y A;  1ZRP A;  2LCQ A;  3QQC E;  2PPT A;  4YWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...