1I9BA

X-ray structure of acetylcholine binding protein (achbp)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
FDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE BINDING PROTEIN
publication title Crystal structure of an ACh-binding protein reveals the ligand-binding domain of nicotinic receptors.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Ligand binding protein
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 1i9bA00
4PIRA 5HCMA 3RQWA 3WTKA 4IL4A 2XNUA 4HFHA 4TWFA 5HEJA 2QC1B 3SH1A 4LMJA 2C9TA 4QH1A 2PGZA 3U8LA 2ZJUA 3WTLA 4EZ1A 3JADA 5SYOA 3TLTA 3RHWA 3C84A 2XQ9A 2YOEA 3TLSA 4FRRA 2WZYA 4HFCA 3IGQA 4TWDA 5J5FA 3TLVA 3U8JA 2XZ6A 4LMKA 3TLWA 5HEOA 3ZKRA 5IUXA 4TNWA 4UM3S 4UY2A 2BR8A 2BYSA 5FJVA 5J5HA 5CO5A 2WN9A 2XQ5A 4NZBA 5AINA 2XQ7A 5AFJA 4ZZBA 2W8FA 3UU4A 2Y7YA 5J5IA 2BR7A 4UM3P 2BYQA 3T4MA 5BP0A 2BG9A 4ZJTA 2XQ3A 4ILBA 3RIFA 3WTMA 3UUBA 4A97A 4AFTA 2Y56A 3WIPA 1UV6A 5BRXA 2WNLA 5BW2A 2XQ6A 2X00D 4X5TA 3SQ9A 2PH9A 3PMZA 5HEUA 4BFQA 2Y58A 2BG9B 4AFHA 4Z90A 4TWHA 2XNVA 4HFDA 4ZK4A 3GUAA 2BYPA 3RQUA 3TLUA 2BG9E 4IREA 4ILCA 2YN6A 4DBMA 5LG3A 4IL9A 4F8HA 4UM3A 2XQ8A 4HFIA 4HQPA 3SIOA 4COFA 4UM1A 2YMEA 3WTJA 4QH5A 3WTHA 2UZ6A 3P4WA 5HEGA 5L47A 2BJ0A 3P50A 5JMEA 3U8NA 3EHZA 5TVCA 2YMDA 4LMLA 3WTOA 2BYRA 1I9BA 4ZJSA 5KZUA 4TNVA 4BQTA 4UXUA 4ALXA 2XYTA 5KE4A 4ZR6A 2BYNA 4QABA 5L4HA 3WTIA 3U8MA 5AFLA 4QACA 4ZK1A 2ZJVA 5L4EA 2XNTA 3EAMA 4D01A 2Y54A 2XQAA 3UU8A 4A98A 4QAAA 4B5DA 3UQ7A 2WNCA 3UU6A 1UW6A 5HCJA 5CFBA 2XYSA 5AFMA 3RI5A 3EI0A 3C79A 2VL0A 4AFGA 3LSVA 4NPPA 4HFBA 3UU3A 4Z91A 3RIAA 3JAFA 4XK9A 3UU5A 4QH4A 5AFKA 3JAEA 3ZDGA 5LXBA 5HEHA 4ZRUA 4HFEA 5AFMB 2XZ5A 5J5GA 4WV9A 2W8GA 2WNJA 4ILAA 2BG9C 4ZZCA 2YKSA 5J0ZA 1UX2A 5AFNA 2Y57A 3UQ4A 4XHEA 5AFHA 2X00A 3U8KA 2XQ4A 3WTNA 3PEOA 3ZDHA 3SQ6A
chains in the Genus database with same CATH superfamily
4PIRA 5HCMA 3RQWA 3WTKA 4IL4A 2XNUA 4HFHA 4TWFA 5HEJA 2QC1B 3SH1A 4LMJA 2C9TA 4QH1A 2PGZA 3U8LA 2ZJUA 3WTLA 4EZ1A 3JADA 5SYOA 3TLTA 3RHWA 3C84A 2XQ9A 2YOEA 3TLSA 4FRRA 2WZYA 4HFCA 3IGQA 4TWDA 5J5FA 3TLVA 3U8JA 2XZ6A 4LMKA 3TLWA 5HEOA 3ZKRA 5IUXA 4TNWA 4UM3S 4UY2A 2BR8A 2BYSA 5FJVA 5J5HA 5CO5A 2WN9A 2XQ5A 4NZBA 5AINA 2XQ7A 5AFJA 4ZZBA 2W8FA 3UU4A 2Y7YA 5J5IA 2BR7A 4UM3P 2BYQA 3T4MA 5BP0A 2BG9A 4ZJTA 2XQ3A 4ILBA 3RIFA 3WTMA 3UUBA 4A97A 4AFTA 2Y56A 3WIPA 1UV6A 5BRXA 2WNLA 5BW2A 2XQ6A 2X00D 4X5TA 3SQ9A 2PH9A 3PMZA 5HEUA 4BFQA 2Y58A 2BG9B 4AFHA 4Z90A 4TWHA 2XNVA 4HFDA 4ZK4A 3GUAA 2BYPA 3RQUA 3TLUA 2BG9E 4IREA 4ILCA 2YN6A 4DBMA 5LG3A 4IL9A 4F8HA 4UM3A 2XQ8A 4HFIA 4HQPA 3SIOA 4COFA 4UM1A 2YMEA 3WTJA 4QH5A 3WTHA 2UZ6A 3P4WA 5HEGA 5L47A 2BJ0A 3P50A 5JMEA 3U8NA 3EHZA 5TVCA 2YMDA 4LMLA 3WTOA 2BYRA 1I9BA 4ZJSA 5KZUA 4TNVA 4BQTA 4UXUA 4ALXA 2XYTA 5KE4A 4ZR6A 2BYNA 4QABA 5L4HA 3WTIA 3U8MA 5AFLA 4QACA 4ZK1A 2ZJVA 5L4EA 2XNTA 3EAMA 4D01A 2Y54A 2XQAA 3UU8A 4A98A 4QAAA 4B5DA 3UQ7A 2WNCA 3UU6A 1UW6A 5HCJA 5CFBA 2XYSA 5AFMA 3RI5A 3EI0A 3C79A 2VL0A 4AFGA 3LSVA 4NPPA 4HFBA 3UU3A 4Z91A 3RIAA 3JAFA 4XK9A 3UU5A 4QH4A 5AFKA 3JAEA 3ZDGA 5LXBA 5HEHA 4ZRUA 4HFEA 5AFMB 2XZ5A 5J5GA 4WV9A 2W8GA 2WNJA 4ILAA 2BG9C 4ZZCA 2YKSA 5J0ZA 1UX2A 5AFNA 2Y57A 3UQ4A 4XHEA 5AFHA 2X00A 3U8KA 2XQ4A 3WTNA 3PEOA 3ZDHA 3SQ6A
chains in the Genus database with same CATH topology
4PIRA 5HCMA 3RQWA 3WTKA 4IL4A 2XNUA 4HFHA 4TWFA 5HEJA 2QC1B 3SH1A 4LMJA 2C9TA 4QH1A 2PGZA 3U8LA 2ZJUA 3WTLA 4EZ1A 3JADA 5SYOA 3TLTA 3RHWA 3C84A 2XQ9A 2YOEA 3TLSA 4FRRA 2WZYA 4HFCA 3IGQA 4TWDA 5J5FA 3TLVA 3U8JA 2XZ6A 4LMKA 3TLWA 5HEOA 3ZKRA 5IUXA 4TNWA 4UM3S 4UY2A 2BR8A 2BYSA 5FJVA 5J5HA 5CO5A 2WN9A 2XQ5A 4NZBA 5AINA 2XQ7A 5AFJA 4ZZBA 2W8FA 3UU4A 2Y7YA 5J5IA 2BR7A 4UM3P 2BYQA 3T4MA 5BP0A 2BG9A 4ZJTA 2XQ3A 4ILBA 3RIFA 3WTMA 3UUBA 4A97A 4AFTA 2Y56A 3WIPA 1UV6A 5BRXA 2WNLA 5BW2A 2XQ6A 2X00D 4X5TA 3SQ9A 2PH9A 3PMZA 5HEUA 4BFQA 2Y58A 2BG9B 4AFHA 4Z90A 4TWHA 2XNVA 4HFDA 4ZK4A 3GUAA 2BYPA 3RQUA 3TLUA 2BG9E 4IREA 4ILCA 2YN6A 4DBMA 5LG3A 4IL9A 4F8HA 4UM3A 2XQ8A 4HFIA 4HQPA 3SIOA 4COFA 4UM1A 2YMEA 3WTJA 4QH5A 3WTHA 2UZ6A 3P4WA 5HEGA 5L47A 2BJ0A 3P50A 5JMEA 3U8NA 3EHZA 5TVCA 2YMDA 4LMLA 3WTOA 2BYRA 1I9BA 4ZJSA 5KZUA 4TNVA 4BQTA 4UXUA 4ALXA 2XYTA 5KE4A 4ZR6A 2BYNA 4QABA 5L4HA 3WTIA 3U8MA 5AFLA 4QACA 4ZK1A 2ZJVA 5L4EA 2XNTA 3EAMA 4D01A 2Y54A 2XQAA 3UU8A 4A98A 4QAAA 4B5DA 3UQ7A 2WNCA 3UU6A 1UW6A 5HCJA 5CFBA 2XYSA 5AFMA 3RI5A 3EI0A 3C79A 2VL0A 4AFGA 3LSVA 4NPPA 4HFBA 3UU3A 4Z91A 3RIAA 3JAFA 4XK9A 3UU5A 4QH4A 5AFKA 3JAEA 3ZDGA 5LXBA 5HEHA 4ZRUA 4HFEA 5AFMB 2XZ5A 5J5GA 4WV9A 2W8GA 2WNJA 4ILAA 2BG9C 4ZZCA 2YKSA 5J0ZA 1UX2A 5AFNA 2Y57A 3UQ4A 4XHEA 5AFHA 2X00A 3U8KA 2XQ4A 3WTNA 3PEOA 3ZDHA 3SQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PIR A;  5HCM A;  3RQW A;  3WTK A;  4IL4 A;  2XNU A;  4HFH A;  4TWF A;  5HEJ A;  2QC1 B;  3SH1 A;  4LMJ A;  2C9T A;  4QH1 A;  2PGZ A;  3U8L A;  2ZJU A;  3WTL A;  4EZ1 A;  3JAD A;  5SYO A;  3TLT A;  3RHW A;  3C84 A;  2XQ9 A;  2YOE A;  3TLS A;  4FRR A;  2WZY A;  4HFC A;  3IGQ A;  4TWD A;  5J5F A;  3TLV A;  3U8J A;  2XZ6 A;  4LMK A;  3TLW A;  5HEO A;  3ZKR A;  5IUX A;  4TNW A;  4UM3 S;  4UY2 A;  2BR8 A;  2BYS A;  5FJV A;  5J5H A;  5CO5 A;  2WN9 A;  2XQ5 A;  4NZB A;  5AIN A;  2XQ7 A;  5AFJ A;  4ZZB A;  2W8F A;  3UU4 A;  2Y7Y A;  5J5I A;  2BR7 A;  4UM3 P;  2BYQ A;  3T4M A;  5BP0 A;  2BG9 A;  4ZJT A;  2XQ3 A;  4ILB A;  3RIF A;  3WTM A;  3UUB A;  4A97 A;  4AFT A;  2Y56 A;  3WIP A;  1UV6 A;  5BRX A;  2WNL A;  5BW2 A;  2XQ6 A;  2X00 D;  4X5T A;  3SQ9 A;  2PH9 A;  3PMZ A;  5HEU A;  4BFQ A;  2Y58 A;  2BG9 B;  4AFH A;  4Z90 A;  4TWH A;  2XNV A;  4HFD A;  4ZK4 A;  3GUA A;  2BYP A;  3RQU A;  3TLU A;  2BG9 E;  4IRE A;  4ILC A;  2YN6 A;  4DBM A;  5LG3 A;  4IL9 A;  4F8H A;  4UM3 A;  2XQ8 A;  4HFI A;  4HQP A;  3SIO A;  4COF A;  4UM1 A;  2YME A;  3WTJ A;  4QH5 A;  3WTH A;  2UZ6 A;  3P4W A;  5HEG A;  5L47 A;  2BJ0 A;  3P50 A;  5JME A;  3U8N A;  3EHZ A;  5TVC A;  2YMD A;  4LML A;  3WTO A;  2BYR A;  1I9B A;  4ZJS A;  5KZU A;  4TNV A;  4BQT A;  4UXU A;  4ALX A;  2XYT A;  5KE4 A;  4ZR6 A;  2BYN A;  4QAB A;  5L4H A;  3WTI A;  3U8M A;  5AFL A;  4QAC A;  4ZK1 A;  2ZJV A;  5L4E A;  2XNT A;  3EAM A;  4D01 A;  2Y54 A;  2XQA A;  3UU8 A;  4A98 A;  4QAA A;  4B5D A;  3UQ7 A;  2WNC A;  3UU6 A;  1UW6 A;  5HCJ A;  5CFB A;  2XYS A;  5AFM A;  3RI5 A;  3EI0 A;  3C79 A;  2VL0 A;  4AFG A;  3LSV A;  4NPP A;  4HFB A;  3UU3 A;  4Z91 A;  3RIA A;  3JAF A;  4XK9 A;  3UU5 A;  4QH4 A;  5AFK A;  3JAE A;  3ZDG A;  5LXB A;  5HEH A;  4ZRU A;  4HFE A;  5AFM B;  2XZ5 A;  5J5G A;  4WV9 A;  2W8G A;  2WNJ A;  4ILA A;  2BG9 C;  4ZZC A;  2YKS A;  5J0Z A;  1UX2 A;  5AFN A;  2Y57 A;  3UQ4 A;  4XHE A;  5AFH A;  2X00 A;  3U8K A;  2XQ4 A;  3WTN A;  3PEO A;  3ZDH A;  3SQ6 A; 
#chains in the Genus database with same CATH topology
 4PIR A;  5HCM A;  3RQW A;  3WTK A;  4IL4 A;  2XNU A;  4HFH A;  4TWF A;  5HEJ A;  2QC1 B;  3SH1 A;  4LMJ A;  2C9T A;  4QH1 A;  2PGZ A;  3U8L A;  2ZJU A;  3WTL A;  4EZ1 A;  3JAD A;  5SYO A;  3TLT A;  3RHW A;  3C84 A;  2XQ9 A;  2YOE A;  3TLS A;  4FRR A;  2WZY A;  4HFC A;  3IGQ A;  4TWD A;  5J5F A;  3TLV A;  3U8J A;  2XZ6 A;  4LMK A;  3TLW A;  5HEO A;  3ZKR A;  5IUX A;  4TNW A;  4UM3 S;  4UY2 A;  2BR8 A;  2BYS A;  5FJV A;  5J5H A;  5CO5 A;  2WN9 A;  2XQ5 A;  4NZB A;  5AIN A;  2XQ7 A;  5AFJ A;  4ZZB A;  2W8F A;  3UU4 A;  2Y7Y A;  5J5I A;  2BR7 A;  4UM3 P;  2BYQ A;  3T4M A;  5BP0 A;  2BG9 A;  4ZJT A;  2XQ3 A;  4ILB A;  3RIF A;  3WTM A;  3UUB A;  4A97 A;  4AFT A;  2Y56 A;  3WIP A;  1UV6 A;  5BRX A;  2WNL A;  5BW2 A;  2XQ6 A;  2X00 D;  4X5T A;  3SQ9 A;  2PH9 A;  3PMZ A;  5HEU A;  4BFQ A;  2Y58 A;  2BG9 B;  4AFH A;  4Z90 A;  4TWH A;  2XNV A;  4HFD A;  4ZK4 A;  3GUA A;  2BYP A;  3RQU A;  3TLU A;  2BG9 E;  4IRE A;  4ILC A;  2YN6 A;  4DBM A;  5LG3 A;  4IL9 A;  4F8H A;  4UM3 A;  2XQ8 A;  4HFI A;  4HQP A;  3SIO A;  4COF A;  4UM1 A;  2YME A;  3WTJ A;  4QH5 A;  3WTH A;  2UZ6 A;  3P4W A;  5HEG A;  5L47 A;  2BJ0 A;  3P50 A;  5JME A;  3U8N A;  3EHZ A;  5TVC A;  2YMD A;  4LML A;  3WTO A;  2BYR A;  1I9B A;  4ZJS A;  5KZU A;  4TNV A;  4BQT A;  4UXU A;  4ALX A;  2XYT A;  5KE4 A;  4ZR6 A;  2BYN A;  4QAB A;  5L4H A;  3WTI A;  3U8M A;  5AFL A;  4QAC A;  4ZK1 A;  2ZJV A;  5L4E A;  2XNT A;  3EAM A;  4D01 A;  2Y54 A;  2XQA A;  3UU8 A;  4A98 A;  4QAA A;  4B5D A;  3UQ7 A;  2WNC A;  3UU6 A;  1UW6 A;  5HCJ A;  5CFB A;  2XYS A;  5AFM A;  3RI5 A;  3EI0 A;  3C79 A;  2VL0 A;  4AFG A;  3LSV A;  4NPP A;  4HFB A;  3UU3 A;  4Z91 A;  3RIA A;  3JAF A;  4XK9 A;  3UU5 A;  4QH4 A;  5AFK A;  3JAE A;  3ZDG A;  5LXB A;  5HEH A;  4ZRU A;  4HFE A;  5AFM B;  2XZ5 A;  5J5G A;  4WV9 A;  2W8G A;  2WNJ A;  4ILA A;  2BG9 C;  4ZZC A;  2YKS A;  5J0Z A;  1UX2 A;  5AFN A;  2Y57 A;  3UQ4 A;  4XHE A;  5AFH A;  2X00 A;  3U8K A;  2XQ4 A;  3WTN A;  3PEO A;  3ZDH A;  3SQ6 A; 
#chains in the Genus database with same CATH homology
 4PIR A;  5HCM A;  3RQW A;  3WTK A;  4IL4 A;  2XNU A;  4HFH A;  4TWF A;  5HEJ A;  2QC1 B;  3SH1 A;  4LMJ A;  2C9T A;  4QH1 A;  2PGZ A;  3U8L A;  2ZJU A;  3WTL A;  4EZ1 A;  3JAD A;  5SYO A;  3TLT A;  3RHW A;  3C84 A;  2XQ9 A;  2YOE A;  3TLS A;  4FRR A;  2WZY A;  4HFC A;  3IGQ A;  4TWD A;  5J5F A;  3TLV A;  3U8J A;  2XZ6 A;  4LMK A;  3TLW A;  5HEO A;  3ZKR A;  5IUX A;  4TNW A;  4UM3 S;  4UY2 A;  2BR8 A;  2BYS A;  5FJV A;  5J5H A;  5CO5 A;  2WN9 A;  2XQ5 A;  4NZB A;  5AIN A;  2XQ7 A;  5AFJ A;  4ZZB A;  2W8F A;  3UU4 A;  2Y7Y A;  5J5I A;  2BR7 A;  4UM3 P;  2BYQ A;  3T4M A;  5BP0 A;  2BG9 A;  4ZJT A;  2XQ3 A;  4ILB A;  3RIF A;  3WTM A;  3UUB A;  4A97 A;  4AFT A;  2Y56 A;  3WIP A;  1UV6 A;  5BRX A;  2WNL A;  5BW2 A;  2XQ6 A;  2X00 D;  4X5T A;  3SQ9 A;  2PH9 A;  3PMZ A;  5HEU A;  4BFQ A;  2Y58 A;  2BG9 B;  4AFH A;  4Z90 A;  4TWH A;  2XNV A;  4HFD A;  4ZK4 A;  3GUA A;  2BYP A;  3RQU A;  3TLU A;  2BG9 E;  4IRE A;  4ILC A;  2YN6 A;  4DBM A;  5LG3 A;  4IL9 A;  4F8H A;  4UM3 A;  2XQ8 A;  4HFI A;  4HQP A;  3SIO A;  4COF A;  4UM1 A;  2YME A;  3WTJ A;  4QH5 A;  3WTH A;  2UZ6 A;  3P4W A;  5HEG A;  5L47 A;  2BJ0 A;  3P50 A;  5JME A;  3U8N A;  3EHZ A;  5TVC A;  2YMD A;  4LML A;  3WTO A;  2BYR A;  1I9B A;  4ZJS A;  5KZU A;  4TNV A;  4BQT A;  4UXU A;  4ALX A;  2XYT A;  5KE4 A;  4ZR6 A;  2BYN A;  4QAB A;  5L4H A;  3WTI A;  3U8M A;  5AFL A;  4QAC A;  4ZK1 A;  2ZJV A;  5L4E A;  2XNT A;  3EAM A;  4D01 A;  2Y54 A;  2XQA A;  3UU8 A;  4A98 A;  4QAA A;  4B5D A;  3UQ7 A;  2WNC A;  3UU6 A;  1UW6 A;  5HCJ A;  5CFB A;  2XYS A;  5AFM A;  3RI5 A;  3EI0 A;  3C79 A;  2VL0 A;  4AFG A;  3LSV A;  4NPP A;  4HFB A;  3UU3 A;  4Z91 A;  3RIA A;  3JAF A;  4XK9 A;  3UU5 A;  4QH4 A;  5AFK A;  3JAE A;  3ZDG A;  5LXB A;  5HEH A;  4ZRU A;  4HFE A;  5AFM B;  2XZ5 A;  5J5G A;  4WV9 A;  2W8G A;  2WNJ A;  4ILA A;  2BG9 C;  4ZZC A;  2YKS A;  5J0Z A;  1UX2 A;  5AFN A;  2Y57 A;  3UQ4 A;  4XHE A;  5AFH A;  2X00 A;  3U8K A;  2XQ4 A;  3WTN A;  3PEO A;  3ZDH A;  3SQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...