1I9BA

X-ray structure of acetylcholine binding protein (achbp)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
FDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords ACETYLCHOLINE BINDING PROTEIN
publication title Crystal structure of an ACh-binding protein reveals the ligand-binding domain of nicotinic receptors.
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 1i9bA00
2BR8A 2YN6A 3UU8A 2XQ8A 1I9BA 3C84A 5KE4A 5L47A 2BG9A 4IL4A 3C79A 3JAFA 2VL0A 4QH4A 3RIAA 3WTHA 5AFMA 5JMEA 2ZJVA 4ILAA 4ILCA 3WTNA 4D01A 1UW6A 2WZYA 5HCMA 4QABA 3UU4A 3GUAA 4HFDA 5AFHA 3TLVA 5KZUA 1UV6A 2XQAA 2XQ9A 4HFHA 4TWFA 2YOEA 2Y7YA 5J5FA 3WTMA 3WTKA 5FJVA 3UU3A 5L4EA 2X00A 4ZK4A 2BG9C 2BYQA 4LMLA 2BR7A 3UU6A 5HEGA 4UM3P 5BW2A 4DBMA 3JADA 3UQ7A 3IGQA 2XYTA 4UM1A 3U8MA 2C9TA 4HQPA 5BP0A 2XZ5A 2XYSA 5J5IA 4WV9A 4QACA 5HEHA 5HEUA 4UM3S 3UUBA 2YMEA 4HFBA 2BG9B 5LXBA 2Y57A 3EHZA 4ZJTA 4IREA 5AFMB 2XQ7A 5CO5A 2XZ6A 3SH1A 2XQ3A 3SIOA 2PGZA 2Y54A 3ZDHA 4ZJSA 4COFA 3PEOA 3SQ9A 4ZZBA 2Y58A 4UXUA 2YKSA 2WNJA 4ZZCA 5J5HA 3WIPA 4QH5A 3RQWA 3P4WA 4IL9A 4ZR6A 3TLTA 2UZ6A 3LSVA 4UM3A 4X5TA 3WTJA 2PH9A 4TNWA 3U8JA 4PIRA 4EZ1A 5AFNA 4A98A 5AFLA 3U8KA 4QAAA 5SYOA 3TLWA 3PMZA 5AINA 5L4HA 4BFQA 3ZKRA 4AFHA 5HEOA 3JAEA 2BYSA 4NZBA 5BRXA 3WTOA 2BG9E 3RI5A 4NPPA 2BJ0A 3WTIA 5AFJA 3EAMA 4TNVA 4XK9A 1UX2A 2W8FA 4HFIA 4ZK1A 4TWDA 5TVCA 5CFBA 3TLSA 5IUXA 4ALXA 5J5GA 2Y56A 4XHEA 3SQ6A 5J0ZA 2WN9A 4LMJA 4ZRUA 4FRRA 4A97A 3WTLA 3UU5A 3RQUA 3RIFA 5HCJA 4UY2A 4ILBA 5LG3A 3RHWA 2BYNA 3UQ4A 3EI0A 2W8GA 2YMDA 4F8HA 3ZDGA 2BYPA 4HFCA 2XNUA 4Z90A 2XQ5A 2XNVA 4B5DA 4AFGA 2QC1B 4BQTA 4AFTA 2WNLA 2WNCA 4Z91A 5AFKA 4QH1A 4LMKA 2BYRA 3U8NA 2X00D 5HEJA 2XQ4A 2XQ6A 3T4MA 2ZJUA 4HFEA 2XNTA 4TWHA 3U8LA 3TLUA 3P50A
chains in the Genus database with same CATH superfamily
2BR8A 2YN6A 3UU8A 2XQ8A 1I9BA 3C84A 5KE4A 5L47A 2BG9A 4IL4A 3C79A 3JAFA 2VL0A 4QH4A 3RIAA 3WTHA 5AFMA 5JMEA 2ZJVA 4ILAA 4ILCA 3WTNA 4D01A 1UW6A 2WZYA 5HCMA 4QABA 3UU4A 3GUAA 4HFDA 5AFHA 3TLVA 5KZUA 1UV6A 2XQAA 2XQ9A 4HFHA 4TWFA 2YOEA 2Y7YA 5J5FA 3WTMA 3WTKA 5FJVA 3UU3A 5L4EA 2X00A 4ZK4A 2BG9C 2BYQA 4LMLA 2BR7A 3UU6A 5HEGA 4UM3P 5BW2A 4DBMA 3JADA 3UQ7A 3IGQA 2XYTA 4UM1A 3U8MA 2C9TA 4HQPA 5BP0A 2XZ5A 2XYSA 5J5IA 4WV9A 4QACA 5HEHA 5HEUA 4UM3S 3UUBA 2YMEA 4HFBA 2BG9B 5LXBA 2Y57A 3EHZA 4ZJTA 4IREA 5AFMB 2XQ7A 5CO5A 2XZ6A 3SH1A 2XQ3A 3SIOA 2PGZA 2Y54A 3ZDHA 4ZJSA 4COFA 3PEOA 3SQ9A 4ZZBA 2Y58A 4UXUA 2YKSA 2WNJA 4ZZCA 5J5HA 3WIPA 4QH5A 3RQWA 3P4WA 4IL9A 4ZR6A 3TLTA 2UZ6A 3LSVA 4UM3A 4X5TA 3WTJA 2PH9A 4TNWA 3U8JA 4PIRA 4EZ1A 5AFNA 4A98A 5AFLA 3U8KA 4QAAA 5SYOA 3TLWA 3PMZA 5AINA 5L4HA 4BFQA 3ZKRA 4AFHA 5HEOA 3JAEA 2BYSA 4NZBA 5BRXA 3WTOA 2BG9E 3RI5A 4NPPA 2BJ0A 3WTIA 5AFJA 3EAMA 4TNVA 4XK9A 1UX2A 2W8FA 4HFIA 4ZK1A 4TWDA 5TVCA 5CFBA 3TLSA 5IUXA 4ALXA 5J5GA 2Y56A 4XHEA 3SQ6A 5J0ZA 2WN9A 4LMJA 4ZRUA 4FRRA 4A97A 3WTLA 3UU5A 3RQUA 3RIFA 5HCJA 4UY2A 4ILBA 5LG3A 3RHWA 2BYNA 3UQ4A 3EI0A 2W8GA 2YMDA 4F8HA 3ZDGA 2BYPA 4HFCA 2XNUA 4Z90A 2XQ5A 2XNVA 4B5DA 4AFGA 2QC1B 4BQTA 4AFTA 2WNLA 2WNCA 4Z91A 5AFKA 4QH1A 4LMKA 2BYRA 3U8NA 2X00D 5HEJA 2XQ4A 2XQ6A 3T4MA 2ZJUA 4HFEA 2XNTA 4TWHA 3U8LA 3TLUA 3P50A
chains in the Genus database with same CATH topology
2BR8A 2YN6A 3UU8A 2XQ8A 1I9BA 3C84A 5KE4A 5L47A 2BG9A 4IL4A 3C79A 3JAFA 2VL0A 4QH4A 3RIAA 3WTHA 5AFMA 5JMEA 2ZJVA 4ILAA 4ILCA 3WTNA 4D01A 1UW6A 2WZYA 5HCMA 4QABA 3UU4A 3GUAA 4HFDA 5AFHA 3TLVA 5KZUA 1UV6A 2XQAA 2XQ9A 4HFHA 4TWFA 2YOEA 2Y7YA 5J5FA 3WTMA 3WTKA 5FJVA 3UU3A 5L4EA 2X00A 4ZK4A 2BG9C 2BYQA 4LMLA 2BR7A 3UU6A 5HEGA 4UM3P 5BW2A 4DBMA 3JADA 3UQ7A 3IGQA 2XYTA 4UM1A 3U8MA 2C9TA 4HQPA 5BP0A 2XZ5A 2XYSA 5J5IA 4WV9A 4QACA 5HEHA 5HEUA 4UM3S 3UUBA 2YMEA 4HFBA 2BG9B 5LXBA 2Y57A 3EHZA 4ZJTA 4IREA 5AFMB 2XQ7A 5CO5A 2XZ6A 3SH1A 2XQ3A 3SIOA 2PGZA 2Y54A 3ZDHA 4ZJSA 4COFA 3PEOA 3SQ9A 4ZZBA 2Y58A 4UXUA 2YKSA 2WNJA 4ZZCA 5J5HA 3WIPA 4QH5A 3RQWA 3P4WA 4IL9A 4ZR6A 3TLTA 2UZ6A 3LSVA 4UM3A 4X5TA 3WTJA 2PH9A 4TNWA 3U8JA 4PIRA 4EZ1A 5AFNA 4A98A 5AFLA 3U8KA 4QAAA 5SYOA 3TLWA 3PMZA 5AINA 5L4HA 4BFQA 3ZKRA 4AFHA 5HEOA 3JAEA 2BYSA 4NZBA 5BRXA 3WTOA 2BG9E 3RI5A 4NPPA 2BJ0A 3WTIA 5AFJA 3EAMA 4TNVA 4XK9A 1UX2A 2W8FA 4HFIA 4ZK1A 4TWDA 5TVCA 5CFBA 3TLSA 5IUXA 4ALXA 5J5GA 2Y56A 4XHEA 3SQ6A 5J0ZA 2WN9A 4LMJA 4ZRUA 4FRRA 4A97A 3WTLA 3UU5A 3RQUA 3RIFA 5HCJA 4UY2A 4ILBA 5LG3A 3RHWA 2BYNA 3UQ4A 3EI0A 2W8GA 2YMDA 4F8HA 3ZDGA 2BYPA 4HFCA 2XNUA 4Z90A 2XQ5A 2XNVA 4B5DA 4AFGA 2QC1B 4BQTA 4AFTA 2WNLA 2WNCA 4Z91A 5AFKA 4QH1A 4LMKA 2BYRA 3U8NA 2X00D 5HEJA 2XQ4A 2XQ6A 3T4MA 2ZJUA 4HFEA 2XNTA 4TWHA 3U8LA 3TLUA 3P50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BR8 A;  2YN6 A;  3UU8 A;  2XQ8 A;  1I9B A;  3C84 A;  5KE4 A;  5L47 A;  2BG9 A;  4IL4 A;  3C79 A;  3JAF A;  2VL0 A;  4QH4 A;  3RIA A;  3WTH A;  5AFM A;  5JME A;  2ZJV A;  4ILA A;  4ILC A;  3WTN A;  4D01 A;  1UW6 A;  2WZY A;  5HCM A;  4QAB A;  3UU4 A;  3GUA A;  4HFD A;  5AFH A;  3TLV A;  5KZU A;  1UV6 A;  2XQA A;  2XQ9 A;  4HFH A;  4TWF A;  2YOE A;  2Y7Y A;  5J5F A;  3WTM A;  3WTK A;  5FJV A;  3UU3 A;  5L4E A;  2X00 A;  4ZK4 A;  2BG9 C;  2BYQ A;  4LML A;  2BR7 A;  3UU6 A;  5HEG A;  4UM3 P;  5BW2 A;  4DBM A;  3JAD A;  3UQ7 A;  3IGQ A;  2XYT A;  4UM1 A;  3U8M A;  2C9T A;  4HQP A;  5BP0 A;  2XZ5 A;  2XYS A;  5J5I A;  4WV9 A;  4QAC A;  5HEH A;  5HEU A;  4UM3 S;  3UUB A;  2YME A;  4HFB A;  2BG9 B;  5LXB A;  2Y57 A;  3EHZ A;  4ZJT A;  4IRE A;  5AFM B;  2XQ7 A;  5CO5 A;  2XZ6 A;  3SH1 A;  2XQ3 A;  3SIO A;  2PGZ A;  2Y54 A;  3ZDH A;  4ZJS A;  4COF A;  3PEO A;  3SQ9 A;  4ZZB A;  2Y58 A;  4UXU A;  2YKS A;  2WNJ A;  4ZZC A;  5J5H A;  3WIP A;  4QH5 A;  3RQW A;  3P4W A;  4IL9 A;  4ZR6 A;  3TLT A;  2UZ6 A;  3LSV A;  4UM3 A;  4X5T A;  3WTJ A;  2PH9 A;  4TNW A;  3U8J A;  4PIR A;  4EZ1 A;  5AFN A;  4A98 A;  5AFL A;  3U8K A;  4QAA A;  5SYO A;  3TLW A;  3PMZ A;  5AIN A;  5L4H A;  4BFQ A;  3ZKR A;  4AFH A;  5HEO A;  3JAE A;  2BYS A;  4NZB A;  5BRX A;  3WTO A;  2BG9 E;  3RI5 A;  4NPP A;  2BJ0 A;  3WTI A;  5AFJ A;  3EAM A;  4TNV A;  4XK9 A;  1UX2 A;  2W8F A;  4HFI A;  4ZK1 A;  4TWD A;  5TVC A;  5CFB A;  3TLS A;  5IUX A;  4ALX A;  5J5G A;  2Y56 A;  4XHE A;  3SQ6 A;  5J0Z A;  2WN9 A;  4LMJ A;  4ZRU A;  4FRR A;  4A97 A;  3WTL A;  3UU5 A;  3RQU A;  3RIF A;  5HCJ A;  4UY2 A;  4ILB A;  5LG3 A;  3RHW A;  2BYN A;  3UQ4 A;  3EI0 A;  2W8G A;  2YMD A;  4F8H A;  3ZDG A;  2BYP A;  4HFC A;  2XNU A;  4Z90 A;  2XQ5 A;  2XNV A;  4B5D A;  4AFG A;  2QC1 B;  4BQT A;  4AFT A;  2WNL A;  2WNC A;  4Z91 A;  5AFK A;  4QH1 A;  4LMK A;  2BYR A;  3U8N A;  2X00 D;  5HEJ A;  2XQ4 A;  2XQ6 A;  3T4M A;  2ZJU A;  4HFE A;  2XNT A;  4TWH A;  3U8L A;  3TLU A;  3P50 A; 
#chains in the Genus database with same CATH topology
 2BR8 A;  2YN6 A;  3UU8 A;  2XQ8 A;  1I9B A;  3C84 A;  5KE4 A;  5L47 A;  2BG9 A;  4IL4 A;  3C79 A;  3JAF A;  2VL0 A;  4QH4 A;  3RIA A;  3WTH A;  5AFM A;  5JME A;  2ZJV A;  4ILA A;  4ILC A;  3WTN A;  4D01 A;  1UW6 A;  2WZY A;  5HCM A;  4QAB A;  3UU4 A;  3GUA A;  4HFD A;  5AFH A;  3TLV A;  5KZU A;  1UV6 A;  2XQA A;  2XQ9 A;  4HFH A;  4TWF A;  2YOE A;  2Y7Y A;  5J5F A;  3WTM A;  3WTK A;  5FJV A;  3UU3 A;  5L4E A;  2X00 A;  4ZK4 A;  2BG9 C;  2BYQ A;  4LML A;  2BR7 A;  3UU6 A;  5HEG A;  4UM3 P;  5BW2 A;  4DBM A;  3JAD A;  3UQ7 A;  3IGQ A;  2XYT A;  4UM1 A;  3U8M A;  2C9T A;  4HQP A;  5BP0 A;  2XZ5 A;  2XYS A;  5J5I A;  4WV9 A;  4QAC A;  5HEH A;  5HEU A;  4UM3 S;  3UUB A;  2YME A;  4HFB A;  2BG9 B;  5LXB A;  2Y57 A;  3EHZ A;  4ZJT A;  4IRE A;  5AFM B;  2XQ7 A;  5CO5 A;  2XZ6 A;  3SH1 A;  2XQ3 A;  3SIO A;  2PGZ A;  2Y54 A;  3ZDH A;  4ZJS A;  4COF A;  3PEO A;  3SQ9 A;  4ZZB A;  2Y58 A;  4UXU A;  2YKS A;  2WNJ A;  4ZZC A;  5J5H A;  3WIP A;  4QH5 A;  3RQW A;  3P4W A;  4IL9 A;  4ZR6 A;  3TLT A;  2UZ6 A;  3LSV A;  4UM3 A;  4X5T A;  3WTJ A;  2PH9 A;  4TNW A;  3U8J A;  4PIR A;  4EZ1 A;  5AFN A;  4A98 A;  5AFL A;  3U8K A;  4QAA A;  5SYO A;  3TLW A;  3PMZ A;  5AIN A;  5L4H A;  4BFQ A;  3ZKR A;  4AFH A;  5HEO A;  3JAE A;  2BYS A;  4NZB A;  5BRX A;  3WTO A;  2BG9 E;  3RI5 A;  4NPP A;  2BJ0 A;  3WTI A;  5AFJ A;  3EAM A;  4TNV A;  4XK9 A;  1UX2 A;  2W8F A;  4HFI A;  4ZK1 A;  4TWD A;  5TVC A;  5CFB A;  3TLS A;  5IUX A;  4ALX A;  5J5G A;  2Y56 A;  4XHE A;  3SQ6 A;  5J0Z A;  2WN9 A;  4LMJ A;  4ZRU A;  4FRR A;  4A97 A;  3WTL A;  3UU5 A;  3RQU A;  3RIF A;  5HCJ A;  4UY2 A;  4ILB A;  5LG3 A;  3RHW A;  2BYN A;  3UQ4 A;  3EI0 A;  2W8G A;  2YMD A;  4F8H A;  3ZDG A;  2BYP A;  4HFC A;  2XNU A;  4Z90 A;  2XQ5 A;  2XNV A;  4B5D A;  4AFG A;  2QC1 B;  4BQT A;  4AFT A;  2WNL A;  2WNC A;  4Z91 A;  5AFK A;  4QH1 A;  4LMK A;  2BYR A;  3U8N A;  2X00 D;  5HEJ A;  2XQ4 A;  2XQ6 A;  3T4M A;  2ZJU A;  4HFE A;  2XNT A;  4TWH A;  3U8L A;  3TLU A;  3P50 A; 
#chains in the Genus database with same CATH homology
 2BR8 A;  2YN6 A;  3UU8 A;  2XQ8 A;  1I9B A;  3C84 A;  5KE4 A;  5L47 A;  2BG9 A;  4IL4 A;  3C79 A;  3JAF A;  2VL0 A;  4QH4 A;  3RIA A;  3WTH A;  5AFM A;  5JME A;  2ZJV A;  4ILA A;  4ILC A;  3WTN A;  4D01 A;  1UW6 A;  2WZY A;  5HCM A;  4QAB A;  3UU4 A;  3GUA A;  4HFD A;  5AFH A;  3TLV A;  5KZU A;  1UV6 A;  2XQA A;  2XQ9 A;  4HFH A;  4TWF A;  2YOE A;  2Y7Y A;  5J5F A;  3WTM A;  3WTK A;  5FJV A;  3UU3 A;  5L4E A;  2X00 A;  4ZK4 A;  2BG9 C;  2BYQ A;  4LML A;  2BR7 A;  3UU6 A;  5HEG A;  4UM3 P;  5BW2 A;  4DBM A;  3JAD A;  3UQ7 A;  3IGQ A;  2XYT A;  4UM1 A;  3U8M A;  2C9T A;  4HQP A;  5BP0 A;  2XZ5 A;  2XYS A;  5J5I A;  4WV9 A;  4QAC A;  5HEH A;  5HEU A;  4UM3 S;  3UUB A;  2YME A;  4HFB A;  2BG9 B;  5LXB A;  2Y57 A;  3EHZ A;  4ZJT A;  4IRE A;  5AFM B;  2XQ7 A;  5CO5 A;  2XZ6 A;  3SH1 A;  2XQ3 A;  3SIO A;  2PGZ A;  2Y54 A;  3ZDH A;  4ZJS A;  4COF A;  3PEO A;  3SQ9 A;  4ZZB A;  2Y58 A;  4UXU A;  2YKS A;  2WNJ A;  4ZZC A;  5J5H A;  3WIP A;  4QH5 A;  3RQW A;  3P4W A;  4IL9 A;  4ZR6 A;  3TLT A;  2UZ6 A;  3LSV A;  4UM3 A;  4X5T A;  3WTJ A;  2PH9 A;  4TNW A;  3U8J A;  4PIR A;  4EZ1 A;  5AFN A;  4A98 A;  5AFL A;  3U8K A;  4QAA A;  5SYO A;  3TLW A;  3PMZ A;  5AIN A;  5L4H A;  4BFQ A;  3ZKR A;  4AFH A;  5HEO A;  3JAE A;  2BYS A;  4NZB A;  5BRX A;  3WTO A;  2BG9 E;  3RI5 A;  4NPP A;  2BJ0 A;  3WTI A;  5AFJ A;  3EAM A;  4TNV A;  4XK9 A;  1UX2 A;  2W8F A;  4HFI A;  4ZK1 A;  4TWD A;  5TVC A;  5CFB A;  3TLS A;  5IUX A;  4ALX A;  5J5G A;  2Y56 A;  4XHE A;  3SQ6 A;  5J0Z A;  2WN9 A;  4LMJ A;  4ZRU A;  4FRR A;  4A97 A;  3WTL A;  3UU5 A;  3RQU A;  3RIF A;  5HCJ A;  4UY2 A;  4ILB A;  5LG3 A;  3RHW A;  2BYN A;  3UQ4 A;  3EI0 A;  2W8G A;  2YMD A;  4F8H A;  3ZDG A;  2BYP A;  4HFC A;  2XNU A;  4Z90 A;  2XQ5 A;  2XNV A;  4B5D A;  4AFG A;  2QC1 B;  4BQT A;  4AFT A;  2WNL A;  2WNC A;  4Z91 A;  5AFK A;  4QH1 A;  4LMK A;  2BYR A;  3U8N A;  2X00 D;  5HEJ A;  2XQ4 A;  2XQ6 A;  3T4M A;  2ZJU A;  4HFE A;  2XNT A;  4TWH A;  3U8L A;  3TLU A;  3P50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...