4QABA

X-ray structure of acetylcholine binding protein (achbp) in complex with 4-(morpholin-4-yl)-6-[4-(trifluoromethyl)phenyl]pyrimidin-2-amine
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
213
structure length
208
Chain Sequence
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Structural basis for cooperative interactions of substituted 2-aminopyrimidines with the acetylcholine binding protein.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein
total genus 43
structure length 208
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qabA00
3RHWA 2WZYA 1UW6A 3TLUA 3UUBA 4NPPA 1UX2A 2XQ5A 3JAFA 5LXBA 3T4MA 2XQ4A 3LSVA 2W8FA 4TWDA 3UQ4A 3ZDHA 3U8LA 2WNLA 4TNWA 3SH1A 2Y54A 4ILAA 5AFMB 3C79A 3EAMA 2YMEA 4UM1A 4QH4A 2W8GA 3GUAA 3WTKA 3WTHA 4DBMA 4HFHA 4X5TA 3RQWA 5L47A 5FJVA 5BP0A 2WN9A 2YMDA 2XZ6A 4Z90A 2PGZA 4COFA 4BFQA 3UU4A 5KE4A 3SQ6A 2XNVA 5HEUA 4QAAA 3TLSA 3RQUA 3UU8A 1I9BA 3ZDGA 3P50A 5CFBA 5SYOA 4EZ1A 3WTJA 5HCMA 4ZK4A 3U8NA 2BR7A 2C9TA 4F8HA 4QACA 4Z91A 5HEHA 3P4WA 2XQAA 2Y7YA 4LMLA 4AFHA 2BR8A 2PH9A 2WNJA 2WNCA 2XNTA 3RIFA 3TLVA 4HQPA 5AFMA 4TWFA 2YOEA 2BG9C 3WTLA 3UU6A 2QC1B 3TLTA 5J5IA 4UM3A 3IGQA 3C84A 4ILBA 2Y58A 4IL9A 3WIPA 4HFBA 4ZJTA 3WTMA 3WTIA 3PMZA 2XQ3A 4ZR6A 2XYSA 2XQ6A 5IUXA 2XQ7A 4B5DA 2BYRA 4HFIA 3WTOA 5BRXA 2Y56A 1UV6A 2YKSA 3EI0A 3TLWA 4NZBA 5HEOA 4BQTA 2YN6A 4QH1A 4HFCA 3JAEA 5JMEA 4A97A 5KZUA 3RIAA 5L4HA 3EHZA 2BYPA 5AFLA 2XQ8A 4LMKA 4UY2A 4ILCA 2ZJUA 4TWHA 5AFHA 5LG3A 4XK9A 3WTNA 2ZJVA 5J0ZA 3JADA 2BG9B 3RI5A 4A98A 3U8KA 2X00A 5CO5A 2BYSA 5HCJA 3UU5A 5HEGA 3U8JA 2XQ9A 2BYNA 3UU3A 5J5GA 2X00D 4TNVA 4AFTA 2VL0A 4UXUA 4IREA 4ZRUA 2Y57A 4FRRA 4ZK1A 4ZZBA 2BG9E 2BJ0A 2XNUA 2BYQA 4UM3S 5BW2A 4HFEA 4IL4A 2XYTA 4ZJSA 2UZ6A 4D01A 5AFKA 4AFGA 4QH5A 4QABA 5HEJA 4PIRA 4ALXA 3SIOA 5AINA 2BG9A 4HFDA 5J5FA 5AFJA 5L4EA 5TVCA 3UQ7A 3PEOA 5J5HA 4UM3P 4ZZCA 4LMJA 4WV9A 3U8MA 5AFNA 3ZKRA 3SQ9A 2XZ5A 4XHEA
chains in the Genus database with same CATH superfamily
3RHWA 2WZYA 1UW6A 3TLUA 3UUBA 4NPPA 1UX2A 2XQ5A 3JAFA 5LXBA 3T4MA 2XQ4A 3LSVA 2W8FA 4TWDA 3UQ4A 3ZDHA 3U8LA 2WNLA 4TNWA 3SH1A 2Y54A 4ILAA 5AFMB 3C79A 3EAMA 2YMEA 4UM1A 4QH4A 2W8GA 3GUAA 3WTKA 3WTHA 4DBMA 4HFHA 4X5TA 3RQWA 5L47A 5FJVA 5BP0A 2WN9A 2YMDA 2XZ6A 4Z90A 2PGZA 4COFA 4BFQA 3UU4A 5KE4A 3SQ6A 2XNVA 5HEUA 4QAAA 3TLSA 3RQUA 3UU8A 1I9BA 3ZDGA 3P50A 5CFBA 5SYOA 4EZ1A 3WTJA 5HCMA 4ZK4A 3U8NA 2BR7A 2C9TA 4F8HA 4QACA 4Z91A 5HEHA 3P4WA 2XQAA 2Y7YA 4LMLA 4AFHA 2BR8A 2PH9A 2WNJA 2WNCA 2XNTA 3RIFA 3TLVA 4HQPA 5AFMA 4TWFA 2YOEA 2BG9C 3WTLA 3UU6A 2QC1B 3TLTA 5J5IA 4UM3A 3IGQA 3C84A 4ILBA 2Y58A 4IL9A 3WIPA 4HFBA 4ZJTA 3WTMA 3WTIA 3PMZA 2XQ3A 4ZR6A 2XYSA 2XQ6A 5IUXA 2XQ7A 4B5DA 2BYRA 4HFIA 3WTOA 5BRXA 2Y56A 1UV6A 2YKSA 3EI0A 3TLWA 4NZBA 5HEOA 4BQTA 2YN6A 4QH1A 4HFCA 3JAEA 5JMEA 4A97A 5KZUA 3RIAA 5L4HA 3EHZA 2BYPA 5AFLA 2XQ8A 4LMKA 4UY2A 4ILCA 2ZJUA 4TWHA 5AFHA 5LG3A 4XK9A 3WTNA 2ZJVA 5J0ZA 3JADA 2BG9B 3RI5A 4A98A 3U8KA 2X00A 5CO5A 2BYSA 5HCJA 3UU5A 5HEGA 3U8JA 2XQ9A 2BYNA 3UU3A 5J5GA 2X00D 4TNVA 4AFTA 2VL0A 4UXUA 4IREA 4ZRUA 2Y57A 4FRRA 4ZK1A 4ZZBA 2BG9E 2BJ0A 2XNUA 2BYQA 4UM3S 5BW2A 4HFEA 4IL4A 2XYTA 4ZJSA 2UZ6A 4D01A 5AFKA 4AFGA 4QH5A 4QABA 5HEJA 4PIRA 4ALXA 3SIOA 5AINA 2BG9A 4HFDA 5J5FA 5AFJA 5L4EA 5TVCA 3UQ7A 3PEOA 5J5HA 4UM3P 4ZZCA 4LMJA 4WV9A 3U8MA 5AFNA 3ZKRA 3SQ9A 2XZ5A 4XHEA
chains in the Genus database with same CATH topology
3RHWA 2WZYA 1UW6A 3TLUA 3UUBA 4NPPA 1UX2A 2XQ5A 3JAFA 5LXBA 3T4MA 2XQ4A 3LSVA 2W8FA 4TWDA 3UQ4A 3ZDHA 3U8LA 2WNLA 4TNWA 3SH1A 2Y54A 4ILAA 5AFMB 3C79A 3EAMA 2YMEA 4UM1A 4QH4A 2W8GA 3GUAA 3WTKA 3WTHA 4DBMA 4HFHA 4X5TA 3RQWA 5L47A 5FJVA 5BP0A 2WN9A 2YMDA 2XZ6A 4Z90A 2PGZA 4COFA 4BFQA 3UU4A 5KE4A 3SQ6A 2XNVA 5HEUA 4QAAA 3TLSA 3RQUA 3UU8A 1I9BA 3ZDGA 3P50A 5CFBA 5SYOA 4EZ1A 3WTJA 5HCMA 4ZK4A 3U8NA 2BR7A 2C9TA 4F8HA 4QACA 4Z91A 5HEHA 3P4WA 2XQAA 2Y7YA 4LMLA 4AFHA 2BR8A 2PH9A 2WNJA 2WNCA 2XNTA 3RIFA 3TLVA 4HQPA 5AFMA 4TWFA 2YOEA 2BG9C 3WTLA 3UU6A 2QC1B 3TLTA 5J5IA 4UM3A 3IGQA 3C84A 4ILBA 2Y58A 4IL9A 3WIPA 4HFBA 4ZJTA 3WTMA 3WTIA 3PMZA 2XQ3A 4ZR6A 2XYSA 2XQ6A 5IUXA 2XQ7A 4B5DA 2BYRA 4HFIA 3WTOA 5BRXA 2Y56A 1UV6A 2YKSA 3EI0A 3TLWA 4NZBA 5HEOA 4BQTA 2YN6A 4QH1A 4HFCA 3JAEA 5JMEA 4A97A 5KZUA 3RIAA 5L4HA 3EHZA 2BYPA 5AFLA 2XQ8A 4LMKA 4UY2A 4ILCA 2ZJUA 4TWHA 5AFHA 5LG3A 4XK9A 3WTNA 2ZJVA 5J0ZA 3JADA 2BG9B 3RI5A 4A98A 3U8KA 2X00A 5CO5A 2BYSA 5HCJA 3UU5A 5HEGA 3U8JA 2XQ9A 2BYNA 3UU3A 5J5GA 2X00D 4TNVA 4AFTA 2VL0A 4UXUA 4IREA 4ZRUA 2Y57A 4FRRA 4ZK1A 4ZZBA 2BG9E 2BJ0A 2XNUA 2BYQA 4UM3S 5BW2A 4HFEA 4IL4A 2XYTA 4ZJSA 2UZ6A 4D01A 5AFKA 4AFGA 4QH5A 4QABA 5HEJA 4PIRA 4ALXA 3SIOA 5AINA 2BG9A 4HFDA 5J5FA 5AFJA 5L4EA 5TVCA 3UQ7A 3PEOA 5J5HA 4UM3P 4ZZCA 4LMJA 4WV9A 3U8MA 5AFNA 3ZKRA 3SQ9A 2XZ5A 4XHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RHW A;  2WZY A;  1UW6 A;  3TLU A;  3UUB A;  4NPP A;  1UX2 A;  2XQ5 A;  3JAF A;  5LXB A;  3T4M A;  2XQ4 A;  3LSV A;  2W8F A;  4TWD A;  3UQ4 A;  3ZDH A;  3U8L A;  2WNL A;  4TNW A;  3SH1 A;  2Y54 A;  4ILA A;  5AFM B;  3C79 A;  3EAM A;  2YME A;  4UM1 A;  4QH4 A;  2W8G A;  3GUA A;  3WTK A;  3WTH A;  4DBM A;  4HFH A;  4X5T A;  3RQW A;  5L47 A;  5FJV A;  5BP0 A;  2WN9 A;  2YMD A;  2XZ6 A;  4Z90 A;  2PGZ A;  4COF A;  4BFQ A;  3UU4 A;  5KE4 A;  3SQ6 A;  2XNV A;  5HEU A;  4QAA A;  3TLS A;  3RQU A;  3UU8 A;  1I9B A;  3ZDG A;  3P50 A;  5CFB A;  5SYO A;  4EZ1 A;  3WTJ A;  5HCM A;  4ZK4 A;  3U8N A;  2BR7 A;  2C9T A;  4F8H A;  4QAC A;  4Z91 A;  5HEH A;  3P4W A;  2XQA A;  2Y7Y A;  4LML A;  4AFH A;  2BR8 A;  2PH9 A;  2WNJ A;  2WNC A;  2XNT A;  3RIF A;  3TLV A;  4HQP A;  5AFM A;  4TWF A;  2YOE A;  2BG9 C;  3WTL A;  3UU6 A;  2QC1 B;  3TLT A;  5J5I A;  4UM3 A;  3IGQ A;  3C84 A;  4ILB A;  2Y58 A;  4IL9 A;  3WIP A;  4HFB A;  4ZJT A;  3WTM A;  3WTI A;  3PMZ A;  2XQ3 A;  4ZR6 A;  2XYS A;  2XQ6 A;  5IUX A;  2XQ7 A;  4B5D A;  2BYR A;  4HFI A;  3WTO A;  5BRX A;  2Y56 A;  1UV6 A;  2YKS A;  3EI0 A;  3TLW A;  4NZB A;  5HEO A;  4BQT A;  2YN6 A;  4QH1 A;  4HFC A;  3JAE A;  5JME A;  4A97 A;  5KZU A;  3RIA A;  5L4H A;  3EHZ A;  2BYP A;  5AFL A;  2XQ8 A;  4LMK A;  4UY2 A;  4ILC A;  2ZJU A;  4TWH A;  5AFH A;  5LG3 A;  4XK9 A;  3WTN A;  2ZJV A;  5J0Z A;  3JAD A;  2BG9 B;  3RI5 A;  4A98 A;  3U8K A;  2X00 A;  5CO5 A;  2BYS A;  5HCJ A;  3UU5 A;  5HEG A;  3U8J A;  2XQ9 A;  2BYN A;  3UU3 A;  5J5G A;  2X00 D;  4TNV A;  4AFT A;  2VL0 A;  4UXU A;  4IRE A;  4ZRU A;  2Y57 A;  4FRR A;  4ZK1 A;  4ZZB A;  2BG9 E;  2BJ0 A;  2XNU A;  2BYQ A;  4UM3 S;  5BW2 A;  4HFE A;  4IL4 A;  2XYT A;  4ZJS A;  2UZ6 A;  4D01 A;  5AFK A;  4AFG A;  4QH5 A;  4QAB A;  5HEJ A;  4PIR A;  4ALX A;  3SIO A;  5AIN A;  2BG9 A;  4HFD A;  5J5F A;  5AFJ A;  5L4E A;  5TVC A;  3UQ7 A;  3PEO A;  5J5H A;  4UM3 P;  4ZZC A;  4LMJ A;  4WV9 A;  3U8M A;  5AFN A;  3ZKR A;  3SQ9 A;  2XZ5 A;  4XHE A; 
#chains in the Genus database with same CATH topology
 3RHW A;  2WZY A;  1UW6 A;  3TLU A;  3UUB A;  4NPP A;  1UX2 A;  2XQ5 A;  3JAF A;  5LXB A;  3T4M A;  2XQ4 A;  3LSV A;  2W8F A;  4TWD A;  3UQ4 A;  3ZDH A;  3U8L A;  2WNL A;  4TNW A;  3SH1 A;  2Y54 A;  4ILA A;  5AFM B;  3C79 A;  3EAM A;  2YME A;  4UM1 A;  4QH4 A;  2W8G A;  3GUA A;  3WTK A;  3WTH A;  4DBM A;  4HFH A;  4X5T A;  3RQW A;  5L47 A;  5FJV A;  5BP0 A;  2WN9 A;  2YMD A;  2XZ6 A;  4Z90 A;  2PGZ A;  4COF A;  4BFQ A;  3UU4 A;  5KE4 A;  3SQ6 A;  2XNV A;  5HEU A;  4QAA A;  3TLS A;  3RQU A;  3UU8 A;  1I9B A;  3ZDG A;  3P50 A;  5CFB A;  5SYO A;  4EZ1 A;  3WTJ A;  5HCM A;  4ZK4 A;  3U8N A;  2BR7 A;  2C9T A;  4F8H A;  4QAC A;  4Z91 A;  5HEH A;  3P4W A;  2XQA A;  2Y7Y A;  4LML A;  4AFH A;  2BR8 A;  2PH9 A;  2WNJ A;  2WNC A;  2XNT A;  3RIF A;  3TLV A;  4HQP A;  5AFM A;  4TWF A;  2YOE A;  2BG9 C;  3WTL A;  3UU6 A;  2QC1 B;  3TLT A;  5J5I A;  4UM3 A;  3IGQ A;  3C84 A;  4ILB A;  2Y58 A;  4IL9 A;  3WIP A;  4HFB A;  4ZJT A;  3WTM A;  3WTI A;  3PMZ A;  2XQ3 A;  4ZR6 A;  2XYS A;  2XQ6 A;  5IUX A;  2XQ7 A;  4B5D A;  2BYR A;  4HFI A;  3WTO A;  5BRX A;  2Y56 A;  1UV6 A;  2YKS A;  3EI0 A;  3TLW A;  4NZB A;  5HEO A;  4BQT A;  2YN6 A;  4QH1 A;  4HFC A;  3JAE A;  5JME A;  4A97 A;  5KZU A;  3RIA A;  5L4H A;  3EHZ A;  2BYP A;  5AFL A;  2XQ8 A;  4LMK A;  4UY2 A;  4ILC A;  2ZJU A;  4TWH A;  5AFH A;  5LG3 A;  4XK9 A;  3WTN A;  2ZJV A;  5J0Z A;  3JAD A;  2BG9 B;  3RI5 A;  4A98 A;  3U8K A;  2X00 A;  5CO5 A;  2BYS A;  5HCJ A;  3UU5 A;  5HEG A;  3U8J A;  2XQ9 A;  2BYN A;  3UU3 A;  5J5G A;  2X00 D;  4TNV A;  4AFT A;  2VL0 A;  4UXU A;  4IRE A;  4ZRU A;  2Y57 A;  4FRR A;  4ZK1 A;  4ZZB A;  2BG9 E;  2BJ0 A;  2XNU A;  2BYQ A;  4UM3 S;  5BW2 A;  4HFE A;  4IL4 A;  2XYT A;  4ZJS A;  2UZ6 A;  4D01 A;  5AFK A;  4AFG A;  4QH5 A;  4QAB A;  5HEJ A;  4PIR A;  4ALX A;  3SIO A;  5AIN A;  2BG9 A;  4HFD A;  5J5F A;  5AFJ A;  5L4E A;  5TVC A;  3UQ7 A;  3PEO A;  5J5H A;  4UM3 P;  4ZZC A;  4LMJ A;  4WV9 A;  3U8M A;  5AFN A;  3ZKR A;  3SQ9 A;  2XZ5 A;  4XHE A; 
#chains in the Genus database with same CATH homology
 3RHW A;  2WZY A;  1UW6 A;  3TLU A;  3UUB A;  4NPP A;  1UX2 A;  2XQ5 A;  3JAF A;  5LXB A;  3T4M A;  2XQ4 A;  3LSV A;  2W8F A;  4TWD A;  3UQ4 A;  3ZDH A;  3U8L A;  2WNL A;  4TNW A;  3SH1 A;  2Y54 A;  4ILA A;  5AFM B;  3C79 A;  3EAM A;  2YME A;  4UM1 A;  4QH4 A;  2W8G A;  3GUA A;  3WTK A;  3WTH A;  4DBM A;  4HFH A;  4X5T A;  3RQW A;  5L47 A;  5FJV A;  5BP0 A;  2WN9 A;  2YMD A;  2XZ6 A;  4Z90 A;  2PGZ A;  4COF A;  4BFQ A;  3UU4 A;  5KE4 A;  3SQ6 A;  2XNV A;  5HEU A;  4QAA A;  3TLS A;  3RQU A;  3UU8 A;  1I9B A;  3ZDG A;  3P50 A;  5CFB A;  5SYO A;  4EZ1 A;  3WTJ A;  5HCM A;  4ZK4 A;  3U8N A;  2BR7 A;  2C9T A;  4F8H A;  4QAC A;  4Z91 A;  5HEH A;  3P4W A;  2XQA A;  2Y7Y A;  4LML A;  4AFH A;  2BR8 A;  2PH9 A;  2WNJ A;  2WNC A;  2XNT A;  3RIF A;  3TLV A;  4HQP A;  5AFM A;  4TWF A;  2YOE A;  2BG9 C;  3WTL A;  3UU6 A;  2QC1 B;  3TLT A;  5J5I A;  4UM3 A;  3IGQ A;  3C84 A;  4ILB A;  2Y58 A;  4IL9 A;  3WIP A;  4HFB A;  4ZJT A;  3WTM A;  3WTI A;  3PMZ A;  2XQ3 A;  4ZR6 A;  2XYS A;  2XQ6 A;  5IUX A;  2XQ7 A;  4B5D A;  2BYR A;  4HFI A;  3WTO A;  5BRX A;  2Y56 A;  1UV6 A;  2YKS A;  3EI0 A;  3TLW A;  4NZB A;  5HEO A;  4BQT A;  2YN6 A;  4QH1 A;  4HFC A;  3JAE A;  5JME A;  4A97 A;  5KZU A;  3RIA A;  5L4H A;  3EHZ A;  2BYP A;  5AFL A;  2XQ8 A;  4LMK A;  4UY2 A;  4ILC A;  2ZJU A;  4TWH A;  5AFH A;  5LG3 A;  4XK9 A;  3WTN A;  2ZJV A;  5J0Z A;  3JAD A;  2BG9 B;  3RI5 A;  4A98 A;  3U8K A;  2X00 A;  5CO5 A;  2BYS A;  5HCJ A;  3UU5 A;  5HEG A;  3U8J A;  2XQ9 A;  2BYN A;  3UU3 A;  5J5G A;  2X00 D;  4TNV A;  4AFT A;  2VL0 A;  4UXU A;  4IRE A;  4ZRU A;  2Y57 A;  4FRR A;  4ZK1 A;  4ZZB A;  2BG9 E;  2BJ0 A;  2XNU A;  2BYQ A;  4UM3 S;  5BW2 A;  4HFE A;  4IL4 A;  2XYT A;  4ZJS A;  2UZ6 A;  4D01 A;  5AFK A;  4AFG A;  4QH5 A;  4QAB A;  5HEJ A;  4PIR A;  4ALX A;  3SIO A;  5AIN A;  2BG9 A;  4HFD A;  5J5F A;  5AFJ A;  5L4E A;  5TVC A;  3UQ7 A;  3PEO A;  5J5H A;  4UM3 P;  4ZZC A;  4LMJ A;  4WV9 A;  3U8M A;  5AFN A;  3ZKR A;  3SQ9 A;  2XZ5 A;  4XHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...