3U8LA

Crystal structure of the acetylcholine binding protein (achbp) from lymnaea stagnalis in complex with ns3570 (1-(5-phenylpyridin-3-yl)-1,4-diazepane)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
202
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein/agonist
molecule keywords Acetylcholine-binding protein
publication title Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine alpha 4 beta 2 receptors: unique role of halogen bonding revealed.
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 49
structure length 202
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3u8lA00
2Y7YA 2PH9A 3ZDGA 4BFQA 2W8GA 2XQ6A 4IREA 5FJVA 5HEUA 2ZJVA 5LG3A 4ZK1A 2XNUA 5TVCA 3WTNA 5KE4A 3U8NA 4DBMA 2XQAA 4TNWA 2X00D 3GUAA 5AFKA 3SIOA 2YOEA 5J5FA 2BG9E 2BJ0A 2BR7A 2WZYA 2QC1B 2WNCA 2BR8A 4IL9A 2YMDA 4ILAA 3ZKRA 4UY2A 4QH5A 4ZK4A 2BG9B 5HEGA 4X5TA 2XYSA 4UM3S 5AFMA 5L4HA 4HFEA 3TLUA 4A97A 3EHZA 2BYQA 2BYSA 2XQ8A 4LMJA 3SQ6A 3UQ7A 4QACA 2BG9C 2XNVA 4ZZCA 5AFJA 3SQ9A 1I9BA 2VL0A 5BP0A 3EI0A 3PEOA 4LMKA 2WNLA 5HEOA 5L47A 5J5IA 5SYOA 2UZ6A 4HFHA 4UM3A 4HQPA 4ILCA 3UU3A 2Y57A 2YN6A 3WTOA 4XK9A 4TWFA 3WTLA 5AFHA 3WTMA 3UU4A 4AFGA 4QABA 3UU5A 3JADA 4QH1A 3UU8A 4PIRA 3U8MA 2X00A 2BG9A 4HFIA 4UM3P 3UQ4A 4Z90A 2XQ7A 4Z91A 4FRRA 3RI5A 3RHWA 4AFHA 4ALXA 4HFBA 5BRXA 4HFDA 3JAFA 3RIFA 5HEJA 4ZJSA 3UUBA 2Y58A 3IGQA 3TLVA 3EAMA 3WIPA 2XNTA 2YKSA 3C79A 4A98A 4COFA 2WNJA 2Y54A 2XQ5A 2YMEA 3JAEA 2BYPA 3WTHA 2BYRA 4ILBA 4UXUA 4UM1A 5J5GA 3UU6A 4QH4A 3RIAA 3RQWA 5L4EA 3ZDHA 4WV9A 3P50A 2XQ3A 3TLWA 5HEHA 5AFLA 1UV6A 3TLTA 4ZRUA 5KZUA 3U8JA 3WTIA 5AFMB 3P4WA 3U8LA 5HCMA 3RQUA 5BW2A 4ZR6A 2XQ4A 4NZBA 3PMZA 3WTJA 4ZJTA 5CO5A 2XQ9A 5AINA 5AFNA 3TLSA 4B5DA 5CFBA 2WN9A 3LSVA 2BYNA 2XYTA 4BQTA 4NPPA 2PGZA 5J0ZA 2W8FA 1UW6A 2C9TA 4ZZBA 4HFCA 4TWDA 3U8KA 3T4MA 2Y56A 4F8HA 2XZ6A 4LMLA 3SH1A 4TNVA 3WTKA 4TWHA 2ZJUA 5JMEA 2XZ5A 4D01A 5IUXA 4EZ1A 4QAAA 5J5HA 5LXBA 3C84A 5HCJA 4IL4A 4AFTA 1UX2A 4XHEA
chains in the Genus database with same CATH superfamily
2Y7YA 2PH9A 3ZDGA 4BFQA 2W8GA 2XQ6A 4IREA 5FJVA 5HEUA 2ZJVA 5LG3A 4ZK1A 2XNUA 5TVCA 3WTNA 5KE4A 3U8NA 4DBMA 2XQAA 4TNWA 2X00D 3GUAA 5AFKA 3SIOA 2YOEA 5J5FA 2BG9E 2BJ0A 2BR7A 2WZYA 2QC1B 2WNCA 2BR8A 4IL9A 2YMDA 4ILAA 3ZKRA 4UY2A 4QH5A 4ZK4A 2BG9B 5HEGA 4X5TA 2XYSA 4UM3S 5AFMA 5L4HA 4HFEA 3TLUA 4A97A 3EHZA 2BYQA 2BYSA 2XQ8A 4LMJA 3SQ6A 3UQ7A 4QACA 2BG9C 2XNVA 4ZZCA 5AFJA 3SQ9A 1I9BA 2VL0A 5BP0A 3EI0A 3PEOA 4LMKA 2WNLA 5HEOA 5L47A 5J5IA 5SYOA 2UZ6A 4HFHA 4UM3A 4HQPA 4ILCA 3UU3A 2Y57A 2YN6A 3WTOA 4XK9A 4TWFA 3WTLA 5AFHA 3WTMA 3UU4A 4AFGA 4QABA 3UU5A 3JADA 4QH1A 3UU8A 4PIRA 3U8MA 2X00A 2BG9A 4HFIA 4UM3P 3UQ4A 4Z90A 2XQ7A 4Z91A 4FRRA 3RI5A 3RHWA 4AFHA 4ALXA 4HFBA 5BRXA 4HFDA 3JAFA 3RIFA 5HEJA 4ZJSA 3UUBA 2Y58A 3IGQA 3TLVA 3EAMA 3WIPA 2XNTA 2YKSA 3C79A 4A98A 4COFA 2WNJA 2Y54A 2XQ5A 2YMEA 3JAEA 2BYPA 3WTHA 2BYRA 4ILBA 4UXUA 4UM1A 5J5GA 3UU6A 4QH4A 3RIAA 3RQWA 5L4EA 3ZDHA 4WV9A 3P50A 2XQ3A 3TLWA 5HEHA 5AFLA 1UV6A 3TLTA 4ZRUA 5KZUA 3U8JA 3WTIA 5AFMB 3P4WA 3U8LA 5HCMA 3RQUA 5BW2A 4ZR6A 2XQ4A 4NZBA 3PMZA 3WTJA 4ZJTA 5CO5A 2XQ9A 5AINA 5AFNA 3TLSA 4B5DA 5CFBA 2WN9A 3LSVA 2BYNA 2XYTA 4BQTA 4NPPA 2PGZA 5J0ZA 2W8FA 1UW6A 2C9TA 4ZZBA 4HFCA 4TWDA 3U8KA 3T4MA 2Y56A 4F8HA 2XZ6A 4LMLA 3SH1A 4TNVA 3WTKA 4TWHA 2ZJUA 5JMEA 2XZ5A 4D01A 5IUXA 4EZ1A 4QAAA 5J5HA 5LXBA 3C84A 5HCJA 4IL4A 4AFTA 1UX2A 4XHEA
chains in the Genus database with same CATH topology
2Y7YA 2PH9A 3ZDGA 4BFQA 2W8GA 2XQ6A 4IREA 5FJVA 5HEUA 2ZJVA 5LG3A 4ZK1A 2XNUA 5TVCA 3WTNA 5KE4A 3U8NA 4DBMA 2XQAA 4TNWA 2X00D 3GUAA 5AFKA 3SIOA 2YOEA 5J5FA 2BG9E 2BJ0A 2BR7A 2WZYA 2QC1B 2WNCA 2BR8A 4IL9A 2YMDA 4ILAA 3ZKRA 4UY2A 4QH5A 4ZK4A 2BG9B 5HEGA 4X5TA 2XYSA 4UM3S 5AFMA 5L4HA 4HFEA 3TLUA 4A97A 3EHZA 2BYQA 2BYSA 2XQ8A 4LMJA 3SQ6A 3UQ7A 4QACA 2BG9C 2XNVA 4ZZCA 5AFJA 3SQ9A 1I9BA 2VL0A 5BP0A 3EI0A 3PEOA 4LMKA 2WNLA 5HEOA 5L47A 5J5IA 5SYOA 2UZ6A 4HFHA 4UM3A 4HQPA 4ILCA 3UU3A 2Y57A 2YN6A 3WTOA 4XK9A 4TWFA 3WTLA 5AFHA 3WTMA 3UU4A 4AFGA 4QABA 3UU5A 3JADA 4QH1A 3UU8A 4PIRA 3U8MA 2X00A 2BG9A 4HFIA 4UM3P 3UQ4A 4Z90A 2XQ7A 4Z91A 4FRRA 3RI5A 3RHWA 4AFHA 4ALXA 4HFBA 5BRXA 4HFDA 3JAFA 3RIFA 5HEJA 4ZJSA 3UUBA 2Y58A 3IGQA 3TLVA 3EAMA 3WIPA 2XNTA 2YKSA 3C79A 4A98A 4COFA 2WNJA 2Y54A 2XQ5A 2YMEA 3JAEA 2BYPA 3WTHA 2BYRA 4ILBA 4UXUA 4UM1A 5J5GA 3UU6A 4QH4A 3RIAA 3RQWA 5L4EA 3ZDHA 4WV9A 3P50A 2XQ3A 3TLWA 5HEHA 5AFLA 1UV6A 3TLTA 4ZRUA 5KZUA 3U8JA 3WTIA 5AFMB 3P4WA 3U8LA 5HCMA 3RQUA 5BW2A 4ZR6A 2XQ4A 4NZBA 3PMZA 3WTJA 4ZJTA 5CO5A 2XQ9A 5AINA 5AFNA 3TLSA 4B5DA 5CFBA 2WN9A 3LSVA 2BYNA 2XYTA 4BQTA 4NPPA 2PGZA 5J0ZA 2W8FA 1UW6A 2C9TA 4ZZBA 4HFCA 4TWDA 3U8KA 3T4MA 2Y56A 4F8HA 2XZ6A 4LMLA 3SH1A 4TNVA 3WTKA 4TWHA 2ZJUA 5JMEA 2XZ5A 4D01A 5IUXA 4EZ1A 4QAAA 5J5HA 5LXBA 3C84A 5HCJA 4IL4A 4AFTA 1UX2A 4XHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y7Y A;  2PH9 A;  3ZDG A;  4BFQ A;  2W8G A;  2XQ6 A;  4IRE A;  5FJV A;  5HEU A;  2ZJV A;  5LG3 A;  4ZK1 A;  2XNU A;  5TVC A;  3WTN A;  5KE4 A;  3U8N A;  4DBM A;  2XQA A;  4TNW A;  2X00 D;  3GUA A;  5AFK A;  3SIO A;  2YOE A;  5J5F A;  2BG9 E;  2BJ0 A;  2BR7 A;  2WZY A;  2QC1 B;  2WNC A;  2BR8 A;  4IL9 A;  2YMD A;  4ILA A;  3ZKR A;  4UY2 A;  4QH5 A;  4ZK4 A;  2BG9 B;  5HEG A;  4X5T A;  2XYS A;  4UM3 S;  5AFM A;  5L4H A;  4HFE A;  3TLU A;  4A97 A;  3EHZ A;  2BYQ A;  2BYS A;  2XQ8 A;  4LMJ A;  3SQ6 A;  3UQ7 A;  4QAC A;  2BG9 C;  2XNV A;  4ZZC A;  5AFJ A;  3SQ9 A;  1I9B A;  2VL0 A;  5BP0 A;  3EI0 A;  3PEO A;  4LMK A;  2WNL A;  5HEO A;  5L47 A;  5J5I A;  5SYO A;  2UZ6 A;  4HFH A;  4UM3 A;  4HQP A;  4ILC A;  3UU3 A;  2Y57 A;  2YN6 A;  3WTO A;  4XK9 A;  4TWF A;  3WTL A;  5AFH A;  3WTM A;  3UU4 A;  4AFG A;  4QAB A;  3UU5 A;  3JAD A;  4QH1 A;  3UU8 A;  4PIR A;  3U8M A;  2X00 A;  2BG9 A;  4HFI A;  4UM3 P;  3UQ4 A;  4Z90 A;  2XQ7 A;  4Z91 A;  4FRR A;  3RI5 A;  3RHW A;  4AFH A;  4ALX A;  4HFB A;  5BRX A;  4HFD A;  3JAF A;  3RIF A;  5HEJ A;  4ZJS A;  3UUB A;  2Y58 A;  3IGQ A;  3TLV A;  3EAM A;  3WIP A;  2XNT A;  2YKS A;  3C79 A;  4A98 A;  4COF A;  2WNJ A;  2Y54 A;  2XQ5 A;  2YME A;  3JAE A;  2BYP A;  3WTH A;  2BYR A;  4ILB A;  4UXU A;  4UM1 A;  5J5G A;  3UU6 A;  4QH4 A;  3RIA A;  3RQW A;  5L4E A;  3ZDH A;  4WV9 A;  3P50 A;  2XQ3 A;  3TLW A;  5HEH A;  5AFL A;  1UV6 A;  3TLT A;  4ZRU A;  5KZU A;  3U8J A;  3WTI A;  5AFM B;  3P4W A;  3U8L A;  5HCM A;  3RQU A;  5BW2 A;  4ZR6 A;  2XQ4 A;  4NZB A;  3PMZ A;  3WTJ A;  4ZJT A;  5CO5 A;  2XQ9 A;  5AIN A;  5AFN A;  3TLS A;  4B5D A;  5CFB A;  2WN9 A;  3LSV A;  2BYN A;  2XYT A;  4BQT A;  4NPP A;  2PGZ A;  5J0Z A;  2W8F A;  1UW6 A;  2C9T A;  4ZZB A;  4HFC A;  4TWD A;  3U8K A;  3T4M A;  2Y56 A;  4F8H A;  2XZ6 A;  4LML A;  3SH1 A;  4TNV A;  3WTK A;  4TWH A;  2ZJU A;  5JME A;  2XZ5 A;  4D01 A;  5IUX A;  4EZ1 A;  4QAA A;  5J5H A;  5LXB A;  3C84 A;  5HCJ A;  4IL4 A;  4AFT A;  1UX2 A;  4XHE A; 
#chains in the Genus database with same CATH topology
 2Y7Y A;  2PH9 A;  3ZDG A;  4BFQ A;  2W8G A;  2XQ6 A;  4IRE A;  5FJV A;  5HEU A;  2ZJV A;  5LG3 A;  4ZK1 A;  2XNU A;  5TVC A;  3WTN A;  5KE4 A;  3U8N A;  4DBM A;  2XQA A;  4TNW A;  2X00 D;  3GUA A;  5AFK A;  3SIO A;  2YOE A;  5J5F A;  2BG9 E;  2BJ0 A;  2BR7 A;  2WZY A;  2QC1 B;  2WNC A;  2BR8 A;  4IL9 A;  2YMD A;  4ILA A;  3ZKR A;  4UY2 A;  4QH5 A;  4ZK4 A;  2BG9 B;  5HEG A;  4X5T A;  2XYS A;  4UM3 S;  5AFM A;  5L4H A;  4HFE A;  3TLU A;  4A97 A;  3EHZ A;  2BYQ A;  2BYS A;  2XQ8 A;  4LMJ A;  3SQ6 A;  3UQ7 A;  4QAC A;  2BG9 C;  2XNV A;  4ZZC A;  5AFJ A;  3SQ9 A;  1I9B A;  2VL0 A;  5BP0 A;  3EI0 A;  3PEO A;  4LMK A;  2WNL A;  5HEO A;  5L47 A;  5J5I A;  5SYO A;  2UZ6 A;  4HFH A;  4UM3 A;  4HQP A;  4ILC A;  3UU3 A;  2Y57 A;  2YN6 A;  3WTO A;  4XK9 A;  4TWF A;  3WTL A;  5AFH A;  3WTM A;  3UU4 A;  4AFG A;  4QAB A;  3UU5 A;  3JAD A;  4QH1 A;  3UU8 A;  4PIR A;  3U8M A;  2X00 A;  2BG9 A;  4HFI A;  4UM3 P;  3UQ4 A;  4Z90 A;  2XQ7 A;  4Z91 A;  4FRR A;  3RI5 A;  3RHW A;  4AFH A;  4ALX A;  4HFB A;  5BRX A;  4HFD A;  3JAF A;  3RIF A;  5HEJ A;  4ZJS A;  3UUB A;  2Y58 A;  3IGQ A;  3TLV A;  3EAM A;  3WIP A;  2XNT A;  2YKS A;  3C79 A;  4A98 A;  4COF A;  2WNJ A;  2Y54 A;  2XQ5 A;  2YME A;  3JAE A;  2BYP A;  3WTH A;  2BYR A;  4ILB A;  4UXU A;  4UM1 A;  5J5G A;  3UU6 A;  4QH4 A;  3RIA A;  3RQW A;  5L4E A;  3ZDH A;  4WV9 A;  3P50 A;  2XQ3 A;  3TLW A;  5HEH A;  5AFL A;  1UV6 A;  3TLT A;  4ZRU A;  5KZU A;  3U8J A;  3WTI A;  5AFM B;  3P4W A;  3U8L A;  5HCM A;  3RQU A;  5BW2 A;  4ZR6 A;  2XQ4 A;  4NZB A;  3PMZ A;  3WTJ A;  4ZJT A;  5CO5 A;  2XQ9 A;  5AIN A;  5AFN A;  3TLS A;  4B5D A;  5CFB A;  2WN9 A;  3LSV A;  2BYN A;  2XYT A;  4BQT A;  4NPP A;  2PGZ A;  5J0Z A;  2W8F A;  1UW6 A;  2C9T A;  4ZZB A;  4HFC A;  4TWD A;  3U8K A;  3T4M A;  2Y56 A;  4F8H A;  2XZ6 A;  4LML A;  3SH1 A;  4TNV A;  3WTK A;  4TWH A;  2ZJU A;  5JME A;  2XZ5 A;  4D01 A;  5IUX A;  4EZ1 A;  4QAA A;  5J5H A;  5LXB A;  3C84 A;  5HCJ A;  4IL4 A;  4AFT A;  1UX2 A;  4XHE A; 
#chains in the Genus database with same CATH homology
 2Y7Y A;  2PH9 A;  3ZDG A;  4BFQ A;  2W8G A;  2XQ6 A;  4IRE A;  5FJV A;  5HEU A;  2ZJV A;  5LG3 A;  4ZK1 A;  2XNU A;  5TVC A;  3WTN A;  5KE4 A;  3U8N A;  4DBM A;  2XQA A;  4TNW A;  2X00 D;  3GUA A;  5AFK A;  3SIO A;  2YOE A;  5J5F A;  2BG9 E;  2BJ0 A;  2BR7 A;  2WZY A;  2QC1 B;  2WNC A;  2BR8 A;  4IL9 A;  2YMD A;  4ILA A;  3ZKR A;  4UY2 A;  4QH5 A;  4ZK4 A;  2BG9 B;  5HEG A;  4X5T A;  2XYS A;  4UM3 S;  5AFM A;  5L4H A;  4HFE A;  3TLU A;  4A97 A;  3EHZ A;  2BYQ A;  2BYS A;  2XQ8 A;  4LMJ A;  3SQ6 A;  3UQ7 A;  4QAC A;  2BG9 C;  2XNV A;  4ZZC A;  5AFJ A;  3SQ9 A;  1I9B A;  2VL0 A;  5BP0 A;  3EI0 A;  3PEO A;  4LMK A;  2WNL A;  5HEO A;  5L47 A;  5J5I A;  5SYO A;  2UZ6 A;  4HFH A;  4UM3 A;  4HQP A;  4ILC A;  3UU3 A;  2Y57 A;  2YN6 A;  3WTO A;  4XK9 A;  4TWF A;  3WTL A;  5AFH A;  3WTM A;  3UU4 A;  4AFG A;  4QAB A;  3UU5 A;  3JAD A;  4QH1 A;  3UU8 A;  4PIR A;  3U8M A;  2X00 A;  2BG9 A;  4HFI A;  4UM3 P;  3UQ4 A;  4Z90 A;  2XQ7 A;  4Z91 A;  4FRR A;  3RI5 A;  3RHW A;  4AFH A;  4ALX A;  4HFB A;  5BRX A;  4HFD A;  3JAF A;  3RIF A;  5HEJ A;  4ZJS A;  3UUB A;  2Y58 A;  3IGQ A;  3TLV A;  3EAM A;  3WIP A;  2XNT A;  2YKS A;  3C79 A;  4A98 A;  4COF A;  2WNJ A;  2Y54 A;  2XQ5 A;  2YME A;  3JAE A;  2BYP A;  3WTH A;  2BYR A;  4ILB A;  4UXU A;  4UM1 A;  5J5G A;  3UU6 A;  4QH4 A;  3RIA A;  3RQW A;  5L4E A;  3ZDH A;  4WV9 A;  3P50 A;  2XQ3 A;  3TLW A;  5HEH A;  5AFL A;  1UV6 A;  3TLT A;  4ZRU A;  5KZU A;  3U8J A;  3WTI A;  5AFM B;  3P4W A;  3U8L A;  5HCM A;  3RQU A;  5BW2 A;  4ZR6 A;  2XQ4 A;  4NZB A;  3PMZ A;  3WTJ A;  4ZJT A;  5CO5 A;  2XQ9 A;  5AIN A;  5AFN A;  3TLS A;  4B5D A;  5CFB A;  2WN9 A;  3LSV A;  2BYN A;  2XYT A;  4BQT A;  4NPP A;  2PGZ A;  5J0Z A;  2W8F A;  1UW6 A;  2C9T A;  4ZZB A;  4HFC A;  4TWD A;  3U8K A;  3T4M A;  2Y56 A;  4F8H A;  2XZ6 A;  4LML A;  3SH1 A;  4TNV A;  3WTK A;  4TWH A;  2ZJU A;  5JME A;  2XZ5 A;  4D01 A;  5IUX A;  4EZ1 A;  4QAA A;  5J5H A;  5LXB A;  3C84 A;  5HCJ A;  4IL4 A;  4AFT A;  1UX2 A;  4XHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...