2BYPA

Crystal structure of aplysia californica achbp in complex with alpha- conotoxin imi
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
213
structure length
210
Chain Sequence
DDDKLHSQANLMRLKSDLFNRYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structures of Aplysia Achbp Complexes with Nicotinic Agonists and Antagonists Reveal Distinctive Binding Interfaces and Conformations.
pubmed doi rcsb
source organism Aplysia californica
total genus 55
structure length 210
sequence length 213
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bypA00
5SYOA 2XQ9A 2WNJA 5TVCA 2WN9A 3SIOA 3WTLA 5AFLA 2BG9E 5KE4A 2Y7YA 5J5IA 4IL4A 4UM3P 5AFMB 4ZRUA 4AFGA 5L4HA 4HQPA 4TWHA 2WNLA 5AFKA 2QC1B 2ZJVA 4ZR6A 3U8LA 3WIPA 4LMLA 5LXBA 3UU4A 3TLWA 2UZ6A 3C84A 4TWFA 5HEOA 5HEHA 3SQ9A 2BYRA 5AFHA 3RHWA 3WTMA 3JAEA 3WTKA 4QABA 4COFA 5LG3A 4QAAA 3JAFA 3GUAA 3T4MA 2XYSA 4NPPA 4DBMA 4HFBA 5BP0A 3ZDHA 2XQAA 4Z90A 3U8MA 4X5TA 4A97A 3TLSA 2YMDA 1UV6A 5BRXA 3RIFA 4HFCA 1UX2A 1UW6A 2YOEA 3SH1A 2XZ5A 2YN6A 4UY2A 5CFBA 5AFMA 2X00A 4WV9A 3P4WA 4LMKA 5HEGA 4AFTA 4BQTA 2XQ4A 5FJVA 5L47A 3U8KA 5L4EA 3LSVA 2VL0A 4QH5A 4XHEA 5CO5A 2W8FA 4Z91A 3RIAA 2XQ7A 3TLTA 3UU8A 3ZDGA 2BR8A 5J5FA 2BG9B 2XQ8A 4ILBA 5J0ZA 2BG9A 2YKSA 5AFNA 3RI5A 4QH4A 3PMZA 4TWDA 5HCJA 5HEUA 5IUXA 2WNCA 2BYNA 2WZYA 4B5DA 4BFQA 5KZUA 3WTHA 2PH9A 4ZZCA 4IL9A 4UM1A 4QH1A 2XZ6A 4TNVA 1I9BA 5J5GA 3C79A 4ILCA 2XQ6A 2XNUA 3UU3A 2Y57A 4HFDA 4HFEA 4ZZBA 3IGQA 4ZK4A 2BG9C 4ILAA 2XYTA 3EHZA 3RQUA 4IREA 2BYSA 2C9TA 4UM3S 2Y56A 4UXUA 5JMEA 4UM3A 2Y54A 3WTOA 5HEJA 3RQWA 4ZJSA 3UQ7A 4ZJTA 2X00D 2ZJUA 2XQ5A 3WTIA 2BYQA 2W8GA 4QACA 3U8JA 2BJ0A 4LMJA 3ZKRA 3U8NA 4FRRA 5AINA 3UU6A 4HFIA 3SQ6A 4ZK1A 5AFJA 4PIRA 4A98A 4ALXA 2PGZA 2XQ3A 4NZBA 3P50A 3WTNA 3EAMA 2YMEA 3PEOA 4EZ1A 3EI0A 4TNWA 3TLUA 2Y58A 2XNTA 4HFHA 4XK9A 5HCMA 3UUBA 3UQ4A 3TLVA 4F8HA 4D01A 3WTJA 5J5HA 2BR7A 5BW2A 2XNVA 3UU5A 4AFHA 2BYPA 3JADA
chains in the Genus database with same CATH superfamily
5SYOA 2XQ9A 2WNJA 5TVCA 2WN9A 3SIOA 3WTLA 5AFLA 2BG9E 5KE4A 2Y7YA 5J5IA 4IL4A 4UM3P 5AFMB 4ZRUA 4AFGA 5L4HA 4HQPA 4TWHA 2WNLA 5AFKA 2QC1B 2ZJVA 4ZR6A 3U8LA 3WIPA 4LMLA 5LXBA 3UU4A 3TLWA 2UZ6A 3C84A 4TWFA 5HEOA 5HEHA 3SQ9A 2BYRA 5AFHA 3RHWA 3WTMA 3JAEA 3WTKA 4QABA 4COFA 5LG3A 4QAAA 3JAFA 3GUAA 3T4MA 2XYSA 4NPPA 4DBMA 4HFBA 5BP0A 3ZDHA 2XQAA 4Z90A 3U8MA 4X5TA 4A97A 3TLSA 2YMDA 1UV6A 5BRXA 3RIFA 4HFCA 1UX2A 1UW6A 2YOEA 3SH1A 2XZ5A 2YN6A 4UY2A 5CFBA 5AFMA 2X00A 4WV9A 3P4WA 4LMKA 5HEGA 4AFTA 4BQTA 2XQ4A 5FJVA 5L47A 3U8KA 5L4EA 3LSVA 2VL0A 4QH5A 4XHEA 5CO5A 2W8FA 4Z91A 3RIAA 2XQ7A 3TLTA 3UU8A 3ZDGA 2BR8A 5J5FA 2BG9B 2XQ8A 4ILBA 5J0ZA 2BG9A 2YKSA 5AFNA 3RI5A 4QH4A 3PMZA 4TWDA 5HCJA 5HEUA 5IUXA 2WNCA 2BYNA 2WZYA 4B5DA 4BFQA 5KZUA 3WTHA 2PH9A 4ZZCA 4IL9A 4UM1A 4QH1A 2XZ6A 4TNVA 1I9BA 5J5GA 3C79A 4ILCA 2XQ6A 2XNUA 3UU3A 2Y57A 4HFDA 4HFEA 4ZZBA 3IGQA 4ZK4A 2BG9C 4ILAA 2XYTA 3EHZA 3RQUA 4IREA 2BYSA 2C9TA 4UM3S 2Y56A 4UXUA 5JMEA 4UM3A 2Y54A 3WTOA 5HEJA 3RQWA 4ZJSA 3UQ7A 4ZJTA 2X00D 2ZJUA 2XQ5A 3WTIA 2BYQA 2W8GA 4QACA 3U8JA 2BJ0A 4LMJA 3ZKRA 3U8NA 4FRRA 5AINA 3UU6A 4HFIA 3SQ6A 4ZK1A 5AFJA 4PIRA 4A98A 4ALXA 2PGZA 2XQ3A 4NZBA 3P50A 3WTNA 3EAMA 2YMEA 3PEOA 4EZ1A 3EI0A 4TNWA 3TLUA 2Y58A 2XNTA 4HFHA 4XK9A 5HCMA 3UUBA 3UQ4A 3TLVA 4F8HA 4D01A 3WTJA 5J5HA 2BR7A 5BW2A 2XNVA 3UU5A 4AFHA 2BYPA 3JADA
chains in the Genus database with same CATH topology
5SYOA 2XQ9A 2WNJA 5TVCA 2WN9A 3SIOA 3WTLA 5AFLA 2BG9E 5KE4A 2Y7YA 5J5IA 4IL4A 4UM3P 5AFMB 4ZRUA 4AFGA 5L4HA 4HQPA 4TWHA 2WNLA 5AFKA 2QC1B 2ZJVA 4ZR6A 3U8LA 3WIPA 4LMLA 5LXBA 3UU4A 3TLWA 2UZ6A 3C84A 4TWFA 5HEOA 5HEHA 3SQ9A 2BYRA 5AFHA 3RHWA 3WTMA 3JAEA 3WTKA 4QABA 4COFA 5LG3A 4QAAA 3JAFA 3GUAA 3T4MA 2XYSA 4NPPA 4DBMA 4HFBA 5BP0A 3ZDHA 2XQAA 4Z90A 3U8MA 4X5TA 4A97A 3TLSA 2YMDA 1UV6A 5BRXA 3RIFA 4HFCA 1UX2A 1UW6A 2YOEA 3SH1A 2XZ5A 2YN6A 4UY2A 5CFBA 5AFMA 2X00A 4WV9A 3P4WA 4LMKA 5HEGA 4AFTA 4BQTA 2XQ4A 5FJVA 5L47A 3U8KA 5L4EA 3LSVA 2VL0A 4QH5A 4XHEA 5CO5A 2W8FA 4Z91A 3RIAA 2XQ7A 3TLTA 3UU8A 3ZDGA 2BR8A 5J5FA 2BG9B 2XQ8A 4ILBA 5J0ZA 2BG9A 2YKSA 5AFNA 3RI5A 4QH4A 3PMZA 4TWDA 5HCJA 5HEUA 5IUXA 2WNCA 2BYNA 2WZYA 4B5DA 4BFQA 5KZUA 3WTHA 2PH9A 4ZZCA 4IL9A 4UM1A 4QH1A 2XZ6A 4TNVA 1I9BA 5J5GA 3C79A 4ILCA 2XQ6A 2XNUA 3UU3A 2Y57A 4HFDA 4HFEA 4ZZBA 3IGQA 4ZK4A 2BG9C 4ILAA 2XYTA 3EHZA 3RQUA 4IREA 2BYSA 2C9TA 4UM3S 2Y56A 4UXUA 5JMEA 4UM3A 2Y54A 3WTOA 5HEJA 3RQWA 4ZJSA 3UQ7A 4ZJTA 2X00D 2ZJUA 2XQ5A 3WTIA 2BYQA 2W8GA 4QACA 3U8JA 2BJ0A 4LMJA 3ZKRA 3U8NA 4FRRA 5AINA 3UU6A 4HFIA 3SQ6A 4ZK1A 5AFJA 4PIRA 4A98A 4ALXA 2PGZA 2XQ3A 4NZBA 3P50A 3WTNA 3EAMA 2YMEA 3PEOA 4EZ1A 3EI0A 4TNWA 3TLUA 2Y58A 2XNTA 4HFHA 4XK9A 5HCMA 3UUBA 3UQ4A 3TLVA 4F8HA 4D01A 3WTJA 5J5HA 2BR7A 5BW2A 2XNVA 3UU5A 4AFHA 2BYPA 3JADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SYO A;  2XQ9 A;  2WNJ A;  5TVC A;  2WN9 A;  3SIO A;  3WTL A;  5AFL A;  2BG9 E;  5KE4 A;  2Y7Y A;  5J5I A;  4IL4 A;  4UM3 P;  5AFM B;  4ZRU A;  4AFG A;  5L4H A;  4HQP A;  4TWH A;  2WNL A;  5AFK A;  2QC1 B;  2ZJV A;  4ZR6 A;  3U8L A;  3WIP A;  4LML A;  5LXB A;  3UU4 A;  3TLW A;  2UZ6 A;  3C84 A;  4TWF A;  5HEO A;  5HEH A;  3SQ9 A;  2BYR A;  5AFH A;  3RHW A;  3WTM A;  3JAE A;  3WTK A;  4QAB A;  4COF A;  5LG3 A;  4QAA A;  3JAF A;  3GUA A;  3T4M A;  2XYS A;  4NPP A;  4DBM A;  4HFB A;  5BP0 A;  3ZDH A;  2XQA A;  4Z90 A;  3U8M A;  4X5T A;  4A97 A;  3TLS A;  2YMD A;  1UV6 A;  5BRX A;  3RIF A;  4HFC A;  1UX2 A;  1UW6 A;  2YOE A;  3SH1 A;  2XZ5 A;  2YN6 A;  4UY2 A;  5CFB A;  5AFM A;  2X00 A;  4WV9 A;  3P4W A;  4LMK A;  5HEG A;  4AFT A;  4BQT A;  2XQ4 A;  5FJV A;  5L47 A;  3U8K A;  5L4E A;  3LSV A;  2VL0 A;  4QH5 A;  4XHE A;  5CO5 A;  2W8F A;  4Z91 A;  3RIA A;  2XQ7 A;  3TLT A;  3UU8 A;  3ZDG A;  2BR8 A;  5J5F A;  2BG9 B;  2XQ8 A;  4ILB A;  5J0Z A;  2BG9 A;  2YKS A;  5AFN A;  3RI5 A;  4QH4 A;  3PMZ A;  4TWD A;  5HCJ A;  5HEU A;  5IUX A;  2WNC A;  2BYN A;  2WZY A;  4B5D A;  4BFQ A;  5KZU A;  3WTH A;  2PH9 A;  4ZZC A;  4IL9 A;  4UM1 A;  4QH1 A;  2XZ6 A;  4TNV A;  1I9B A;  5J5G A;  3C79 A;  4ILC A;  2XQ6 A;  2XNU A;  3UU3 A;  2Y57 A;  4HFD A;  4HFE A;  4ZZB A;  3IGQ A;  4ZK4 A;  2BG9 C;  4ILA A;  2XYT A;  3EHZ A;  3RQU A;  4IRE A;  2BYS A;  2C9T A;  4UM3 S;  2Y56 A;  4UXU A;  5JME A;  4UM3 A;  2Y54 A;  3WTO A;  5HEJ A;  3RQW A;  4ZJS A;  3UQ7 A;  4ZJT A;  2X00 D;  2ZJU A;  2XQ5 A;  3WTI A;  2BYQ A;  2W8G A;  4QAC A;  3U8J A;  2BJ0 A;  4LMJ A;  3ZKR A;  3U8N A;  4FRR A;  5AIN A;  3UU6 A;  4HFI A;  3SQ6 A;  4ZK1 A;  5AFJ A;  4PIR A;  4A98 A;  4ALX A;  2PGZ A;  2XQ3 A;  4NZB A;  3P50 A;  3WTN A;  3EAM A;  2YME A;  3PEO A;  4EZ1 A;  3EI0 A;  4TNW A;  3TLU A;  2Y58 A;  2XNT A;  4HFH A;  4XK9 A;  5HCM A;  3UUB A;  3UQ4 A;  3TLV A;  4F8H A;  4D01 A;  3WTJ A;  5J5H A;  2BR7 A;  5BW2 A;  2XNV A;  3UU5 A;  4AFH A;  2BYP A;  3JAD A; 
#chains in the Genus database with same CATH topology
 5SYO A;  2XQ9 A;  2WNJ A;  5TVC A;  2WN9 A;  3SIO A;  3WTL A;  5AFL A;  2BG9 E;  5KE4 A;  2Y7Y A;  5J5I A;  4IL4 A;  4UM3 P;  5AFM B;  4ZRU A;  4AFG A;  5L4H A;  4HQP A;  4TWH A;  2WNL A;  5AFK A;  2QC1 B;  2ZJV A;  4ZR6 A;  3U8L A;  3WIP A;  4LML A;  5LXB A;  3UU4 A;  3TLW A;  2UZ6 A;  3C84 A;  4TWF A;  5HEO A;  5HEH A;  3SQ9 A;  2BYR A;  5AFH A;  3RHW A;  3WTM A;  3JAE A;  3WTK A;  4QAB A;  4COF A;  5LG3 A;  4QAA A;  3JAF A;  3GUA A;  3T4M A;  2XYS A;  4NPP A;  4DBM A;  4HFB A;  5BP0 A;  3ZDH A;  2XQA A;  4Z90 A;  3U8M A;  4X5T A;  4A97 A;  3TLS A;  2YMD A;  1UV6 A;  5BRX A;  3RIF A;  4HFC A;  1UX2 A;  1UW6 A;  2YOE A;  3SH1 A;  2XZ5 A;  2YN6 A;  4UY2 A;  5CFB A;  5AFM A;  2X00 A;  4WV9 A;  3P4W A;  4LMK A;  5HEG A;  4AFT A;  4BQT A;  2XQ4 A;  5FJV A;  5L47 A;  3U8K A;  5L4E A;  3LSV A;  2VL0 A;  4QH5 A;  4XHE A;  5CO5 A;  2W8F A;  4Z91 A;  3RIA A;  2XQ7 A;  3TLT A;  3UU8 A;  3ZDG A;  2BR8 A;  5J5F A;  2BG9 B;  2XQ8 A;  4ILB A;  5J0Z A;  2BG9 A;  2YKS A;  5AFN A;  3RI5 A;  4QH4 A;  3PMZ A;  4TWD A;  5HCJ A;  5HEU A;  5IUX A;  2WNC A;  2BYN A;  2WZY A;  4B5D A;  4BFQ A;  5KZU A;  3WTH A;  2PH9 A;  4ZZC A;  4IL9 A;  4UM1 A;  4QH1 A;  2XZ6 A;  4TNV A;  1I9B A;  5J5G A;  3C79 A;  4ILC A;  2XQ6 A;  2XNU A;  3UU3 A;  2Y57 A;  4HFD A;  4HFE A;  4ZZB A;  3IGQ A;  4ZK4 A;  2BG9 C;  4ILA A;  2XYT A;  3EHZ A;  3RQU A;  4IRE A;  2BYS A;  2C9T A;  4UM3 S;  2Y56 A;  4UXU A;  5JME A;  4UM3 A;  2Y54 A;  3WTO A;  5HEJ A;  3RQW A;  4ZJS A;  3UQ7 A;  4ZJT A;  2X00 D;  2ZJU A;  2XQ5 A;  3WTI A;  2BYQ A;  2W8G A;  4QAC A;  3U8J A;  2BJ0 A;  4LMJ A;  3ZKR A;  3U8N A;  4FRR A;  5AIN A;  3UU6 A;  4HFI A;  3SQ6 A;  4ZK1 A;  5AFJ A;  4PIR A;  4A98 A;  4ALX A;  2PGZ A;  2XQ3 A;  4NZB A;  3P50 A;  3WTN A;  3EAM A;  2YME A;  3PEO A;  4EZ1 A;  3EI0 A;  4TNW A;  3TLU A;  2Y58 A;  2XNT A;  4HFH A;  4XK9 A;  5HCM A;  3UUB A;  3UQ4 A;  3TLV A;  4F8H A;  4D01 A;  3WTJ A;  5J5H A;  2BR7 A;  5BW2 A;  2XNV A;  3UU5 A;  4AFH A;  2BYP A;  3JAD A; 
#chains in the Genus database with same CATH homology
 5SYO A;  2XQ9 A;  2WNJ A;  5TVC A;  2WN9 A;  3SIO A;  3WTL A;  5AFL A;  2BG9 E;  5KE4 A;  2Y7Y A;  5J5I A;  4IL4 A;  4UM3 P;  5AFM B;  4ZRU A;  4AFG A;  5L4H A;  4HQP A;  4TWH A;  2WNL A;  5AFK A;  2QC1 B;  2ZJV A;  4ZR6 A;  3U8L A;  3WIP A;  4LML A;  5LXB A;  3UU4 A;  3TLW A;  2UZ6 A;  3C84 A;  4TWF A;  5HEO A;  5HEH A;  3SQ9 A;  2BYR A;  5AFH A;  3RHW A;  3WTM A;  3JAE A;  3WTK A;  4QAB A;  4COF A;  5LG3 A;  4QAA A;  3JAF A;  3GUA A;  3T4M A;  2XYS A;  4NPP A;  4DBM A;  4HFB A;  5BP0 A;  3ZDH A;  2XQA A;  4Z90 A;  3U8M A;  4X5T A;  4A97 A;  3TLS A;  2YMD A;  1UV6 A;  5BRX A;  3RIF A;  4HFC A;  1UX2 A;  1UW6 A;  2YOE A;  3SH1 A;  2XZ5 A;  2YN6 A;  4UY2 A;  5CFB A;  5AFM A;  2X00 A;  4WV9 A;  3P4W A;  4LMK A;  5HEG A;  4AFT A;  4BQT A;  2XQ4 A;  5FJV A;  5L47 A;  3U8K A;  5L4E A;  3LSV A;  2VL0 A;  4QH5 A;  4XHE A;  5CO5 A;  2W8F A;  4Z91 A;  3RIA A;  2XQ7 A;  3TLT A;  3UU8 A;  3ZDG A;  2BR8 A;  5J5F A;  2BG9 B;  2XQ8 A;  4ILB A;  5J0Z A;  2BG9 A;  2YKS A;  5AFN A;  3RI5 A;  4QH4 A;  3PMZ A;  4TWD A;  5HCJ A;  5HEU A;  5IUX A;  2WNC A;  2BYN A;  2WZY A;  4B5D A;  4BFQ A;  5KZU A;  3WTH A;  2PH9 A;  4ZZC A;  4IL9 A;  4UM1 A;  4QH1 A;  2XZ6 A;  4TNV A;  1I9B A;  5J5G A;  3C79 A;  4ILC A;  2XQ6 A;  2XNU A;  3UU3 A;  2Y57 A;  4HFD A;  4HFE A;  4ZZB A;  3IGQ A;  4ZK4 A;  2BG9 C;  4ILA A;  2XYT A;  3EHZ A;  3RQU A;  4IRE A;  2BYS A;  2C9T A;  4UM3 S;  2Y56 A;  4UXU A;  5JME A;  4UM3 A;  2Y54 A;  3WTO A;  5HEJ A;  3RQW A;  4ZJS A;  3UQ7 A;  4ZJT A;  2X00 D;  2ZJU A;  2XQ5 A;  3WTI A;  2BYQ A;  2W8G A;  4QAC A;  3U8J A;  2BJ0 A;  4LMJ A;  3ZKR A;  3U8N A;  4FRR A;  5AIN A;  3UU6 A;  4HFI A;  3SQ6 A;  4ZK1 A;  5AFJ A;  4PIR A;  4A98 A;  4ALX A;  2PGZ A;  2XQ3 A;  4NZB A;  3P50 A;  3WTN A;  3EAM A;  2YME A;  3PEO A;  4EZ1 A;  3EI0 A;  4TNW A;  3TLU A;  2Y58 A;  2XNT A;  4HFH A;  4XK9 A;  5HCM A;  3UUB A;  3UQ4 A;  3TLV A;  4F8H A;  4D01 A;  3WTJ A;  5J5H A;  2BR7 A;  5BW2 A;  2XNV A;  3UU5 A;  4AFH A;  2BYP A;  3JAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...