2XQ9A

Pentameric ligand gated ion channel glic mutant e221a in complex with tetraethylarsonium (teas)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
310
structure length
310
Chain Sequence
b'PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYDANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 85
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq9A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq9A01
3C84A 2WNJA 2XZ6A 5J5FA 4LMKA 4NPPA 1UV6A 3ZDGA 4AFHA 3JAFA 2Y58A 5HEOA 4ZJSA 3U8MA 4HFCA 5BP0A 4WV9A 2Y7YA 5KZUA 4UXUA 4XHEA 4DBMA 3TLSA 3UU4A 4HQPA 5TVCA 4A97A 2ZJUA 1I9BA 2C9TA 1OEDC 2Y54A 4ZRUA 3RIFA 4ZR6A 3SIOA 3TLTA 5BW2A 5AFLA 2PGZA 3WTKA 1OEDA 3EAMA 3UU8A 3SQ9A 2X00D 2XQ3A 4NZBA 4ZK4A 5J5GA 4QH1A 3WTHA 3P4WA 1OEDB 2YN6A 2XQAA 3WIPA 4D01A 3WTLA 2XYSA 2WNLA 4TNWA 2KSRA 5CFBA 2WN9A 5LG3A 4BFQA 1UX2A 4UM3S 2VL0A 3RHWA 4TWFA 5KE4A 4LMJA 5HEGA 4UM3A 3U8JA 2LM2A 3EI0A 4UY2A 4HFIA 2Y56A 5BRXA 3TLUA 5AFNA 3RI5A 3GUAA 4ILCA 2BG9E 4IREA 4B5DA 5HEHA 2XYTA 3PEOA 4ZJTA 5AFKA 5J5HA 3TLWA 5IUXA 3IGQA 2BR7A 3EHZA 5CO5A 4BQTA 5JMEA 4ILAA 3RQWA 4IL9A 4UM1A 2X00A 5HCMA 4AFGA 3UU5A 4QACA 2YMDA 4ALXA 5FJVA 4HFEA 5HEUA 4PIRA 1UW6A 5L4EA 3PMZA 3UUBA 4AFTA 3LSVA 4IL4A 2BYNA 3WTJA 3RQUA 3ZDHA 3C79A 2XNUA 4ZZCA 2Y57A 4XK9A 3WTMA 3WTIA 5AFMB 2PH9A 4QAAA 3ZKRA 3U8KA 4HFHA 2XNVA 2LKGA 4X5TA 4EZ1A 2BYRA 2M6IA 2XNTA 2YKSA 3T4MA 3U8LA 2YOEA 2W8GA 3U8NA 5HEJA 2LKHA 2BG9C 2UZ6A 2ZJVA 2W8FA 4UM3P 2YMEA 5AINA 2XQ9A 3TLVA 4QABA 2QC1B 5LXBA 2WNCA 1OEDE 4FRRA 2BYSA 3SQ6A 2XQ4A 2BYQA 2BG9A 3P50A 3RIAA 5AFHA 2BR8A 2WZYA 5AFMA 4ZZBA 2LLYA 4HFDA 5SYOA 2XQ5A 4Z90A 3UU6A 2BYPA 3SH1A 5L47A 4ZK1A 3WTOA 4TNVA 4COFA 3JAEA 4TWDA 2BG9B 2XQ8A 3JADA 4QH5A 4LMLA 3UU3A 5L4HA 5J0ZA 2MAWA 2XZ5A 2BJ0A 2XQ6A 5AFJA 3UQ4A 4F8HA 5J5IA 4TWHA 2XQ7A 4HFBA 4ILBA 2M6BA 5HCJA 4Z91A 4QH4A 3WTNA 4A98A 3UQ7A
chains in the Genus database with same CATH superfamily
2N9DA 2NP9A 4MBQA 3IEEA 3HKEE 4G63A 2Y48B 2J4GA 2AXDS 3A8YC 4GKKT 3EAMA 3SQ9A 2WU2A 2VWAA 1Z0PA 2YU1A 4JI2T 2ACXA 4YTPA 2D2SA 3B57A 2PFVA 5LNKA 3PUZF 4I43B 3RHWA 4DUYT 3Q5DA 3ESLA 3PUSA 2KINB 2Y56A 3TLUA 2PTFA 3PUVF 2V26A 3L39A 3TLWA 3KINB 2W66A 4UM1A 4ALXA 2YDSA 5L4EA 4AFTA 3WTJA 3RQUA 4EZHA 2WP9A 3CX7B 2LKGA 2UXCT 2H7VC 2YKSA 2LJLA 4DV4T 4GK0E 3N9MA 1XDOA 4YJ3E 4TV9E 2LLYA 3ZJ2A 1MNDA 4QKNA 3AB3B 4TWDA 4LF6T 2BG9B 3SS1A 4YT0A 5AFJA 1T98A 3UQ4A 4F8HA 5J5IA 2QYWA 4ILBA 4P1NA 2BBHA 1WR0A 4PNIA 5J5FA 4PJJA 2W00A 4ZS3A 5AQOB 3ZDGA 3H3MA 1O3XA 4XHEA 3FHNA 2C5KT 5J1GA 2XTLA 3M3ZB 3SIOA 2W62A 3MZKB 2X00D 2WZIA 2YDQA 3N9OA 2D0UA 4O4HE 5JH7E 4ZXLA 4D01A 5LB7B 2WN9A 4QHOA 4B3RT 1D0YA 3EUHA 1J5WA 4YXDA 3ZT6A 2X0LB 2BS4A 3Q5WA 1VRBA 1NWMX 4U2ZA 4ILCA 2BG9E 2A3DA 4OHFA 4JI4T 4H9QC 4DV7T 4PIRA 2UXXB 2J1DG 3LSVA 2KMFA 2LM9A 3ZDHA 4DV2T 2LHNA 2CWOA 4I0UA 3MACA 4ZI2D 4MHCA 3T4MA 4LF7T 5AQMB 2XAQB 2CXLA 4OX9T 4UR9A 3SWHA 2ZMAA 2KT9A 1XNRT 2XQ8A 4AKIA 1ZP0A 1M7KA 2WDRA 4HFBA 1W09A 2UXBT 2YINA 1V9DA 2XAGB 4ZJSA 3U8MA 2ES0A 2HN2A 2JQKA 2LSGA 3I0OA 4HFCA 3FB2A 2V7KA 4IDNA 3MJXA 3DTOA 4AQFC 2EHOC 1OEDC 4LFBT 4ZR6A 4EB6E 3TLTA 1YXRA 3C98B 4JUYA 3OBVE 4KI0F 3FZKB 3AEGA 4CQIA 2XSAA 1LVKA 1WR6A 1Y01A 4X66T 5ABGA 2V5DA 5JDLA 2MOZA 4UVBB 5AQVB 2X0HA 2ZM8A 3AEEA 1E7PA 2OLTA 5HEHA 4ILAA 4GK5E 3VRAA 4CN6A 4X64T 3ZMUB 4XK9A 4QX8B 3LK42 3OJAA 4DVDA 3UUMA 2DLRA 3AECA 2IMLA 2E9XD 2RA1A 3ZMVB 5LMNT 4QH5A 2WZHA 3ETUA 3UULA 5HCJA 3N2GE 4X20E 4OYJA 4ISTA 2E9XB 1GQEA 1WCRA 1ZKEA 2PBIA 4ZI7E 1QSDA 1NAFA 3RYIE 2V6YB 2XZEA 4K0KT 3N9QA 2P9BA 5DQWA 2FJDA 4GIWA 5LHIB 5CA1E 1LRZA 4CZZB 4BJNA 5JDMA 3GMIA 4HE8A 4KMCA 2CCQA 3QB5K 2V6XA 2QGSA 1HX1B 3HKBE 3RKGA 5DQVA 3RI5A 5KX5E 2I59A 4HWCA 5JMEA 3EHZA 5JRCB 1Y64B 4IL9A 3JC6C 3SRZA 4OFZA 4YTNA 4H63V 1E1HB 5JDFA 3ZCIA 5L3DB 2CM0A 4CI2B 5L3EB 2DWGA 5J2UE 5ETWA 3PU3A 2W63A 5BMVE 2BS2A 5LJNA 2C0SA 1W0BA 2CXDA 5HXHA 4HWHA 3LJCA 2BG9C 2WDQA 2DHRA 4C90A 3LK2B 3J7Yq 5L3FB 2BR8A 2WZYA 3AA0B 4H9NC 3BQLA 3ZYKA 1IBLT 2W0GA 3RX6A 3ANWB 4EYYR 2CPTA 2C5JA 4EZ4A 2W61A 1MMGA 2BVLA 3JAFA 3KVAA 3CQCB 2YEVC 3NZQA 1IJ6A 5HXEA 2XHEB 1IBMT 3ZSSA 2ZJUA 3ABVA 3AEDA 1I6ZA 3MA9A 4UEMA 2ZM0A 1T7SA 5AFLA 5C3JA 2EHOA 1OEDA 4JI1T 3P4RA 3PUWF 2V1DB 4IE7A 4XAXB 3ONLC 4ZK4A 5J5GA 2MTQA 2E8IA 4PJNA 5AQJB 3DJBA 4NXNT 2IW5B 2VB6A 1OXZA 1HR0T 4XBFB 2WB5A 2XY8B 1JNZA 3F57A 5LYJE 4O4JE 2X9XA 1KEYA 4WBOA 5JDGA 1FMVA 2BR7A 2V5CA 4DR6T 4HFEA 4O4IE 4DV5T 5DJQC 3PUXF 2SPCA 1ZHCA 2DI4A 3WTMA 3WTIA 4H9OC 3D0TA 2W2UA 4CN1A 4HFHA 3IHRA 5AQPB 3PE0A 3QK6A 1E2AA 2X9WA 4K0UA 3QC9A 2BYSA 4PJLA 2BYQA 3P50A 2YU2A 5SYOA 5AQSB 4Z90A 3ZC1A 2ZLYA 2VKOA 4I4TE 2X68A 2X0YA 5L4HA 4IDPA 2NTYA 3AXJB 2VVSA 3C84A 1D1CA 1UV6A 1HG2A 5HEOA 4UF0B 5CGMA 2E5VA 5A1LA 1I9BA 3R6NA 4KX6A 4ZRUA 5BW2A 2WU5A 1SE7A 2CE7A 5LP6E 2V7JA 1KFYA 4NZBA 3MXZA 4LF5T 4HTEA 3RC3A 3AE8A 5AFUL 2ZM2A 4DNDA 3OVUA 2YN6A 5FL0A 2N2NA 3WTLA 2XYSA 5LG3A 2VL0A 4JLEA 4NUVA 4YHHT 2N1GA 3AE3A 5JVDE 2Y8DA 4HFIA 2M67A 2YDRA 1B7TA 1T8BA 5M4YA 5J5HA 3IGQA 2Z6EA 3AAIA 4AXPA 1D1AA 4PFPA 5JR9B 2Q9QC 1HNWT 3RRWA 5ABFB 3VKHA 3IF8B 3O1HA 1HCIA 3I1AA 4QAAA 2MBGA 3C64A 1T72A 4EZ1A 2BYRA 3K1SA 3U8NA 2ODUA 4QXHB 1UX5A 1EZ3A 4P0AA 4OK0A 2L3LA 2H89A 2QC1B 4H63H 2BG9A 4IDOA 2WAUA 4U74A 2WQYA 4ZK1A 5LBMA 2XASB 5FNVE 3RYHE 4I50E 4LMLA 2CRBA 1HF8A 5FYMA 5LXTE 4ISSA 5TAOA 2XZ6A 3UFGA 2Y58A 5BP0A 5FXVA 3O1IA 1WRDA 4MLKA 1UURA 1DU2A 2PGZA 3K8PC 4WZXA 4IE4A 2CEAA 2CLYC 3NVOA 3QUJA 2WSSV 3Q5EA 4KHPT 5H6QB 2X66A 3RPUA 3NWIA 4EEBA 3KV5A 4TWFA 3O4XE 4E7ZA 4LFAT 5IWAT 5HXRA 5C2TA 2AE9A 4B3TT 3PEOA 1NENA 4IIJE 4X62T 4BQTA 3RIUC 2XJ7A 4AKRB 1XMOT 5HCMA 4AFGA 3ETVA 5CA0E 3RKOA 2MYSA 2MPKA 3AA6B 5E0OA 3HKDE 2M6IA 3FZFB 3HI2A 3MKDA 5LBQB 2A72A 4X1IE 3H37A 1W0AA 4DO0A 3FXDB 4NIQA 2WWVA 3TLVA 5LXBA 2XQ4A 3T1YT 4GOUA 1X9BA 5F8PA 2XAFB 1HG5A 2DNXA 4UELA 5EZYE 2V7MA 3CKDA 3T1HT 4B3MT 2A2FX 4WW0A 4QH4A 5F3JA 3I9WA 4ZI3D 3ZT7A 3PU8A 4CI3B 4DBMA 2JPFA 4U72A 3I9YA 3RYCE 5L2LA 2JMHA 3P4QA 2VASA 5LMUT 5JDNA 3PV0F 1WFDA 5EK4A 5HEGA 5BR8T 4TX5A 2X51A 3UFEA 4NXMT 4IREA 3ZJ1A 3AE4A 1U4QA 3ONXA 3NBXX 3Q5XA 1SHZC 2HH7A 4JEUB 4N78D 3CIRA 4DR1T 3ZN0B 4HWFA 1YKHB 3L8RA 1BR4A 3K3QC 2Q9QA 2IUBA 4JI3T 2XNVA 3PJAJ 4HWDA 3I0QA 5HEJA 4JI7T 3AAAB 3U78A 3SFDA 2UZ6A 3X1DA 1MMDA 3ONJA 5FY7A 3RIAA 5AFMA 3VR8A 4EGWA 2V7LA 2BYPA 3RC8A 4TNVA 2VKHA 2WM9A 4B3ST 5J0ZA 4HWIB 2BJ0A 2XQ6A 1J1JA 3LBXB 3FXEB 1MMNA 1VCTA 3CWZB 3ZYLA 3SOLA 2V6YA 3M65A 5AQQB 5HXCA 4H9SE 3VU7H 5TVCA 3BQIA 2LRKA 1KNZA 4DMWA 2LRLA 2QVAA 2JQQA 2B76A 3VRBA 5FY1A 4F6RC 3PUGA 1UX4A 2OA5A 5LOVE 2CHNA 4QXBB 3CPZA 3ZMTB 2WMOA 4JI6T 2YK0A 2LM2A 5JR9C 2HPJA 2RPAA 3DP7A 5IYZE 2CBIA 4YFSA 2NW9A 3ZSTA 3CX6B 3GWHA 5HEUA 2QA7A 4YHJA 3RIUA 2PJQA 2NR4A 3KBTA 4IL4A 2BYNA 3ZYMA 4FI5A 2PH9A 3ZMSB 3U8KA 4IE6A 5HAXA 3O9XA 4BAYB 4AQGA 2YOEA 3BK9A 4DV3T 4PK4A 3EDVA 3A7MA 5L3GB 2WNCA 2XPKA 2LSJA 4DR2T 5GONE 4ZZBA 1G73A 5AQTB 5AQHB 2XQ5A 3ANWA 3N2KE 2XM1A 5L3BB 4U2YA 3CK6A 4CXWA 4TWHA 4I55E 3F31A 5ADXL 3UUNA 2W8FA 1MIWA 4YSYA 4U7YA 3SFEA 4LF4T 4O4LE 2WDVA 4MFRA 2Y7YA 4B6XA 3TLSA 3E08A 4A97A 2XUEA 4UXNB 4AKGA 1YKEB 4GKJT 3WTKA 3UU8A 2XQ3A 2K9AA 4ZOLE 3AE9A 2UUAT 3ZT5A 3J9X1 4DR5T 4JI5T 2BKPA 4TUYE 5CFBA 4BFQA 5FXXA 1N33T 2KNDA 3F2EA 2C5IT 2LOSA 1YD8G 5AQRB 2DL1A 1BR0A 3PTRB 4X1YE 3EDUA 2KXPB 5FJVA 4JI0T 2LT3A 3AE5A 3PMZA 4WYVA 5LCYA 3B13A 3VHLA 3UTKA 3K3OA 5FXZA 2JJ9A 2GK9A 3LG7A 1MMAA 4O8SA 2JIWA 2Y6XA 4UM3P 5KXJA 2YMEA 4DBQA 3SQ6A 5AFHA 3O1JA 2EHOD 1Z8UA 2FJAA 5LGUB 3KVBA 4EV6A 3JADA 1H7CA 3AXJA 2CHOA 3RRCA 4ZI2C 2XQ7A 3UUXB 2EHOB 4UF0A 3AE6A 3UQ7A 4HGAA 4AFHA 4EOZB 1MNEA 3PJAA 3ZLIA 5ABEA 2NWBA 1UCUA 1N36T 5KZUA 1YQ3A 3UU4A 4M1PA 4O2AE 4P09A 2OV9A 2ACZA 4P0BA 3RIFA 2WMNA 3FBLA 5LHHB 5HXSA 4G2AA 4XZCA 4JEHB 2G0UA 5FVKA 4KHZF 4QH1A 5AQFB 4O2BE 4PFOA 1HFAA 1FIOA 2LOPA 5FL1A 2UU9T 1S94A 2VL8A 4LF8T 2KSRA 3LDQB 4DV6T 2VK9A 2HHHT 3CQGB 2L8KA 1ZEEA 2KWHA 5BRXA 2K3WA 1QUUA 4B5DA 3S4UA 3GA8A 5AFKA 5JR9A 1US7B 1MIVA 2IHR1 4PAGA 1VOMA 4ADZA 5ABFA 4BJMA 1UGOA 3QOFA 3GN5B 3ZCJA 4IDQA 4AQYT 2WCAA 3UT5E 4QXCB 1N32T 4ZZCA 2JMKA 5AQUB 2LEHA 1AJ3A 2FBWA 2X67A 1J5ET 1D0XA 3ZC0A 5AQGB 2LKHA 2FUPA 2DWKA 2X9YA 2XQ9A 3P7IA 2D0TA 4DR3T 2JQ9A 1BR2A 5CJ5A 3PUQA 2NTXA 3JCFA 4HFDA 1LKXA 2LHRA 1MIYA 2J47A 2UXNB 3Q2MA 4QWNB 2BKOA 3RF1A 2DCFA 3NRXA 3V5UA 5LA6E 5C8YE 5HYAA 3OYXA 4YSZA 5FY0A 1S35A 4EXTA 4WV9A 1WYCA 2BDEA 4TV8E 2E9XC 2VKDA 4LF9T 1N34T 3T8OA 3HL6A 2FJEA 3TKLB 3AA1B 4UV9B 2XAHB 3JC6D 3WIPA 4J2CA 4UM3S 5LGTB 5HWXA 2NW7A 3GUAA 2XYTA 3OYZA 4DBRA 2VKJA 1WYBA 5CO5A 3FZMB 3MK7C 3RQWA 2X00A 3UU5A 1FJGT 1HTJF 2YMDA 3N9NA 3P8CD 3C50A 2NW8A 3EVYA 2XNUA 2WS3A 3E0ZA 1CHUA 4L9IA 4V1Av 4IHJE 4X5TA 5JDQA 2XNTA 4UVAB 3U8LA 5EK3A 5J2TE 2D5UA 2ZJVA 4PK6A 1KNPA 4FJOA 4FRRA 4TZ4C 1D1BA 3KV4A 3KV9A 5IHYA 3C4ZA 3NRYA 4L5GA 2BS3A 4AKLA 1L0VA 2WBLA 5AQLB 3ZPOA 1YW0A 2WWUA 3WTNA 2NOXA 5AQKB 4DUZT 5FXWA 4DV1T 2CA5A 4UXUA 3NKZA 1YQ4A 2L9QA 2Y54A 2KZ7B 1LVFA 1UUSA 2H7OA 2FJBA 3CMLA 2K5BB 2R6GF 4EAHA 3WTHA 3NZPA 4EYUA 3ZEFB 2XQYA 3BQKA 2H88A 2IDOB 1HX8A 3K3NA 4UM3A 3U8JA 4HN9A 4H9RC 3C4WA 4NUUA 4ILUA 3CX8B 3U3IA 4WBNE 5FVLA 1XMQT 3B5MA 4ZJTA 2CWYA 5CB4E 1R8IA 2I0MA 3EABA 3W15B 1HNXT 3QNUA 4QACA 4OYKA 3C4XA 4X65T 2X9HA 1UW6A 2KWIB 3C79A 3AAEB 4IDZA 1M62A 4E7SA 4A5XA 2BBJA 5EK2A 5H6RB 2BKNA 2K48A 3WAKA 5JQGE 4TN7B 5AQIB 1XZYA 3UU6A 3PUAA 3WTOA 3LBXA 3LFMA 4COFA 3H3AA 1HS7A 3PURA 1W9RA 4ZEYA 4X1KE 2J62A 2B1EA 2K24A 2UXDT 3VKGA 2XSBA 4Z91A 4A98A 2WNJA 4LMKA 2UUBT 4DIDB 4UIGA 4Z8XA 5ABHA 1I94T 4HQPA 3AVRA 4ERRA 1JNRA 2C9TA 3E22E 3KBUA 1QLBA 2E9XA 2H3RA 3N9LA 1XWMA 1CUNA 4JBWF 4DV0T 2XQAA 2Q9QD 4TNWA 1VCSA 1UX2A 2HN1A 3ZMZB 2UUCT 3CVRA 2VQET 2LSYA 4AISA 3EI0A 4HFVA 4GYSA 4CN4A 4KUMB 2XM2A 2Q9QB 3A5XA 3RH3A 1OWAA 2QRXA 4CI1B 3AA7B 3G06A 4U3CA 2W4XA 4IE5A 3Q9DA 4CXXA 3AE2A 2CBJA 3CQXC 4U33A 4ANJA 4AIUA 3UUBA 4JI8T 3KDSE 1NEKA 5AFMB 3HKCE 4GYRA 4H9PC 3QB5A 5JRCA 3AEAA 1G8XA 4HKAA 2VQFT 3FZLB 3ZN1B 4DR7T 1KK7A 2V8SV 1SA0E 4DR4T 5JREA 4EEDA 3RGLA 2ODVA 3WI3A 4NPPA 5JDHA 2KLQA 5AQNB 3N9PA 4IT4A 4Q25A 3PUYF 3AEFA 2CLYB 2WY2A 2BVMA 5HWYA 4JYAT 1BR1A 2LSKA 4U7IA 3HR0A 2E2AA 4ASKA 3P4WA 4AKHA 4PK5A 4WNKA 1WLXA 2RP4A 4JV5T 3AE1A 2CXFA 2VURA 2F4VT 5LJMA 4LMJA 2JQHA 4UY2A 4IGUA 1IZNB 4KBMB 1U5PA 1FEWA 5IUXA 2VVNA 4IE0A 1ZV4X 5L3CB 4PJMA 4AI6A 4YJ2E 3LK3B 1FMWA 3VR9A 5FKYA 2Y57A 3AE7A 1ZOYA 3IBPA 4C91A 3RYFE 5LGNB 4EIWA 4YTMA 4ZS2A 1IJ5A 2W8GA 2IAKA 1UK5A 5DABA 3L3PA 4ZHQE 1SUMB 2IIUA 3KV6A 5FP3A 1HNZT 5L47A 2A9UA 4AQFA 1XDPA 3UU3A 5JTGA 2MAWA 3N5LA 3HA4A 5FMNA 3AEBA 3L09A 2W67A 3N2OA 1XNQT 3KFWX 3OTOT 3OKQA 5LHGB 2JRKA 2LSIA 4PW8A 2D9DA 4MALA 2HPLA 3FBZA 4L0RA 3P4SA 2IC9A 3P4PA 2IC6A 4CXYA 3WAJA 2PG8A 1OEDB 3OPCA 4ZI3C 4U31A 2WNLA 5LG4A 3AVSA 5KE4A 4A56A 4YY3T 4LFCT 2XAJB 5AFNA 3R84B 2BZBA 1IBKT 3V5SA 4BA9A 3GN5A 4DMVA 2V7IA 4HEAA 3ZKRA 2E5LT 3IA3A 1X79A 4YLHA 4YSXA 2CMRA 1KF6A 4UVCB 2LE8A 4UV8B 5AINA 4QABA 1OEDE 5F5WA 3PDYA 1D0ZA 3SH1A 4QX7B 1KNRA 5KMGP 3JAEA 5KDMC 2I6HA 2XZ5A 1IAPA 3C51A 3RLFF 2M6BA 4KP3C 2ZM6T 3FZHB
chains in the Genus database with same CATH topology
3C84A 2WNJA 2XZ6A 5J5FA 4LMKA 4NPPA 1UV6A 3ZDGA 4AFHA 3JAFA 2Y58A 5HEOA 4ZJSA 3U8MA 4HFCA 5BP0A 4WV9A 2Y7YA 5KZUA 4UXUA 4XHEA 4DBMA 3TLSA 3UU4A 4HQPA 5TVCA 4A97A 2ZJUA 1I9BA 2C9TA 1OEDC 2Y54A 4ZRUA 3RIFA 4ZR6A 3SIOA 3TLTA 5BW2A 5AFLA 2PGZA 3WTKA 1OEDA 3EAMA 3UU8A 3SQ9A 2X00D 2XQ3A 4NZBA 4ZK4A 5J5GA 4QH1A 3WTHA 3P4WA 1OEDB 2YN6A 2XQAA 3WIPA 4D01A 3WTLA 2XYSA 2WNLA 4TNWA 2KSRA 5CFBA 2WN9A 5LG3A 4BFQA 1UX2A 4UM3S 2VL0A 3RHWA 4TWFA 5KE4A 4LMJA 5HEGA 4UM3A 3U8JA 2LM2A 3EI0A 4UY2A 4HFIA 2Y56A 5BRXA 3TLUA 5AFNA 3RI5A 3GUAA 4ILCA 2BG9E 4IREA 4B5DA 5HEHA 2XYTA 3PEOA 4ZJTA 5AFKA 5J5HA 3TLWA 5IUXA 3IGQA 2BR7A 3EHZA 5CO5A 4BQTA 5JMEA 4ILAA 3RQWA 4IL9A 4UM1A 2X00A 5HCMA 4AFGA 3UU5A 4QACA 2YMDA 4ALXA 5FJVA 4HFEA 5HEUA 4PIRA 1UW6A 5L4EA 3PMZA 3UUBA 4AFTA 3LSVA 4IL4A 2BYNA 3WTJA 3RQUA 3ZDHA 3C79A 2XNUA 4ZZCA 2Y57A 4XK9A 3WTMA 3WTIA 5AFMB 2PH9A 4QAAA 3ZKRA 3U8KA 4HFHA 2XNVA 2LKGA 4X5TA 4EZ1A 2BYRA 2M6IA 2XNTA 2YKSA 3T4MA 3U8LA 2YOEA 2W8GA 3U8NA 5HEJA 2LKHA 2BG9C 2UZ6A 2ZJVA 2W8FA 4UM3P 2YMEA 5AINA 2XQ9A 3TLVA 4QABA 2QC1B 5LXBA 2WNCA 1OEDE 4FRRA 2BYSA 3SQ6A 2XQ4A 2BYQA 2BG9A 3P50A 3RIAA 5AFHA 2BR8A 2WZYA 5AFMA 4ZZBA 2LLYA 4HFDA 5SYOA 2XQ5A 4Z90A 3UU6A 2BYPA 3SH1A 5L47A 4ZK1A 3WTOA 4TNVA 4COFA 3JAEA 4TWDA 2BG9B 2XQ8A 3JADA 4QH5A 4LMLA 3UU3A 5L4HA 5J0ZA 2MAWA 2XZ5A 2BJ0A 2XQ6A 5AFJA 3UQ4A 4F8HA 5J5IA 4TWHA 2XQ7A 4HFBA 4ILBA 2M6BA 5HCJA 4Z91A 4QH4A 3WTNA 4A98A 3UQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C84 A;  2WNJ A;  2XZ6 A;  5J5F A;  4LMK A;  4NPP A;  1UV6 A;  3ZDG A;  4AFH A;  3JAF A;  2Y58 A;  5HEO A;  4ZJS A;  3U8M A;  4HFC A;  5BP0 A;  4WV9 A;  2Y7Y A;  5KZU A;  4UXU A;  4XHE A;  4DBM A;  3TLS A;  3UU4 A;  4HQP A;  5TVC A;  4A97 A;  2ZJU A;  1I9B A;  2C9T A;  1OED C;  2Y54 A;  4ZRU A;  3RIF A;  4ZR6 A;  3SIO A;  3TLT A;  5BW2 A;  5AFL A;  2PGZ A;  3WTK A;  1OED A;  3EAM A;  3UU8 A;  3SQ9 A;  2X00 D;  2XQ3 A;  4NZB A;  4ZK4 A;  5J5G A;  4QH1 A;  3WTH A;  3P4W A;  1OED B;  2YN6 A;  2XQA A;  3WIP A;  4D01 A;  3WTL A;  2XYS A;  2WNL A;  4TNW A;  2KSR A;  5CFB A;  2WN9 A;  5LG3 A;  4BFQ A;  1UX2 A;  4UM3 S;  2VL0 A;  3RHW A;  4TWF A;  5KE4 A;  4LMJ A;  5HEG A;  4UM3 A;  3U8J A;  2LM2 A;  3EI0 A;  4UY2 A;  4HFI A;  2Y56 A;  5BRX A;  3TLU A;  5AFN A;  3RI5 A;  3GUA A;  4ILC A;  2BG9 E;  4IRE A;  4B5D A;  5HEH A;  2XYT A;  3PEO A;  4ZJT A;  5AFK A;  5J5H A;  3TLW A;  5IUX A;  3IGQ A;  2BR7 A;  3EHZ A;  5CO5 A;  4BQT A;  5JME A;  4ILA A;  3RQW A;  4IL9 A;  4UM1 A;  2X00 A;  5HCM A;  4AFG A;  3UU5 A;  4QAC A;  2YMD A;  4ALX A;  5FJV A;  4HFE A;  5HEU A;  4PIR A;  1UW6 A;  5L4E A;  3PMZ A;  3UUB A;  4AFT A;  3LSV A;  4IL4 A;  2BYN A;  3WTJ A;  3RQU A;  3ZDH A;  3C79 A;  2XNU A;  4ZZC A;  2Y57 A;  4XK9 A;  3WTM A;  3WTI A;  5AFM B;  2PH9 A;  4QAA A;  3ZKR A;  3U8K A;  4HFH A;  2XNV A;  2LKG A;  4X5T A;  4EZ1 A;  2BYR A;  2M6I A;  2XNT A;  2YKS A;  3T4M A;  3U8L A;  2YOE A;  2W8G A;  3U8N A;  5HEJ A;  2LKH A;  2BG9 C;  2UZ6 A;  2ZJV A;  2W8F A;  4UM3 P;  2YME A;  5AIN A;  2XQ9 A;  3TLV A;  4QAB A;  2QC1 B;  5LXB A;  2WNC A;  1OED E;  4FRR A;  2BYS A;  3SQ6 A;  2XQ4 A;  2BYQ A;  2BG9 A;  3P50 A;  3RIA A;  5AFH A;  2BR8 A;  2WZY A;  5AFM A;  4ZZB A;  2LLY A;  4HFD A;  5SYO A;  2XQ5 A;  4Z90 A;  3UU6 A;  2BYP A;  3SH1 A;  5L47 A;  4ZK1 A;  3WTO A;  4TNV A;  4COF A;  3JAE A;  4TWD A;  2BG9 B;  2XQ8 A;  3JAD A;  4QH5 A;  4LML A;  3UU3 A;  5L4H A;  5J0Z A;  2MAW A;  2XZ5 A;  2BJ0 A;  2XQ6 A;  5AFJ A;  3UQ4 A;  4F8H A;  5J5I A;  4TWH A;  2XQ7 A;  4HFB A;  4ILB A;  2M6B A;  5HCJ A;  4Z91 A;  4QH4 A;  3WTN A;  4A98 A;  3UQ7 A; 
#chains in the Genus database with same CATH topology
 2N9D A;  2NP9 A;  4MBQ A;  3IEE A;  3HKE E;  4G63 A;  2Y48 B;  2J4G A;  2AXD S;  3A8Y C;  4GKK T;  3EAM A;  3SQ9 A;  2WU2 A;  2VWA A;  1Z0P A;  2YU1 A;  4JI2 T;  2ACX A;  4YTP A;  2D2S A;  3B57 A;  2PFV A;  5LNK A;  3PUZ F;  4I43 B;  3RHW A;  4DUY T;  3Q5D A;  3ESL A;  3PUS A;  2KIN B;  2Y56 A;  3TLU A;  2PTF A;  3PUV F;  2V26 A;  3L39 A;  3TLW A;  3KIN B;  2W66 A;  4UM1 A;  4ALX A;  2YDS A;  5L4E A;  4AFT A;  3WTJ A;  3RQU A;  4EZH A;  2WP9 A;  3CX7 B;  2LKG A;  2UXC T;  2H7V C;  2YKS A;  2LJL A;  4DV4 T;  4GK0 E;  3N9M A;  1XDO A;  4YJ3 E;  4TV9 E;  2LLY A;  3ZJ2 A;  1MND A;  4QKN A;  3AB3 B;  4TWD A;  4LF6 T;  2BG9 B;  3SS1 A;  4YT0 A;  5AFJ A;  1T98 A;  3UQ4 A;  4F8H A;  5J5I A;  2QYW A;  4ILB A;  4P1N A;  2BBH A;  1WR0 A;  4PNI A;  5J5F A;  4PJJ A;  2W00 A;  4ZS3 A;  5AQO B;  3ZDG A;  3H3M A;  1O3X A;  4XHE A;  3FHN A;  2C5K T;  5J1G A;  2XTL A;  3M3Z B;  3SIO A;  2W62 A;  3MZK B;  2X00 D;  2WZI A;  2YDQ A;  3N9O A;  2D0U A;  4O4H E;  5JH7 E;  4ZXL A;  4D01 A;  5LB7 B;  2WN9 A;  4QHO A;  4B3R T;  1D0Y A;  3EUH A;  1J5W A;  4YXD A;  3ZT6 A;  2X0L B;  2BS4 A;  3Q5W A;  1VRB A;  1NWM X;  4U2Z A;  4ILC A;  2BG9 E;  2A3D A;  4OHF A;  4JI4 T;  4H9Q C;  4DV7 T;  4PIR A;  2UXX B;  2J1D G;  3LSV A;  2KMF A;  2LM9 A;  3ZDH A;  4DV2 T;  2LHN A;  2CWO A;  4I0U A;  3MAC A;  4ZI2 D;  4MHC A;  3T4M A;  4LF7 T;  5AQM B;  2XAQ B;  2CXL A;  4OX9 T;  4UR9 A;  3SWH A;  2ZMA A;  2KT9 A;  1XNR T;  2XQ8 A;  4AKI A;  1ZP0 A;  1M7K A;  2WDR A;  4HFB A;  1W09 A;  2UXB T;  2YIN A;  1V9D A;  2XAG B;  4ZJS A;  3U8M A;  2ES0 A;  2HN2 A;  2JQK A;  2LSG A;  3I0O A;  4HFC A;  3FB2 A;  2V7K A;  4IDN A;  3MJX A;  3DTO A;  4AQF C;  2EHO C;  1OED C;  4LFB T;  4ZR6 A;  4EB6 E;  3TLT A;  1YXR A;  3C98 B;  4JUY A;  3OBV E;  4KI0 F;  3FZK B;  3AEG A;  4CQI A;  2XSA A;  1LVK A;  1WR6 A;  1Y01 A;  4X66 T;  5ABG A;  2V5D A;  5JDL A;  2MOZ A;  4UVB B;  5AQV B;  2X0H A;  2ZM8 A;  3AEE A;  1E7P A;  2OLT A;  5HEH A;  4ILA A;  4GK5 E;  3VRA A;  4CN6 A;  4X64 T;  3ZMU B;  4XK9 A;  4QX8 B;  3LK4 2;  3OJA A;  4DVD A;  3UUM A;  2DLR A;  3AEC A;  2IML A;  2E9X D;  2RA1 A;  3ZMV B;  5LMN T;  4QH5 A;  2WZH A;  3ETU A;  3UUL A;  5HCJ A;  3N2G E;  4X20 E;  4OYJ A;  4IST A;  2E9X B;  1GQE A;  1WCR A;  1ZKE A;  2PBI A;  4ZI7 E;  1QSD A;  1NAF A;  3RYI E;  2V6Y B;  2XZE A;  4K0K T;  3N9Q A;  2P9B A;  5DQW A;  2FJD A;  4GIW A;  5LHI B;  5CA1 E;  1LRZ A;  4CZZ B;  4BJN A;  5JDM A;  3GMI A;  4HE8 A;  4KMC A;  2CCQ A;  3QB5 K;  2V6X A;  2QGS A;  1HX1 B;  3HKB E;  3RKG A;  5DQV A;  3RI5 A;  5KX5 E;  2I59 A;  4HWC A;  5JME A;  3EHZ A;  5JRC B;  1Y64 B;  4IL9 A;  3JC6 C;  3SRZ A;  4OFZ A;  4YTN A;  4H63 V;  1E1H B;  5JDF A;  3ZCI A;  5L3D B;  2CM0 A;  4CI2 B;  5L3E B;  2DWG A;  5J2U E;  5ETW A;  3PU3 A;  2W63 A;  5BMV E;  2BS2 A;  5LJN A;  2C0S A;  1W0B A;  2CXD A;  5HXH A;  4HWH A;  3LJC A;  2BG9 C;  2WDQ A;  2DHR A;  4C90 A;  3LK2 B;  3J7Y q;  5L3F B;  2BR8 A;  2WZY A;  3AA0 B;  4H9N C;  3BQL A;  3ZYK A;  1IBL T;  2W0G A;  3RX6 A;  3ANW B;  4EYY R;  2CPT A;  2C5J A;  4EZ4 A;  2W61 A;  1MMG A;  2BVL A;  3JAF A;  3KVA A;  3CQC B;  2YEV C;  3NZQ A;  1IJ6 A;  5HXE A;  2XHE B;  1IBM T;  3ZSS A;  2ZJU A;  3ABV A;  3AED A;  1I6Z A;  3MA9 A;  4UEM A;  2ZM0 A;  1T7S A;  5AFL A;  5C3J A;  2EHO A;  1OED A;  4JI1 T;  3P4R A;  3PUW F;  2V1D B;  4IE7 A;  4XAX B;  3ONL C;  4ZK4 A;  5J5G A;  2MTQ A;  2E8I A;  4PJN A;  5AQJ B;  3DJB A;  4NXN T;  2IW5 B;  2VB6 A;  1OXZ A;  1HR0 T;  4XBF B;  2WB5 A;  2XY8 B;  1JNZ A;  3F57 A;  5LYJ E;  4O4J E;  2X9X A;  1KEY A;  4WBO A;  5JDG A;  1FMV A;  2BR7 A;  2V5C A;  4DR6 T;  4HFE A;  4O4I E;  4DV5 T;  5DJQ C;  3PUX F;  2SPC A;  1ZHC A;  2DI4 A;  3WTM A;  3WTI A;  4H9O C;  3D0T A;  2W2U A;  4CN1 A;  4HFH A;  3IHR A;  5AQP B;  3PE0 A;  3QK6 A;  1E2A A;  2X9W A;  4K0U A;  3QC9 A;  2BYS A;  4PJL A;  2BYQ A;  3P50 A;  2YU2 A;  5SYO A;  5AQS B;  4Z90 A;  3ZC1 A;  2ZLY A;  2VKO A;  4I4T E;  2X68 A;  2X0Y A;  5L4H A;  4IDP A;  2NTY A;  3AXJ B;  2VVS A;  3C84 A;  1D1C A;  1UV6 A;  1HG2 A;  5HEO A;  4UF0 B;  5CGM A;  2E5V A;  5A1L A;  1I9B A;  3R6N A;  4KX6 A;  4ZRU A;  5BW2 A;  2WU5 A;  1SE7 A;  2CE7 A;  5LP6 E;  2V7J A;  1KFY A;  4NZB A;  3MXZ A;  4LF5 T;  4HTE A;  3RC3 A;  3AE8 A;  5AFU L;  2ZM2 A;  4DND A;  3OVU A;  2YN6 A;  5FL0 A;  2N2N A;  3WTL A;  2XYS A;  5LG3 A;  2VL0 A;  4JLE A;  4NUV A;  4YHH T;  2N1G A;  3AE3 A;  5JVD E;  2Y8D A;  4HFI A;  2M67 A;  2YDR A;  1B7T A;  1T8B A;  5M4Y A;  5J5H A;  3IGQ A;  2Z6E A;  3AAI A;  4AXP A;  1D1A A;  4PFP A;  5JR9 B;  2Q9Q C;  1HNW T;  3RRW A;  5ABF B;  3VKH A;  3IF8 B;  3O1H A;  1HCI A;  3I1A A;  4QAA A;  2MBG A;  3C64 A;  1T72 A;  4EZ1 A;  2BYR A;  3K1S A;  3U8N A;  2ODU A;  4QXH B;  1UX5 A;  1EZ3 A;  4P0A A;  4OK0 A;  2L3L A;  2H89 A;  2QC1 B;  4H63 H;  2BG9 A;  4IDO A;  2WAU A;  4U74 A;  2WQY A;  4ZK1 A;  5LBM A;  2XAS B;  5FNV E;  3RYH E;  4I50 E;  4LML A;  2CRB A;  1HF8 A;  5FYM A;  5LXT E;  4ISS A;  5TAO A;  2XZ6 A;  3UFG A;  2Y58 A;  5BP0 A;  5FXV A;  3O1I A;  1WRD A;  4MLK A;  1UUR A;  1DU2 A;  2PGZ A;  3K8P C;  4WZX A;  4IE4 A;  2CEA A;  2CLY C;  3NVO A;  3QUJ A;  2WSS V;  3Q5E A;  4KHP T;  5H6Q B;  2X66 A;  3RPU A;  3NWI A;  4EEB A;  3KV5 A;  4TWF A;  3O4X E;  4E7Z A;  4LFA T;  5IWA T;  5HXR A;  5C2T A;  2AE9 A;  4B3T T;  3PEO A;  1NEN A;  4IIJ E;  4X62 T;  4BQT A;  3RIU C;  2XJ7 A;  4AKR B;  1XMO T;  5HCM A;  4AFG A;  3ETV A;  5CA0 E;  3RKO A;  2MYS A;  2MPK A;  3AA6 B;  5E0O A;  3HKD E;  2M6I A;  3FZF B;  3HI2 A;  3MKD A;  5LBQ B;  2A72 A;  4X1I E;  3H37 A;  1W0A A;  4DO0 A;  3FXD B;  4NIQ A;  2WWV A;  3TLV A;  5LXB A;  2XQ4 A;  3T1Y T;  4GOU A;  1X9B A;  5F8P A;  2XAF B;  1HG5 A;  2DNX A;  4UEL A;  5EZY E;  2V7M A;  3CKD A;  3T1H T;  4B3M T;  2A2F X;  4WW0 A;  4QH4 A;  5F3J A;  3I9W A;  4ZI3 D;  3ZT7 A;  3PU8 A;  4CI3 B;  4DBM A;  2JPF A;  4U72 A;  3I9Y A;  3RYC E;  5L2L A;  2JMH A;  3P4Q A;  2VAS A;  5LMU T;  5JDN A;  3PV0 F;  1WFD A;  5EK4 A;  5HEG A;  5BR8 T;  4TX5 A;  2X51 A;  3UFE A;  4NXM T;  4IRE A;  3ZJ1 A;  3AE4 A;  1U4Q A;  3ONX A;  3NBX X;  3Q5X A;  1SHZ C;  2HH7 A;  4JEU B;  4N78 D;  3CIR A;  4DR1 T;  3ZN0 B;  4HWF A;  1YKH B;  3L8R A;  1BR4 A;  3K3Q C;  2Q9Q A;  2IUB A;  4JI3 T;  2XNV A;  3PJA J;  4HWD A;  3I0Q A;  5HEJ A;  4JI7 T;  3AAA B;  3U78 A;  3SFD A;  2UZ6 A;  3X1D A;  1MMD A;  3ONJ A;  5FY7 A;  3RIA A;  5AFM A;  3VR8 A;  4EGW A;  2V7L A;  2BYP A;  3RC8 A;  4TNV A;  2VKH A;  2WM9 A;  4B3S T;  5J0Z A;  4HWI B;  2BJ0 A;  2XQ6 A;  1J1J A;  3LBX B;  3FXE B;  1MMN A;  1VCT A;  3CWZ B;  3ZYL A;  3SOL A;  2V6Y A;  3M65 A;  5AQQ B;  5HXC A;  4H9S E;  3VU7 H;  5TVC A;  3BQI A;  2LRK A;  1KNZ A;  4DMW A;  2LRL A;  2QVA A;  2JQQ A;  2B76 A;  3VRB A;  5FY1 A;  4F6R C;  3PUG A;  1UX4 A;  2OA5 A;  5LOV E;  2CHN A;  4QXB B;  3CPZ A;  3ZMT B;  2WMO A;  4JI6 T;  2YK0 A;  2LM2 A;  5JR9 C;  2HPJ A;  2RPA A;  3DP7 A;  5IYZ E;  2CBI A;  4YFS A;  2NW9 A;  3ZST A;  3CX6 B;  3GWH A;  5HEU A;  2QA7 A;  4YHJ A;  3RIU A;  2PJQ A;  2NR4 A;  3KBT A;  4IL4 A;  2BYN A;  3ZYM A;  4FI5 A;  2PH9 A;  3ZMS B;  3U8K A;  4IE6 A;  5HAX A;  3O9X A;  4BAY B;  4AQG A;  2YOE A;  3BK9 A;  4DV3 T;  4PK4 A;  3EDV A;  3A7M A;  5L3G B;  2WNC A;  2XPK A;  2LSJ A;  4DR2 T;  5GON E;  4ZZB A;  1G73 A;  5AQT B;  5AQH B;  2XQ5 A;  3ANW A;  3N2K E;  2XM1 A;  5L3B B;  4U2Y A;  3CK6 A;  4CXW A;  4TWH A;  4I55 E;  3F31 A;  5ADX L;  3UUN A;  2W8F A;  1MIW A;  4YSY A;  4U7Y A;  3SFE A;  4LF4 T;  4O4L E;  2WDV A;  4MFR A;  2Y7Y A;  4B6X A;  3TLS A;  3E08 A;  4A97 A;  2XUE A;  4UXN B;  4AKG A;  1YKE B;  4GKJ T;  3WTK A;  3UU8 A;  2XQ3 A;  2K9A A;  4ZOL E;  3AE9 A;  2UUA T;  3ZT5 A;  3J9X 1;  4DR5 T;  4JI5 T;  2BKP A;  4TUY E;  5CFB A;  4BFQ A;  5FXX A;  1N33 T;  2KND A;  3F2E A;  2C5I T;  2LOS A;  1YD8 G;  5AQR B;  2DL1 A;  1BR0 A;  3PTR B;  4X1Y E;  3EDU A;  2KXP B;  5FJV A;  4JI0 T;  2LT3 A;  3AE5 A;  3PMZ A;  4WYV A;  5LCY A;  3B13 A;  3VHL A;  3UTK A;  3K3O A;  5FXZ A;  2JJ9 A;  2GK9 A;  3LG7 A;  1MMA A;  4O8S A;  2JIW A;  2Y6X A;  4UM3 P;  5KXJ A;  2YME A;  4DBQ A;  3SQ6 A;  5AFH A;  3O1J A;  2EHO D;  1Z8U A;  2FJA A;  5LGU B;  3KVB A;  4EV6 A;  3JAD A;  1H7C A;  3AXJ A;  2CHO A;  3RRC A;  4ZI2 C;  2XQ7 A;  3UUX B;  2EHO B;  4UF0 A;  3AE6 A;  3UQ7 A;  4HGA A;  4AFH A;  4EOZ B;  1MNE A;  3PJA A;  3ZLI A;  5ABE A;  2NWB A;  1UCU A;  1N36 T;  5KZU A;  1YQ3 A;  3UU4 A;  4M1P A;  4O2A E;  4P09 A;  2OV9 A;  2ACZ A;  4P0B A;  3RIF A;  2WMN A;  3FBL A;  5LHH B;  5HXS A;  4G2A A;  4XZC A;  4JEH B;  2G0U A;  5FVK A;  4KHZ F;  4QH1 A;  5AQF B;  4O2B E;  4PFO A;  1HFA A;  1FIO A;  2LOP A;  5FL1 A;  2UU9 T;  1S94 A;  2VL8 A;  4LF8 T;  2KSR A;  3LDQ B;  4DV6 T;  2VK9 A;  2HHH T;  3CQG B;  2L8K A;  1ZEE A;  2KWH A;  5BRX A;  2K3W A;  1QUU A;  4B5D A;  3S4U A;  3GA8 A;  5AFK A;  5JR9 A;  1US7 B;  1MIV A;  2IHR 1;  4PAG A;  1VOM A;  4ADZ A;  5ABF A;  4BJM A;  1UGO A;  3QOF A;  3GN5 B;  3ZCJ A;  4IDQ A;  4AQY T;  2WCA A;  3UT5 E;  4QXC B;  1N32 T;  4ZZC A;  2JMK A;  5AQU B;  2LEH A;  1AJ3 A;  2FBW A;  2X67 A;  1J5E T;  1D0X A;  3ZC0 A;  5AQG B;  2LKH A;  2FUP A;  2DWK A;  2X9Y A;  2XQ9 A;  3P7I A;  2D0T A;  4DR3 T;  2JQ9 A;  1BR2 A;  5CJ5 A;  3PUQ A;  2NTX A;  3JCF A;  4HFD A;  1LKX A;  2LHR A;  1MIY A;  2J47 A;  2UXN B;  3Q2M A;  4QWN B;  2BKO A;  3RF1 A;  2DCF A;  3NRX A;  3V5U A;  5LA6 E;  5C8Y E;  5HYA A;  3OYX A;  4YSZ A;  5FY0 A;  1S35 A;  4EXT A;  4WV9 A;  1WYC A;  2BDE A;  4TV8 E;  2E9X C;  2VKD A;  4LF9 T;  1N34 T;  3T8O A;  3HL6 A;  2FJE A;  3TKL B;  3AA1 B;  4UV9 B;  2XAH B;  3JC6 D;  3WIP A;  4J2C A;  4UM3 S;  5LGT B;  5HWX A;  2NW7 A;  3GUA A;  2XYT A;  3OYZ A;  4DBR A;  2VKJ A;  1WYB A;  5CO5 A;  3FZM B;  3MK7 C;  3RQW A;  2X00 A;  3UU5 A;  1FJG T;  1HTJ F;  2YMD A;  3N9N A;  3P8C D;  3C50 A;  2NW8 A;  3EVY A;  2XNU A;  2WS3 A;  3E0Z A;  1CHU A;  4L9I A;  4V1A v;  4IHJ E;  4X5T A;  5JDQ A;  2XNT A;  4UVA B;  3U8L A;  5EK3 A;  5J2T E;  2D5U A;  2ZJV A;  4PK6 A;  1KNP A;  4FJO A;  4FRR A;  4TZ4 C;  1D1B A;  3KV4 A;  3KV9 A;  5IHY A;  3C4Z A;  3NRY A;  4L5G A;  2BS3 A;  4AKL A;  1L0V A;  2WBL A;  5AQL B;  3ZPO A;  1YW0 A;  2WWU A;  3WTN A;  2NOX A;  5AQK B;  4DUZ T;  5FXW A;  4DV1 T;  2CA5 A;  4UXU A;  3NKZ A;  1YQ4 A;  2L9Q A;  2Y54 A;  2KZ7 B;  1LVF A;  1UUS A;  2H7O A;  2FJB A;  3CML A;  2K5B B;  2R6G F;  4EAH A;  3WTH A;  3NZP A;  4EYU A;  3ZEF B;  2XQY A;  3BQK A;  2H88 A;  2IDO B;  1HX8 A;  3K3N A;  4UM3 A;  3U8J A;  4HN9 A;  4H9R C;  3C4W A;  4NUU A;  4ILU A;  3CX8 B;  3U3I A;  4WBN E;  5FVL A;  1XMQ T;  3B5M A;  4ZJT A;  2CWY A;  5CB4 E;  1R8I A;  2I0M A;  3EAB A;  3W15 B;  1HNX T;  3QNU A;  4QAC A;  4OYK A;  3C4X A;  4X65 T;  2X9H A;  1UW6 A;  2KWI B;  3C79 A;  3AAE B;  4IDZ A;  1M62 A;  4E7S A;  4A5X A;  2BBJ A;  5EK2 A;  5H6R B;  2BKN A;  2K48 A;  3WAK A;  5JQG E;  4TN7 B;  5AQI B;  1XZY A;  3UU6 A;  3PUA A;  3WTO A;  3LBX A;  3LFM A;  4COF A;  3H3A A;  1HS7 A;  3PUR A;  1W9R A;  4ZEY A;  4X1K E;  2J62 A;  2B1E A;  2K24 A;  2UXD T;  3VKG A;  2XSB A;  4Z91 A;  4A98 A;  2WNJ A;  4LMK A;  2UUB T;  4DID B;  4UIG A;  4Z8X A;  5ABH A;  1I94 T;  4HQP A;  3AVR A;  4ERR A;  1JNR A;  2C9T A;  3E22 E;  3KBU A;  1QLB A;  2E9X A;  2H3R A;  3N9L A;  1XWM A;  1CUN A;  4JBW F;  4DV0 T;  2XQA A;  2Q9Q D;  4TNW A;  1VCS A;  1UX2 A;  2HN1 A;  3ZMZ B;  2UUC T;  3CVR A;  2VQE T;  2LSY A;  4AIS A;  3EI0 A;  4HFV A;  4GYS A;  4CN4 A;  4KUM B;  2XM2 A;  2Q9Q B;  3A5X A;  3RH3 A;  1OWA A;  2QRX A;  4CI1 B;  3AA7 B;  3G06 A;  4U3C A;  2W4X A;  4IE5 A;  3Q9D A;  4CXX A;  3AE2 A;  2CBJ A;  3CQX C;  4U33 A;  4ANJ A;  4AIU A;  3UUB A;  4JI8 T;  3KDS E;  1NEK A;  5AFM B;  3HKC E;  4GYR A;  4H9P C;  3QB5 A;  5JRC A;  3AEA A;  1G8X A;  4HKA A;  2VQF T;  3FZL B;  3ZN1 B;  4DR7 T;  1KK7 A;  2V8S V;  1SA0 E;  4DR4 T;  5JRE A;  4EED A;  3RGL A;  2ODV A;  3WI3 A;  4NPP A;  5JDH A;  2KLQ A;  5AQN B;  3N9P A;  4IT4 A;  4Q25 A;  3PUY F;  3AEF A;  2CLY B;  2WY2 A;  2BVM A;  5HWY A;  4JYA T;  1BR1 A;  2LSK A;  4U7I A;  3HR0 A;  2E2A A;  4ASK A;  3P4W A;  4AKH A;  4PK5 A;  4WNK A;  1WLX A;  2RP4 A;  4JV5 T;  3AE1 A;  2CXF A;  2VUR A;  2F4V T;  5LJM A;  4LMJ A;  2JQH A;  4UY2 A;  4IGU A;  1IZN B;  4KBM B;  1U5P A;  1FEW A;  5IUX A;  2VVN A;  4IE0 A;  1ZV4 X;  5L3C B;  4PJM A;  4AI6 A;  4YJ2 E;  3LK3 B;  1FMW A;  3VR9 A;  5FKY A;  2Y57 A;  3AE7 A;  1ZOY A;  3IBP A;  4C91 A;  3RYF E;  5LGN B;  4EIW A;  4YTM A;  4ZS2 A;  1IJ5 A;  2W8G A;  2IAK A;  1UK5 A;  5DAB A;  3L3P A;  4ZHQ E;  1SUM B;  2IIU A;  3KV6 A;  5FP3 A;  1HNZ T;  5L47 A;  2A9U A;  4AQF A;  1XDP A;  3UU3 A;  5JTG A;  2MAW A;  3N5L A;  3HA4 A;  5FMN A;  3AEB A;  3L09 A;  2W67 A;  3N2O A;  1XNQ T;  3KFW X;  3OTO T;  3OKQ A;  5LHG B;  2JRK A;  2LSI A;  4PW8 A;  2D9D A;  4MAL A;  2HPL A;  3FBZ A;  4L0R A;  3P4S A;  2IC9 A;  3P4P A;  2IC6 A;  4CXY A;  3WAJ A;  2PG8 A;  1OED B;  3OPC A;  4ZI3 C;  4U31 A;  2WNL A;  5LG4 A;  3AVS A;  5KE4 A;  4A56 A;  4YY3 T;  4LFC T;  2XAJ B;  5AFN A;  3R84 B;  2BZB A;  1IBK T;  3V5S A;  4BA9 A;  3GN5 A;  4DMV A;  2V7I A;  4HEA A;  3ZKR A;  2E5L T;  3IA3 A;  1X79 A;  4YLH A;  4YSX A;  2CMR A;  1KF6 A;  4UVC B;  2LE8 A;  4UV8 B;  5AIN A;  4QAB A;  1OED E;  5F5W A;  3PDY A;  1D0Z A;  3SH1 A;  4QX7 B;  1KNR A;  5KMG P;  3JAE A;  5KDM C;  2I6H A;  2XZ5 A;  1IAP A;  3C51 A;  3RLF F;  2M6B A;  4KP3 C;  2ZM6 T;  3FZH B; 
#chains in the Genus database with same CATH homology
 3C84 A;  2WNJ A;  2XZ6 A;  5J5F A;  4LMK A;  4NPP A;  1UV6 A;  3ZDG A;  4AFH A;  3JAF A;  2Y58 A;  5HEO A;  4ZJS A;  3U8M A;  4HFC A;  5BP0 A;  4WV9 A;  2Y7Y A;  5KZU A;  4UXU A;  4XHE A;  4DBM A;  3TLS A;  3UU4 A;  4HQP A;  5TVC A;  4A97 A;  2ZJU A;  1I9B A;  2C9T A;  1OED C;  2Y54 A;  4ZRU A;  3RIF A;  4ZR6 A;  3SIO A;  3TLT A;  5BW2 A;  5AFL A;  2PGZ A;  3WTK A;  1OED A;  3EAM A;  3UU8 A;  3SQ9 A;  2X00 D;  2XQ3 A;  4NZB A;  4ZK4 A;  5J5G A;  4QH1 A;  3WTH A;  3P4W A;  1OED B;  2YN6 A;  2XQA A;  3WIP A;  4D01 A;  3WTL A;  2XYS A;  2WNL A;  4TNW A;  2KSR A;  5CFB A;  2WN9 A;  5LG3 A;  4BFQ A;  1UX2 A;  4UM3 S;  2VL0 A;  3RHW A;  4TWF A;  5KE4 A;  4LMJ A;  5HEG A;  4UM3 A;  3U8J A;  2LM2 A;  3EI0 A;  4UY2 A;  4HFI A;  2Y56 A;  5BRX A;  3TLU A;  5AFN A;  3RI5 A;  3GUA A;  4ILC A;  2BG9 E;  4IRE A;  4B5D A;  5HEH A;  2XYT A;  3PEO A;  4ZJT A;  5AFK A;  5J5H A;  3TLW A;  5IUX A;  3IGQ A;  2BR7 A;  3EHZ A;  5CO5 A;  4BQT A;  5JME A;  4ILA A;  3RQW A;  4IL9 A;  4UM1 A;  2X00 A;  5HCM A;  4AFG A;  3UU5 A;  4QAC A;  2YMD A;  4ALX A;  5FJV A;  4HFE A;  5HEU A;  4PIR A;  1UW6 A;  5L4E A;  3PMZ A;  3UUB A;  4AFT A;  3LSV A;  4IL4 A;  2BYN A;  3WTJ A;  3RQU A;  3ZDH A;  3C79 A;  2XNU A;  4ZZC A;  2Y57 A;  4XK9 A;  3WTM A;  3WTI A;  5AFM B;  2PH9 A;  4QAA A;  3ZKR A;  3U8K A;  4HFH A;  2XNV A;  2LKG A;  4X5T A;  4EZ1 A;  2BYR A;  2M6I A;  2XNT A;  2YKS A;  3T4M A;  3U8L A;  2YOE A;  2W8G A;  3U8N A;  5HEJ A;  2LKH A;  2BG9 C;  2UZ6 A;  2ZJV A;  2W8F A;  4UM3 P;  2YME A;  5AIN A;  2XQ9 A;  3TLV A;  4QAB A;  2QC1 B;  5LXB A;  2WNC A;  1OED E;  4FRR A;  2BYS A;  3SQ6 A;  2XQ4 A;  2BYQ A;  2BG9 A;  3P50 A;  3RIA A;  5AFH A;  2BR8 A;  2WZY A;  5AFM A;  4ZZB A;  2LLY A;  4HFD A;  5SYO A;  2XQ5 A;  4Z90 A;  3UU6 A;  2BYP A;  3SH1 A;  5L47 A;  4ZK1 A;  3WTO A;  4TNV A;  4COF A;  3JAE A;  4TWD A;  2BG9 B;  2XQ8 A;  3JAD A;  4QH5 A;  4LML A;  3UU3 A;  5L4H A;  5J0Z A;  2MAW A;  2XZ5 A;  2BJ0 A;  2XQ6 A;  5AFJ A;  3UQ4 A;  4F8H A;  5J5I A;  4TWH A;  2XQ7 A;  4HFB A;  4ILB A;  2M6B A;  5HCJ A;  4Z91 A;  4QH4 A;  3WTN A;  4A98 A;  3UQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...