2XQ9A

Pentameric ligand gated ion channel glic mutant e221a in complex with tetraethylarsonium (teas)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYDANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 85
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq9A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq9A01
4HFEA 5HEHA 4A98A 4HFBA 3UU8A 2LKHA 5AFKA 4TNWA 2Y58A 5HEJA 4HQPA 3C79A 5J5FA 3UQ7A 2XZ5A 3TLVA 4IREA 4ZK1A 5L47A 2WNCA 4NPPA 4XK9A 5BW2A 2WN9A 4COFA 2WZYA 2PGZA 2BG9C 4UM1A 5J5IA 2WNLA 4AFGA 5HCJA 3RQUA 4LMKA 3C84A 2C9TA 1OEDA 2Y56A 4AFHA 3UUBA 4AFTA 3RIAA 4XHEA 1OEDE 3WTMA 2XNVA 4QABA 5SYOA 2XQAA 2LLYA 2XQ6A 2XNTA 2BJ0A 3UU4A 5BP0A 3SIOA 4Z91A 4ILBA 1OEDB 2BYQA 3JAEA 3SQ9A 4EZ1A 3UU6A 3RIFA 3PMZA 4UM3A 3EI0A 3WIPA 5AFMA 5AFNA 2XQ8A 2BR8A 4ZJSA 3UU5A 2PH9A 4ZJTA 3GUAA 4TWDA 3P50A 2BYRA 3U8JA 2LM2A 2BR7A 2XQ5A 2XQ9A 2YN6A 2LKGA 3RQWA 3UU3A 4HFDA 3ZDGA 3EAMA 4HFIA 5HCMA 4FRRA 2BYNA 4ZK4A 4X5TA 4UM3S 4LMLA 3PEOA 4UXUA 5J5GA 3EHZA 1UX2A 4UY2A 3WTIA 5AFJA 4TWHA 4BFQA 2X00D 5L4HA 4QH5A 2Y7YA 2UZ6A 4NZBA 5FJVA 4QH4A 4HFHA 5L4EA 5AINA 3TLSA 3TLTA 3U8MA 3RHWA 5JMEA 3SH1A 3UQ4A 3ZKRA 5CO5A 2M6IA 3TLWA 5LXBA 4UM3P 4D01A 1UW6A 4LMJA 2QC1B 2X00A 5AFHA 2MAWA 1OEDC 2BYPA 2XYTA 4PIRA 1UV6A 2YOEA 5IUXA 2XYSA 5J0ZA 2XQ4A 5LG3A 2YMEA 2KSRA 2ZJVA 5AFMB 4QACA 2XQ3A 4BQTA 2XZ6A 3U8LA 4TWFA 2ZJUA 2W8GA 2YMDA 2VL0A 2YKSA 5AFLA 3WTLA 2XQ7A 5KE4A 3WTOA 3P4WA 4TNVA 2BG9A 3WTHA 3JADA 5BRXA 3LSVA 3JAFA 3U8NA 2BG9E 5CFBA 4Z90A 2Y54A 2M6BA 3RI5A 4ZR6A 2BG9B 4ZZCA 5HEGA 3WTJA 4HFCA 3WTKA 3WTNA 4ILAA 4ALXA 4F8HA 5HEOA 4QAAA 4B5DA 4WV9A 3U8KA 5KZUA 4ZRUA 4A97A 4IL9A 2XNUA 3T4MA 4DBMA 4QH1A 2W8FA 2BYSA 5TVCA 2Y57A 5HEUA 2WNJA 3SQ6A 3ZDHA 5J5HA 3TLUA 4IL4A 1I9BA 3IGQA 4ZZBA 4ILCA
chains in the Genus database with same CATH superfamily
4A98A 2XAHB 2CM0A 4DV2T 5HEJA 2V7IA 2NOXA 3FXEB 3KBTA 3LJCA 5AQMB 3F31A 4AFGA 2BKPA 3AVSA 2XQ6A 3R6NA 3Q5DA 3OKQA 2NR4A 2D0UA 2VKHA 2IW5B 1YD8G 2PBIA 4LF9T 3U8JA 3H3MA 3GA8A 1D1BA 4LMLA 1IAPA 3C4ZA 5FMNA 5BP0A 4QH4A 3RHWA 2F4VT 4E7ZA 5JDFA 2QC1B 2D2SA 3LK3B 5JDNA 4ISSA 3ZSSA 4QACA 3E08A 3AE8A 5KE4A 2BG9A 3QUJA 4YTPA 4HWCA 1FMVA 5EK4A 1WR0A 2JQHA 2QGSA 3A5XA 5JH7E 5DJQC 3ZSTA 4B5DA 5LHHB 5JRCA 2D0TA 1T98A 4GIWA 4JEHB 4E7SA 4ISTA 4CI3B 5BR8T 4KBMB 2N2NA 3SS1A 3TLUA 3ZT5A 4IL4A 5F5WA 5LOVE 1X79A 1O3XA 4UF0B 3TLVA 2FUPA 1MMAA 2LSIA 2FJEA 3NZQA 1SHZC 2G0UA 1OEDE 3BK9A 3WTMA 2XNVA 3NVOA 2BZBA 2W67A 5AQQB 3VU7H 4DR5T 3AEDA 3W15B 3UU5A 3E0ZA 4MBQA 4PAGA 3N2KE 4TWDA 2BYRA 3MA9A 2NW7A 3CVRA 3RQWA 4HFIA 4UXUA 3S4UA 2I59A 3C4XA 4NZBA 4HFHA 3U8MA 5JDLA 5JMEA 2YU1A 2K3WA 1BR4A 5LB7B 4LF8T 2KWHA 5AQIB 3CKDA 3ETUA 1MMNA 1HF8A 3PUZF 4PIRA 4ZEYA 4HEAA 5J0ZA 2VKOA 2DL1A 4ZOLE 4GYRA 1FJGT 2IC6A 2L3LA 3N9NA 5FVKA 3F2EA 4ZHQE 3RC3A 2W61A 4IDQA 4GK5E 5CGMA 3F57A 4CZZB 2WAUA 3FXDB 3VRBA 3P8CD 3RYIE 4ILAA 1HCIA 4Z8XA 2ZM8A 1Z0PA 5FY7A 5DQVA 4WBOA 3HKBE 3T4MA 2XQYA 4LFBT 2WS3A 4TZ4C 4UR9A 4UF0A 2XSAA 3RKOA 3UU8A 3OJAA 3UQ7A 1BR0A 3HKDE 4X1KE 2B1EA 2W0GA 2JMKA 3N2OA 2LT3A 3K3NA 3KFWX 2CHNA 4QX8B 4AFTA 2FJBA 2YINA 3CX8B 2CXDA 5L3CB 2WZHA 3OBVE 1J5ET 4UV9B 2B76A 5AFMA 2BR8A 4DV7T 3ZJ1A 2BVMA 2NTYA 2BR7A 2KMFA 4ZK4A 5AQPB 3EHZA 1UK5A 4BFQA 4QH5A 3Q5XA 4DUZT 3OYZA 1DU2A 5F3JA 1OEDC 4GK0E 2E9XC 2XYSA 5LMUT 5LG3A 1W0BA 4IDZA 4ILUA 1WLXA 4PK5A 4X1YE 4JI5T 2NTXA 4IE0A 2YMDA 4U7YA 2XQ7A 2CXLA 1D1CA 2BG9E 3WI3A 3C64A 4JI4T 5TAOA 3FBLA 3RKGA 4ZZCA 5HYAA 4JLEA 1KNRA 4KHPT 2YU2A 1HNXT 5CB4E 1MNEA 4YFSA 5LBQB 2ODVA 4MALA 1I9BA 3C4WA 4EEBA 2Y58A 3C79A 4IT4A 3UUMA 2V8SV 2RP4A 3HR0A 2IC9A 2E5LT 3CQCB 3RQUA 3N9OA 3LDQB 2CA5A 4YTMA 4WNKA 5SYOA 2LLYA 4IE6A 5FVLA 3JAEA 2YK0A 4L0RA 3PMZA 4IDPA 2UXXB 4K0UA 3T1HT 1I94T 2QRXA 4ZJSA 4ZJTA 2OLTA 1HR0T 2QYWA 2YN6A 4IDNA 3Q2MA 1SUMB 1LVKA 1JNZA 1XWMA 2UZ6A 2UXNB 2LJLA 4YT0A 5CA1E 2WBLA 3ZN0B 5CO5A 2J4GA 5J1GA 5LXBA 2E9XB 2W62A 1UW6A 2H88A 2C5KT 3IA3A 1IBLT 3LBXB 2BDEA 4EGWA 4DBQA 2K5BB 3ZCIA 2HH7A 3ZT6A 1X9BA 1WRDA 2JIWA 3RLFF 2WWVA 2JQKA 2V6XA 3WTJA 4XZCA 1U5PA 5AFUL 1LKXA 4WV9A 4KUMB 2DHRA 3SOLA 5HXCA 2M67A 2Y57A 3ZDHA 4EOZB 4UIGA 5C2TA 4ILCA 2X9YA 3NRXA 4ZK1A 4NPPA 3HKEE 2BG9C 2CLYB 2YDQA 2HPJA 4EV6A 3Q5WA 5ABEA 2XTLA 4HWHA 4I4TE 3MJXA 1ZEEA 4ILBA 2BYQA 1XDPA 1I6ZA 5AQFB 2XQ8A 3AEGA 3KV4A 1ZP0A 2E5VA 5AQJB 4O4HE 4U33A 2XAJB 2Y7YA 2JPFA 3QB5K 4H9QC 3TLSA 2J62A 1QUUA 2BBHA 4IE5A 5AQUB 2W2UA 3LBXA 2XZEA 1HG2A 3ZEFB 3G06A 4A56A 2WWUA 3HL6A 2H7OA 3AECA 4MHCA 2V1DB 5HXHA 4LF5T 2XUEA 5LNKA 4Q25A 3Q9DA 4EZHA 4LFCT 4TNVA 3JADA 4IGUA 3B57A 4WW0A 3KINB 3PUXF 3P4SA 4WZXA 5LGUB 3MK7C 4PFOA 3T1YT 4QAAA 1YQ3A 3PE0A 5J5HA 4YHHT 2E8IA 3VRAA 4ZZBA 2WM9A 5HEHA 2CCQA 4TNWA 2WY2A 1UX5A 4UVBB 4IREA 1W9RA 4DV3T 4XK9A 5BW2A 4COFA 2CBJA 1D0ZA 4UM1A 2KZ7B 4YSYA 4LFAT 3JCFA 1WYBA 1VCTA 3CK6A 5JQGE 2Z6EA 4QABA 2Y6XA 2WU5A 1KNZA 5JRCB 1HX1B 4H9SE 4BA9A 4DO0A 2R6GF 4UXNB 1LVFA 2H89A 2WQYA 3PUGA 4UM3S 2K24A 2XM1A 3PEOA 4EXTA 2LSYA 4KI0F 3PUYF 1VRBA 4PJJA 2XM2A 3O1JA 2JQ9A 2FJDA 2YDRA 3NBXX 1Y64B 4D01A 3K3QC 4WYVA 4OHFA 2I0MA 2OV9A 4ERRA 2XQ4A 4ZI7E 4X65T 4A5XA 1NAFA 4P0BA 1IJ5A 1KNPA 2L8KA 3ABVA 2ZLYA 2UUCT 3AE7A 4PK6A 3LSVA 3BQKA 2BS4A 4L5GA 1S35A 3RI5A 1VOMA 3I9YA 5FL0A 4G63A 3VR8A 1XNRT 2UU9T 5IWAT 3RRCA 2PFVA 4YY3T 3IGQA 2UXCT 3V5SA 2Y48B 3VR9A 2SPCA 1M7KA 4YJ2E 3CQXC 4KP3C 2WZYA 3UUNA 3ZJ2A 4AKIA 2P9BA 3RIAA 2BS2A 2V7MA 2XNTA 2DWKA 3N9MA 5HXRA 1N36T 2WSSV 5KXJA 1N32T 3ZC0A 2HN1A 3ZYMA 2LKGA 1XMQT 2WMNA 4UY2A 5GONE 3WTIA 4AQFA 2X00D 3V5UA 1Z8UA 2IUBA 5J2TE 4ADZA 5FXWA 1XZYA 2DCFA 3A8YC 5M4YA 3RIUC 2A9UA 4O4LE 4UM3P 1IZNB 2X00A 1CHUA 3OYXA 4QX7B 4PW8A 4O8SA 5IUXA 4X62T 2PJQA 2V7JA 3KV6A 2KSRA 5AFMB 4UVAB 4OFZA 3CX7B 2X67A 3C51A 2IHR1 4X64T 3X1DA 3T8OA 4QXHB 4NXMT 4PFPA 1EZ3A 4H63V 3KBUA 4O2AE 3U8KA 4DBMA 5EK2A 2LOSA 2X9WA 1J1JA 3N5LA 1JNRA 3PTRB 2JRKA 2BBJA 4H9PC 1OXZA 3CX6B 1UURA 4HQPA 5J5FA 3FZKB 5L47A 4U31A 5AQRB 2XAQB 2Y56A 4CQIA 4MFRA 1D0YA 2XQAA 2C5IT 2A3DA 3L3PA 1W0AA 4JI8T 2PTFA 4ZI2D 4UVCB 3ZT7A 2V26A 4UELA 4AQGA 4YTNA 3JC6D 2LHRA 3AEBA 3EAMA 4DUYT 2X0LB 2BYNA 3EUHA 5AFJA 3AVRA 4EZ4A 4F6RC 5L4HA 5LYJE 3H3AA 2WDRA 5FL1A 5ABHA 5L3BB 3QK6A 2VASA 5AFHA 2VK9A 2XYTA 4ASKA 4CXYA 4GKJT 4DR3T 5LBMA 2YKSA 1HNZT 3AA6B 1WYCA 1B7TA 5BRXA 3BQIA 1VCSA 4YJ3E 1SA0E 3KV9A 2V7KA 2LEHA 3OPCA 3DP7A 4AI6A 1T72A 5FXZA 3RF1A 5FY0A 4DR6T 3Q5EA 2K48A 3KDSE 4NXNT 4IL9A 2XNUA 3D0TA 5HEUA 4IHJE 5E0OA 3OVUA 2WP9A 2KLQA 1HG5A 2DLRA 4OYKA 3QC9A 4M1PA 4HFEA 5FY1A 3UUXB 3AE2A 2CBIA 1UCUA 5A1LA 5ADXL 3ESLA 1ZOYA 5LA6E 3AB3B 4GKKT 2WNCA 4CN6A 4YSZA 4TX5A 4DIDB 2XAFB 4I50E 3PJAJ 2IIUA 4HE8A 2VB6A 3AE9A 4J2CA 4MLKA 5AQHB 4EZ1A 4UM3A 3EI0A 4ZI3D 4DV1T 1HS7A 2LOPA 3PJAA 5AQTB 2HPLA 4YSXA 5JR9B 2MTQA 4AQYT 3LG7A 1G73A 3L8RA 3N9QA 3PURA 1YW0A 4CI1B 3ZN1B 2CLYC 2X66A 4ZS2A 5LGNB 2J47A 5HWYA 4DR2T 3J7Yq 2LSKA 2QA7A 3NZPA 1N34T 5AQSB 4DVDA 1H7CA 3AE4A 4TWFA 2ZJUA 3QB5A 4QWNB 4YLHA 3SFDA 2EHOD 2OA5A 5LP6E 4OYJA 2MYSA 2J1DG 4JI2T 3FHNA 3M65A 4JI3T 2CXFA 2EHOA 2AE9A 5HEOA 2YEVC 2CWYA 2BYSA 3AE6A 2BKNA 2CRBA 1LRZA 4H9RC 2LRKA 5AFKA 1MIVA 3O1HA 5H6QB 2UXBT 4IE7A 3H37A 2HHHT 3WAJA 3B5MA 3AA7B 1L0VA 2CE7A 1US7B 4Z91A 4K0KT 5JR9A 3RYHE 2AXDS 3P7IA 4GOUA 3FZHB 5IHYA 2QVAA 4XBFB 3AAIA 3PU3A 4AKLA 1W09A 4AXPA 1MIYA 5AINA 2XHEB 3ZKRA 4FJOA 4HWDA 5HXEA 1KF6A 2FBWA 3EVYA 3VKGA 5JVDE 2MOZA 4DMWA 2Q9QD 5DQWA 1UV6A 3PUSA 4GYSA 5LJNA 3KV5A 3ANWB 3MACA 2UUAT 1M62A 4DR7T 3UTKA 2Q9QA 3O1IA 4JV5T 3WTLA 2A72A 4XAXB 2W63A 3UT5E 2W66A 4Z90A 2X9HA 4U74A 2Y54A 4DV5T 4ANJA 5IYZE 4U7IA 3WTNA 3TKLB 4L9IA 5KX5E 2FJAA 4BJMA 2IMLA 5H6RB 5KDMC 3SRZA 1HFAA 4A97A 5TVCA 2WNJA 4CN1A 2N9DA 3ZMSB 3HA4A 4PNIA 2V5CA 1WFDA 5C8YE 5FXVA 2C5JA 2ZM2A 4IDOA 2UXDT 2XZ5A 5KMGP 4DV6T 3N9PA 3RYCE 2MPKA 3RRWA 1NWMX 2K9AA 5J5IA 3FBZA 3ZLIA 4G2AA 1Y01A 2D5UA 3SIOA 2BKOA 4C91A 4TUYE 1FIOA 2H7VC 2WCAA 3WIPA 3PUAA 3AEEA 2LSGA 4JUYA 2ZM0A 3GN5A 3P50A 2XSBA 2XQ5A 4HFDA 4FRRA 4X5TA 2V6YB 2NWBA 1FMWA 1HX8A 4U3CA 3ANWA 2KT9A 1D1AA 3RX6A 2BYPA 5AQLB 4AKRB 4EYUA 2CEAA 2E2AA 2ZJVA 3LFMA 4O2BE 2XQ3A 2LRLA 2JMHA 2LE8A 4OK0A 4HTEA 3RC8A 3CPZA 3U8NA 4JI6T 4ZI2C 5HEGA 4HFCA 4F8HA 4JEUB 4PJLA 1QLBA 2W4XA 1YKHB 2WDQA 3JC6C 1YXRA 2ES0A 4P09A 4HGAA 4BJNA 2ZM6T 4P1NA 4QH1A 2WMOA 5LMNT 1UUSA 4CXXA 2V7LA 2CWOA 5AQKB 2LKHA 5EZYE 5C3JA 1XDOA 3I0OA 3ZMVB 3P4QA 3KVAA 5HCJA 4EIWA 1IJ6A 3C84A 4LF7T 3I0QA 3UU4A 3K1SA 4OX9T 3CQGB 2NP9A 3E22E 2W00A 5CJ5A 2A2FX 2V6YA 5ABGA 1MMDA 2LM2A 2XQ9A 2KINB 3NRYA 3P4RA 1HNWT 2X0YA 5L4EA 2DI4A 3FZFB 4AKGA 3BQLA 3HKCE 5FYMA 3GMIA 2MAWA 3QOFA 4AIUA 2Y8DA 5FKYA 5ABFA 4BQTA 1MNDA 3R84B 2WZIA 5LCYA 2NW9A 4LF4T 2N1GA 1UGOA 4U2ZA 5LHIB 2XASB 4NIQA 4ZI3C 4JI7T 4O4JE 3QNUA 1YQ4A 3AE1A 5JDHA 2W8FA 4I0UA 4B3RT 1S94A 2H3RA 3K8PC 5L3GB 1IBMT 1V9DA 4AISA 3ZMUB 4U72A 4NUUA 4DMVA 4PK4A 3ZPOA 2D9DA 4UEMA 2HN2A 4O4IE 3PUVF 2C0SA 1G8XA 1ZHCA 4KX6A 4V1Av 1NEKA 4LMKA 2C9TA 1FEWA 2VKJA 4XHEA 5JDQA 3LK42 2CHOA 1T7SA 2BJ0A 2EHOC 5BMVE 3KVBA 4KHZF 1QSDA 1KFYA 4UV8B 3IEEA 3UU3A 3CMLA 4QXBB 3AA1B 5J2UE 1UX2A 4B3TT 4TV9E 3C50A 2RPAA 4TWHA 3J9X1 2I6HA 4EAHA 1GQEA 1NENA 3HI2A 2X0HA 2M6IA 3MXZA 3AAAB 1HTJF 3ONJA 5L3DB 2PG8A 2DNXA 2YOEA 3I1AA 2MBGA 4EYYR 5AQVB 4JYAT 5JR9C 1UX4A 3U8LA 3RGLA 1YKEB 3AA0B 5AFLA 3N9LA 2X68A 4ZXLA 2M6BA 2VWAA 4ZR6A 4TV8E 2X51A 2WDVA 4HN9A 3EDVA 3EABA 4ZRUA 3MZKB 2VQFT 3AEAA 3SQ6A 2VKDA 1ZKEA 1WR6A 2NW8A 3RH3A 4HFBA 3N2GE 4X20E 3O9XA 4I55E 3PUWF 2Q9QC 3RPUA 4CI2B 3I9WA 3ETVA 2WN9A 4B6XA 3SWHA 3DTOA 4YXDA 1IBKT 2EHOB 3ONLC 4QHOA 5EK3A 3RIFA 2CPTA 4QXCB 3GUAA 3PU8A 3P4PA 5HCMA 3K3OA 5FNVE 2JJ9A 2XPKA 4N78D 1N33T 5L3EB 3UQ4A 3AE5A 5AQGB 2IDOB 2GK9A 4PJNA 5LJMA 2LHNA 2IAKA 2VL8A 5DABA 3ZC1A 4X66T 3AE3A 2VL0A 4IE4A 4U2YA 4P0AA 4YHJA 3WTOA 3P4WA 3ZCJA 3WTHA 4WBNE 3JAFA 4EEDA 2XY8B 5L2LA 3PUQA 2L9QA 3WTKA 2KXPB 3RIUA 3IBPA 2ZMAA 5KZUA 5HAXA 4C90A 5CA0E 2KNDA 4IIJE 2YDSA 5JTGA 2BVLA 2VVNA 2ODUA 4DV0T 1BR1A 2Q9QB 4JBWF 4DR4T 1WCRA 4LF6T 3ZYKA 4AFHA 2VURA 3AEFA 4JI1T 3SQ9A 1OEDB 2JQQA 3VKHA 3UU6A 1XNQT 5AFNA 3NWIA 2PH9A 5JREA 1KEYA 5LHGB 3ZDGA 3A7MA 3FZLB 3MKDA 3U78A 5FJVA 3TLTA 1J5WA 3ZMTB 4PJMA 1MMGA 3VHLA 1AJ3A 4LMJA 3IF8B 3PV0F 2RA1A 2YMEA 3UFEA 2WB5A 2VVSA 2DWGA 4FI5A 3L39A 4ZS3A 1D0XA 2CMRA 5FXXA 3GN5B 1U4QA 3ZYLA 2W8GA 4KMCA 1R8IA 5L3FB 3C98B 3DJBA 4H9OC 5CFBA 3CWZB 5HWXA 3OTOT 3U3IA 3CIRA 4NUVA 2BS3A 1CUNA 3AXJB 3WAKA 5LGTB 3UFGA 4AQFC 2E9XD 2LM9A 4DNDA 5LG4A 2PGZA 1BR2A 4AKHA 2WNLA 2XAGB 1OEDA 1ZV4X 5HXSA 3UUBA 2ACZA 3GWHA 1SE7A 2E9XA 4QKNA 4TN7B 4CN4A 4HKAA 3LK2B 3PDYA 4BAYB 3ONXA 5JDGA 2ACXA 4I43B 1E2AA 1MIWA 2VQET 3RYFE 4H9NC 5J5GA 4B3ST 3AAEB 5FP3A 2XJ7A 4CXWA 1T8BA 3FZMB 4EB6E 3SH1A 2UUBT 3TLWA 4JI0T 2LSJA 4DV4T 3EDUA 5F8PA 5ETWA 3UULA 1E7PA 1E1HB 2XZ6A 3NKZA 4H63H 1XMOT 3FB2A 4DR1T 2WU2A 5LXTE 3B13A 5AQOB 3ZMZB 5AQNB 4B3MT 2X9XA 4HWFA 3M3ZB 2BG9B 4HWIB 3SFEA 4ALXA 2V5DA 3L09A 5JDMA 3IHRA 3AXJA 4X1IE 2KWIB 4HFVA 3O4XE 4DBRA 1OWAA 5ABFB 1KK7A
chains in the Genus database with same CATH topology
4HFEA 5HEHA 4A98A 4HFBA 3UU8A 2LKHA 5AFKA 4TNWA 2Y58A 5HEJA 4HQPA 3C79A 5J5FA 3UQ7A 2XZ5A 3TLVA 4IREA 4ZK1A 5L47A 2WNCA 4NPPA 4XK9A 5BW2A 2WN9A 4COFA 2WZYA 2PGZA 2BG9C 4UM1A 5J5IA 2WNLA 4AFGA 5HCJA 3RQUA 4LMKA 3C84A 2C9TA 1OEDA 2Y56A 4AFHA 3UUBA 4AFTA 3RIAA 4XHEA 1OEDE 3WTMA 2XNVA 4QABA 5SYOA 2XQAA 2LLYA 2XQ6A 2XNTA 2BJ0A 3UU4A 5BP0A 3SIOA 4Z91A 4ILBA 1OEDB 2BYQA 3JAEA 3SQ9A 4EZ1A 3UU6A 3RIFA 3PMZA 4UM3A 3EI0A 3WIPA 5AFMA 5AFNA 2XQ8A 2BR8A 4ZJSA 3UU5A 2PH9A 4ZJTA 3GUAA 4TWDA 3P50A 2BYRA 3U8JA 2LM2A 2BR7A 2XQ5A 2XQ9A 2YN6A 2LKGA 3RQWA 3UU3A 4HFDA 3ZDGA 3EAMA 4HFIA 5HCMA 4FRRA 2BYNA 4ZK4A 4X5TA 4UM3S 4LMLA 3PEOA 4UXUA 5J5GA 3EHZA 1UX2A 4UY2A 3WTIA 5AFJA 4TWHA 4BFQA 2X00D 5L4HA 4QH5A 2Y7YA 2UZ6A 4NZBA 5FJVA 4QH4A 4HFHA 5L4EA 5AINA 3TLSA 3TLTA 3U8MA 3RHWA 5JMEA 3SH1A 3UQ4A 3ZKRA 5CO5A 2M6IA 3TLWA 5LXBA 4UM3P 4D01A 1UW6A 4LMJA 2QC1B 2X00A 5AFHA 2MAWA 1OEDC 2BYPA 2XYTA 4PIRA 1UV6A 2YOEA 5IUXA 2XYSA 5J0ZA 2XQ4A 5LG3A 2YMEA 2KSRA 2ZJVA 5AFMB 4QACA 2XQ3A 4BQTA 2XZ6A 3U8LA 4TWFA 2ZJUA 2W8GA 2YMDA 2VL0A 2YKSA 5AFLA 3WTLA 2XQ7A 5KE4A 3WTOA 3P4WA 4TNVA 2BG9A 3WTHA 3JADA 5BRXA 3LSVA 3JAFA 3U8NA 2BG9E 5CFBA 4Z90A 2Y54A 2M6BA 3RI5A 4ZR6A 2BG9B 4ZZCA 5HEGA 3WTJA 4HFCA 3WTKA 3WTNA 4ILAA 4ALXA 4F8HA 5HEOA 4QAAA 4B5DA 4WV9A 3U8KA 5KZUA 4ZRUA 4A97A 4IL9A 2XNUA 3T4MA 4DBMA 4QH1A 2W8FA 2BYSA 5TVCA 2Y57A 5HEUA 2WNJA 3SQ6A 3ZDHA 5J5HA 3TLUA 4IL4A 1I9BA 3IGQA 4ZZBA 4ILCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFE A;  5HEH A;  4A98 A;  4HFB A;  3UU8 A;  2LKH A;  5AFK A;  4TNW A;  2Y58 A;  5HEJ A;  4HQP A;  3C79 A;  5J5F A;  3UQ7 A;  2XZ5 A;  3TLV A;  4IRE A;  4ZK1 A;  5L47 A;  2WNC A;  4NPP A;  4XK9 A;  5BW2 A;  2WN9 A;  4COF A;  2WZY A;  2PGZ A;  2BG9 C;  4UM1 A;  5J5I A;  2WNL A;  4AFG A;  5HCJ A;  3RQU A;  4LMK A;  3C84 A;  2C9T A;  1OED A;  2Y56 A;  4AFH A;  3UUB A;  4AFT A;  3RIA A;  4XHE A;  1OED E;  3WTM A;  2XNV A;  4QAB A;  5SYO A;  2XQA A;  2LLY A;  2XQ6 A;  2XNT A;  2BJ0 A;  3UU4 A;  5BP0 A;  3SIO A;  4Z91 A;  4ILB A;  1OED B;  2BYQ A;  3JAE A;  3SQ9 A;  4EZ1 A;  3UU6 A;  3RIF A;  3PMZ A;  4UM3 A;  3EI0 A;  3WIP A;  5AFM A;  5AFN A;  2XQ8 A;  2BR8 A;  4ZJS A;  3UU5 A;  2PH9 A;  4ZJT A;  3GUA A;  4TWD A;  3P50 A;  2BYR A;  3U8J A;  2LM2 A;  2BR7 A;  2XQ5 A;  2XQ9 A;  2YN6 A;  2LKG A;  3RQW A;  3UU3 A;  4HFD A;  3ZDG A;  3EAM A;  4HFI A;  5HCM A;  4FRR A;  2BYN A;  4ZK4 A;  4X5T A;  4UM3 S;  4LML A;  3PEO A;  4UXU A;  5J5G A;  3EHZ A;  1UX2 A;  4UY2 A;  3WTI A;  5AFJ A;  4TWH A;  4BFQ A;  2X00 D;  5L4H A;  4QH5 A;  2Y7Y A;  2UZ6 A;  4NZB A;  5FJV A;  4QH4 A;  4HFH A;  5L4E A;  5AIN A;  3TLS A;  3TLT A;  3U8M A;  3RHW A;  5JME A;  3SH1 A;  3UQ4 A;  3ZKR A;  5CO5 A;  2M6I A;  3TLW A;  5LXB A;  4UM3 P;  4D01 A;  1UW6 A;  4LMJ A;  2QC1 B;  2X00 A;  5AFH A;  2MAW A;  1OED C;  2BYP A;  2XYT A;  4PIR A;  1UV6 A;  2YOE A;  5IUX A;  2XYS A;  5J0Z A;  2XQ4 A;  5LG3 A;  2YME A;  2KSR A;  2ZJV A;  5AFM B;  4QAC A;  2XQ3 A;  4BQT A;  2XZ6 A;  3U8L A;  4TWF A;  2ZJU A;  2W8G A;  2YMD A;  2VL0 A;  2YKS A;  5AFL A;  3WTL A;  2XQ7 A;  5KE4 A;  3WTO A;  3P4W A;  4TNV A;  2BG9 A;  3WTH A;  3JAD A;  5BRX A;  3LSV A;  3JAF A;  3U8N A;  2BG9 E;  5CFB A;  4Z90 A;  2Y54 A;  2M6B A;  3RI5 A;  4ZR6 A;  2BG9 B;  4ZZC A;  5HEG A;  3WTJ A;  4HFC A;  3WTK A;  3WTN A;  4ILA A;  4ALX A;  4F8H A;  5HEO A;  4QAA A;  4B5D A;  4WV9 A;  3U8K A;  5KZU A;  4ZRU A;  4A97 A;  4IL9 A;  2XNU A;  3T4M A;  4DBM A;  4QH1 A;  2W8F A;  2BYS A;  5TVC A;  2Y57 A;  5HEU A;  2WNJ A;  3SQ6 A;  3ZDH A;  5J5H A;  3TLU A;  4IL4 A;  1I9B A;  3IGQ A;  4ZZB A;  4ILC A; 
#chains in the Genus database with same CATH topology
 4A98 A;  2XAH B;  2CM0 A;  4DV2 T;  5HEJ A;  2V7I A;  2NOX A;  3FXE B;  3KBT A;  3LJC A;  5AQM B;  3F31 A;  4AFG A;  2BKP A;  3AVS A;  2XQ6 A;  3R6N A;  3Q5D A;  3OKQ A;  2NR4 A;  2D0U A;  2VKH A;  2IW5 B;  1YD8 G;  2PBI A;  4LF9 T;  3U8J A;  3H3M A;  3GA8 A;  1D1B A;  4LML A;  1IAP A;  3C4Z A;  5FMN A;  5BP0 A;  4QH4 A;  3RHW A;  2F4V T;  4E7Z A;  5JDF A;  2QC1 B;  2D2S A;  3LK3 B;  5JDN A;  4ISS A;  3ZSS A;  4QAC A;  3E08 A;  3AE8 A;  5KE4 A;  2BG9 A;  3QUJ A;  4YTP A;  4HWC A;  1FMV A;  5EK4 A;  1WR0 A;  2JQH A;  2QGS A;  3A5X A;  5JH7 E;  5DJQ C;  3ZST A;  4B5D A;  5LHH B;  5JRC A;  2D0T A;  1T98 A;  4GIW A;  4JEH B;  4E7S A;  4IST A;  4CI3 B;  5BR8 T;  4KBM B;  2N2N A;  3SS1 A;  3TLU A;  3ZT5 A;  4IL4 A;  5F5W A;  5LOV E;  1X79 A;  1O3X A;  4UF0 B;  3TLV A;  2FUP A;  1MMA A;  2LSI A;  2FJE A;  3NZQ A;  1SHZ C;  2G0U A;  1OED E;  3BK9 A;  3WTM A;  2XNV A;  3NVO A;  2BZB A;  2W67 A;  5AQQ B;  3VU7 H;  4DR5 T;  3AED A;  3W15 B;  3UU5 A;  3E0Z A;  4MBQ A;  4PAG A;  3N2K E;  4TWD A;  2BYR A;  3MA9 A;  2NW7 A;  3CVR A;  3RQW A;  4HFI A;  4UXU A;  3S4U A;  2I59 A;  3C4X A;  4NZB A;  4HFH A;  3U8M A;  5JDL A;  5JME A;  2YU1 A;  2K3W A;  1BR4 A;  5LB7 B;  4LF8 T;  2KWH A;  5AQI B;  3CKD A;  3ETU A;  1MMN A;  1HF8 A;  3PUZ F;  4PIR A;  4ZEY A;  4HEA A;  5J0Z A;  2VKO A;  2DL1 A;  4ZOL E;  4GYR A;  1FJG T;  2IC6 A;  2L3L A;  3N9N A;  5FVK A;  3F2E A;  4ZHQ E;  3RC3 A;  2W61 A;  4IDQ A;  4GK5 E;  5CGM A;  3F57 A;  4CZZ B;  2WAU A;  3FXD B;  3VRB A;  3P8C D;  3RYI E;  4ILA A;  1HCI A;  4Z8X A;  2ZM8 A;  1Z0P A;  5FY7 A;  5DQV A;  4WBO A;  3HKB E;  3T4M A;  2XQY A;  4LFB T;  2WS3 A;  4TZ4 C;  4UR9 A;  4UF0 A;  2XSA A;  3RKO A;  3UU8 A;  3OJA A;  3UQ7 A;  1BR0 A;  3HKD E;  4X1K E;  2B1E A;  2W0G A;  2JMK A;  3N2O A;  2LT3 A;  3K3N A;  3KFW X;  2CHN A;  4QX8 B;  4AFT A;  2FJB A;  2YIN A;  3CX8 B;  2CXD A;  5L3C B;  2WZH A;  3OBV E;  1J5E T;  4UV9 B;  2B76 A;  5AFM A;  2BR8 A;  4DV7 T;  3ZJ1 A;  2BVM A;  2NTY A;  2BR7 A;  2KMF A;  4ZK4 A;  5AQP B;  3EHZ A;  1UK5 A;  4BFQ A;  4QH5 A;  3Q5X A;  4DUZ T;  3OYZ A;  1DU2 A;  5F3J A;  1OED C;  4GK0 E;  2E9X C;  2XYS A;  5LMU T;  5LG3 A;  1W0B A;  4IDZ A;  4ILU A;  1WLX A;  4PK5 A;  4X1Y E;  4JI5 T;  2NTX A;  4IE0 A;  2YMD A;  4U7Y A;  2XQ7 A;  2CXL A;  1D1C A;  2BG9 E;  3WI3 A;  3C64 A;  4JI4 T;  5TAO A;  3FBL A;  3RKG A;  4ZZC A;  5HYA A;  4JLE A;  1KNR A;  4KHP T;  2YU2 A;  1HNX T;  5CB4 E;  1MNE A;  4YFS A;  5LBQ B;  2ODV A;  4MAL A;  1I9B A;  3C4W A;  4EEB A;  2Y58 A;  3C79 A;  4IT4 A;  3UUM A;  2V8S V;  2RP4 A;  3HR0 A;  2IC9 A;  2E5L T;  3CQC B;  3RQU A;  3N9O A;  3LDQ B;  2CA5 A;  4YTM A;  4WNK A;  5SYO A;  2LLY A;  4IE6 A;  5FVL A;  3JAE A;  2YK0 A;  4L0R A;  3PMZ A;  4IDP A;  2UXX B;  4K0U A;  3T1H T;  1I94 T;  2QRX A;  4ZJS A;  4ZJT A;  2OLT A;  1HR0 T;  2QYW A;  2YN6 A;  4IDN A;  3Q2M A;  1SUM B;  1LVK A;  1JNZ A;  1XWM A;  2UZ6 A;  2UXN B;  2LJL A;  4YT0 A;  5CA1 E;  2WBL A;  3ZN0 B;  5CO5 A;  2J4G A;  5J1G A;  5LXB A;  2E9X B;  2W62 A;  1UW6 A;  2H88 A;  2C5K T;  3IA3 A;  1IBL T;  3LBX B;  2BDE A;  4EGW A;  4DBQ A;  2K5B B;  3ZCI A;  2HH7 A;  3ZT6 A;  1X9B A;  1WRD A;  2JIW A;  3RLF F;  2WWV A;  2JQK A;  2V6X A;  3WTJ A;  4XZC A;  1U5P A;  5AFU L;  1LKX A;  4WV9 A;  4KUM B;  2DHR A;  3SOL A;  5HXC A;  2M67 A;  2Y57 A;  3ZDH A;  4EOZ B;  4UIG A;  5C2T A;  4ILC A;  2X9Y A;  3NRX A;  4ZK1 A;  4NPP A;  3HKE E;  2BG9 C;  2CLY B;  2YDQ A;  2HPJ A;  4EV6 A;  3Q5W A;  5ABE A;  2XTL A;  4HWH A;  4I4T E;  3MJX A;  1ZEE A;  4ILB A;  2BYQ A;  1XDP A;  1I6Z A;  5AQF B;  2XQ8 A;  3AEG A;  3KV4 A;  1ZP0 A;  2E5V A;  5AQJ B;  4O4H E;  4U33 A;  2XAJ B;  2Y7Y A;  2JPF A;  3QB5 K;  4H9Q C;  3TLS A;  2J62 A;  1QUU A;  2BBH A;  4IE5 A;  5AQU B;  2W2U A;  3LBX A;  2XZE A;  1HG2 A;  3ZEF B;  3G06 A;  4A56 A;  2WWU A;  3HL6 A;  2H7O A;  3AEC A;  4MHC A;  2V1D B;  5HXH A;  4LF5 T;  2XUE A;  5LNK A;  4Q25 A;  3Q9D A;  4EZH A;  4LFC T;  4TNV A;  3JAD A;  4IGU A;  3B57 A;  4WW0 A;  3KIN B;  3PUX F;  3P4S A;  4WZX A;  5LGU B;  3MK7 C;  4PFO A;  3T1Y T;  4QAA A;  1YQ3 A;  3PE0 A;  5J5H A;  4YHH T;  2E8I A;  3VRA A;  4ZZB A;  2WM9 A;  5HEH A;  2CCQ A;  4TNW A;  2WY2 A;  1UX5 A;  4UVB B;  4IRE A;  1W9R A;  4DV3 T;  4XK9 A;  5BW2 A;  4COF A;  2CBJ A;  1D0Z A;  4UM1 A;  2KZ7 B;  4YSY A;  4LFA T;  3JCF A;  1WYB A;  1VCT A;  3CK6 A;  5JQG E;  2Z6E A;  4QAB A;  2Y6X A;  2WU5 A;  1KNZ A;  5JRC B;  1HX1 B;  4H9S E;  4BA9 A;  4DO0 A;  2R6G F;  4UXN B;  1LVF A;  2H89 A;  2WQY A;  3PUG A;  4UM3 S;  2K24 A;  2XM1 A;  3PEO A;  4EXT A;  2LSY A;  4KI0 F;  3PUY F;  1VRB A;  4PJJ A;  2XM2 A;  3O1J A;  2JQ9 A;  2FJD A;  2YDR A;  3NBX X;  1Y64 B;  4D01 A;  3K3Q C;  4WYV A;  4OHF A;  2I0M A;  2OV9 A;  4ERR A;  2XQ4 A;  4ZI7 E;  4X65 T;  4A5X A;  1NAF A;  4P0B A;  1IJ5 A;  1KNP A;  2L8K A;  3ABV A;  2ZLY A;  2UUC T;  3AE7 A;  4PK6 A;  3LSV A;  3BQK A;  2BS4 A;  4L5G A;  1S35 A;  3RI5 A;  1VOM A;  3I9Y A;  5FL0 A;  4G63 A;  3VR8 A;  1XNR T;  2UU9 T;  5IWA T;  3RRC A;  2PFV A;  4YY3 T;  3IGQ A;  2UXC T;  3V5S A;  2Y48 B;  3VR9 A;  2SPC A;  1M7K A;  4YJ2 E;  3CQX C;  4KP3 C;  2WZY A;  3UUN A;  3ZJ2 A;  4AKI A;  2P9B A;  3RIA A;  2BS2 A;  2V7M A;  2XNT A;  2DWK A;  3N9M A;  5HXR A;  1N36 T;  2WSS V;  5KXJ A;  1N32 T;  3ZC0 A;  2HN1 A;  3ZYM A;  2LKG A;  1XMQ T;  2WMN A;  4UY2 A;  5GON E;  3WTI A;  4AQF A;  2X00 D;  3V5U A;  1Z8U A;  2IUB A;  5J2T E;  4ADZ A;  5FXW A;  1XZY A;  2DCF A;  3A8Y C;  5M4Y A;  3RIU C;  2A9U A;  4O4L E;  4UM3 P;  1IZN B;  2X00 A;  1CHU A;  3OYX A;  4QX7 B;  4PW8 A;  4O8S A;  5IUX A;  4X62 T;  2PJQ A;  2V7J A;  3KV6 A;  2KSR A;  5AFM B;  4UVA B;  4OFZ A;  3CX7 B;  2X67 A;  3C51 A;  2IHR 1;  4X64 T;  3X1D A;  3T8O A;  4QXH B;  4NXM T;  4PFP A;  1EZ3 A;  4H63 V;  3KBU A;  4O2A E;  3U8K A;  4DBM A;  5EK2 A;  2LOS A;  2X9W A;  1J1J A;  3N5L A;  1JNR A;  3PTR B;  2JRK A;  2BBJ A;  4H9P C;  1OXZ A;  3CX6 B;  1UUR A;  4HQP A;  5J5F A;  3FZK B;  5L47 A;  4U31 A;  5AQR B;  2XAQ B;  2Y56 A;  4CQI A;  4MFR A;  1D0Y A;  2XQA A;  2C5I T;  2A3D A;  3L3P A;  1W0A A;  4JI8 T;  2PTF A;  4ZI2 D;  4UVC B;  3ZT7 A;  2V26 A;  4UEL A;  4AQG A;  4YTN A;  3JC6 D;  2LHR A;  3AEB A;  3EAM A;  4DUY T;  2X0L B;  2BYN A;  3EUH A;  5AFJ A;  3AVR A;  4EZ4 A;  4F6R C;  5L4H A;  5LYJ E;  3H3A A;  2WDR A;  5FL1 A;  5ABH A;  5L3B B;  3QK6 A;  2VAS A;  5AFH A;  2VK9 A;  2XYT A;  4ASK A;  4CXY A;  4GKJ T;  4DR3 T;  5LBM A;  2YKS A;  1HNZ T;  3AA6 B;  1WYC A;  1B7T A;  5BRX A;  3BQI A;  1VCS A;  4YJ3 E;  1SA0 E;  3KV9 A;  2V7K A;  2LEH A;  3OPC A;  3DP7 A;  4AI6 A;  1T72 A;  5FXZ A;  3RF1 A;  5FY0 A;  4DR6 T;  3Q5E A;  2K48 A;  3KDS E;  4NXN T;  4IL9 A;  2XNU A;  3D0T A;  5HEU A;  4IHJ E;  5E0O A;  3OVU A;  2WP9 A;  2KLQ A;  1HG5 A;  2DLR A;  4OYK A;  3QC9 A;  4M1P A;  4HFE A;  5FY1 A;  3UUX B;  3AE2 A;  2CBI A;  1UCU A;  5A1L A;  5ADX L;  3ESL A;  1ZOY A;  5LA6 E;  3AB3 B;  4GKK T;  2WNC A;  4CN6 A;  4YSZ A;  4TX5 A;  4DID B;  2XAF B;  4I50 E;  3PJA J;  2IIU A;  4HE8 A;  2VB6 A;  3AE9 A;  4J2C A;  4MLK A;  5AQH B;  4EZ1 A;  4UM3 A;  3EI0 A;  4ZI3 D;  4DV1 T;  1HS7 A;  2LOP A;  3PJA A;  5AQT B;  2HPL A;  4YSX A;  5JR9 B;  2MTQ A;  4AQY T;  3LG7 A;  1G73 A;  3L8R A;  3N9Q A;  3PUR A;  1YW0 A;  4CI1 B;  3ZN1 B;  2CLY C;  2X66 A;  4ZS2 A;  5LGN B;  2J47 A;  5HWY A;  4DR2 T;  3J7Y q;  2LSK A;  2QA7 A;  3NZP A;  1N34 T;  5AQS B;  4DVD A;  1H7C A;  3AE4 A;  4TWF A;  2ZJU A;  3QB5 A;  4QWN B;  4YLH A;  3SFD A;  2EHO D;  2OA5 A;  5LP6 E;  4OYJ A;  2MYS A;  2J1D G;  4JI2 T;  3FHN A;  3M65 A;  4JI3 T;  2CXF A;  2EHO A;  2AE9 A;  5HEO A;  2YEV C;  2CWY A;  2BYS A;  3AE6 A;  2BKN A;  2CRB A;  1LRZ A;  4H9R C;  2LRK A;  5AFK A;  1MIV A;  3O1H A;  5H6Q B;  2UXB T;  4IE7 A;  3H37 A;  2HHH T;  3WAJ A;  3B5M A;  3AA7 B;  1L0V A;  2CE7 A;  1US7 B;  4Z91 A;  4K0K T;  5JR9 A;  3RYH E;  2AXD S;  3P7I A;  4GOU A;  3FZH B;  5IHY A;  2QVA A;  4XBF B;  3AAI A;  3PU3 A;  4AKL A;  1W09 A;  4AXP A;  1MIY A;  5AIN A;  2XHE B;  3ZKR A;  4FJO A;  4HWD A;  5HXE A;  1KF6 A;  2FBW A;  3EVY A;  3VKG A;  5JVD E;  2MOZ A;  4DMW A;  2Q9Q D;  5DQW A;  1UV6 A;  3PUS A;  4GYS A;  5LJN A;  3KV5 A;  3ANW B;  3MAC A;  2UUA T;  1M62 A;  4DR7 T;  3UTK A;  2Q9Q A;  3O1I A;  4JV5 T;  3WTL A;  2A72 A;  4XAX B;  2W63 A;  3UT5 E;  2W66 A;  4Z90 A;  2X9H A;  4U74 A;  2Y54 A;  4DV5 T;  4ANJ A;  5IYZ E;  4U7I A;  3WTN A;  3TKL B;  4L9I A;  5KX5 E;  2FJA A;  4BJM A;  2IML A;  5H6R B;  5KDM C;  3SRZ A;  1HFA A;  4A97 A;  5TVC A;  2WNJ A;  4CN1 A;  2N9D A;  3ZMS B;  3HA4 A;  4PNI A;  2V5C A;  1WFD A;  5C8Y E;  5FXV A;  2C5J A;  2ZM2 A;  4IDO A;  2UXD T;  2XZ5 A;  5KMG P;  4DV6 T;  3N9P A;  3RYC E;  2MPK A;  3RRW A;  1NWM X;  2K9A A;  5J5I A;  3FBZ A;  3ZLI A;  4G2A A;  1Y01 A;  2D5U A;  3SIO A;  2BKO A;  4C91 A;  4TUY E;  1FIO A;  2H7V C;  2WCA A;  3WIP A;  3PUA A;  3AEE A;  2LSG A;  4JUY A;  2ZM0 A;  3GN5 A;  3P50 A;  2XSB A;  2XQ5 A;  4HFD A;  4FRR A;  4X5T A;  2V6Y B;  2NWB A;  1FMW A;  1HX8 A;  4U3C A;  3ANW A;  2KT9 A;  1D1A A;  3RX6 A;  2BYP A;  5AQL B;  4AKR B;  4EYU A;  2CEA A;  2E2A A;  2ZJV A;  3LFM A;  4O2B E;  2XQ3 A;  2LRL A;  2JMH A;  2LE8 A;  4OK0 A;  4HTE A;  3RC8 A;  3CPZ A;  3U8N A;  4JI6 T;  4ZI2 C;  5HEG A;  4HFC A;  4F8H A;  4JEU B;  4PJL A;  1QLB A;  2W4X A;  1YKH B;  2WDQ A;  3JC6 C;  1YXR A;  2ES0 A;  4P09 A;  4HGA A;  4BJN A;  2ZM6 T;  4P1N A;  4QH1 A;  2WMO A;  5LMN T;  1UUS A;  4CXX A;  2V7L A;  2CWO A;  5AQK B;  2LKH A;  5EZY E;  5C3J A;  1XDO A;  3I0O A;  3ZMV B;  3P4Q A;  3KVA A;  5HCJ A;  4EIW A;  1IJ6 A;  3C84 A;  4LF7 T;  3I0Q A;  3UU4 A;  3K1S A;  4OX9 T;  3CQG B;  2NP9 A;  3E22 E;  2W00 A;  5CJ5 A;  2A2F X;  2V6Y A;  5ABG A;  1MMD A;  2LM2 A;  2XQ9 A;  2KIN B;  3NRY A;  3P4R A;  1HNW T;  2X0Y A;  5L4E A;  2DI4 A;  3FZF B;  4AKG A;  3BQL A;  3HKC E;  5FYM A;  3GMI A;  2MAW A;  3QOF A;  4AIU A;  2Y8D A;  5FKY A;  5ABF A;  4BQT A;  1MND A;  3R84 B;  2WZI A;  5LCY A;  2NW9 A;  4LF4 T;  2N1G A;  1UGO A;  4U2Z A;  5LHI B;  2XAS B;  4NIQ A;  4ZI3 C;  4JI7 T;  4O4J E;  3QNU A;  1YQ4 A;  3AE1 A;  5JDH A;  2W8F A;  4I0U A;  4B3R T;  1S94 A;  2H3R A;  3K8P C;  5L3G B;  1IBM T;  1V9D A;  4AIS A;  3ZMU B;  4U72 A;  4NUU A;  4DMV A;  4PK4 A;  3ZPO A;  2D9D A;  4UEM A;  2HN2 A;  4O4I E;  3PUV F;  2C0S A;  1G8X A;  1ZHC A;  4KX6 A;  4V1A v;  1NEK A;  4LMK A;  2C9T A;  1FEW A;  2VKJ A;  4XHE A;  5JDQ A;  3LK4 2;  2CHO A;  1T7S A;  2BJ0 A;  2EHO C;  5BMV E;  3KVB A;  4KHZ F;  1QSD A;  1KFY A;  4UV8 B;  3IEE A;  3UU3 A;  3CML A;  4QXB B;  3AA1 B;  5J2U E;  1UX2 A;  4B3T T;  4TV9 E;  3C50 A;  2RPA A;  4TWH A;  3J9X 1;  2I6H A;  4EAH A;  1GQE A;  1NEN A;  3HI2 A;  2X0H A;  2M6I A;  3MXZ A;  3AAA B;  1HTJ F;  3ONJ A;  5L3D B;  2PG8 A;  2DNX A;  2YOE A;  3I1A A;  2MBG A;  4EYY R;  5AQV B;  4JYA T;  5JR9 C;  1UX4 A;  3U8L A;  3RGL A;  1YKE B;  3AA0 B;  5AFL A;  3N9L A;  2X68 A;  4ZXL A;  2M6B A;  2VWA A;  4ZR6 A;  4TV8 E;  2X51 A;  2WDV A;  4HN9 A;  3EDV A;  3EAB A;  4ZRU A;  3MZK B;  2VQF T;  3AEA A;  3SQ6 A;  2VKD A;  1ZKE A;  1WR6 A;  2NW8 A;  3RH3 A;  4HFB A;  3N2G E;  4X20 E;  3O9X A;  4I55 E;  3PUW F;  2Q9Q C;  3RPU A;  4CI2 B;  3I9W A;  3ETV A;  2WN9 A;  4B6X A;  3SWH A;  3DTO A;  4YXD A;  1IBK T;  2EHO B;  3ONL C;  4QHO A;  5EK3 A;  3RIF A;  2CPT A;  4QXC B;  3GUA A;  3PU8 A;  3P4P A;  5HCM A;  3K3O A;  5FNV E;  2JJ9 A;  2XPK A;  4N78 D;  1N33 T;  5L3E B;  3UQ4 A;  3AE5 A;  5AQG B;  2IDO B;  2GK9 A;  4PJN A;  5LJM A;  2LHN A;  2IAK A;  2VL8 A;  5DAB A;  3ZC1 A;  4X66 T;  3AE3 A;  2VL0 A;  4IE4 A;  4U2Y A;  4P0A A;  4YHJ A;  3WTO A;  3P4W A;  3ZCJ A;  3WTH A;  4WBN E;  3JAF A;  4EED A;  2XY8 B;  5L2L A;  3PUQ A;  2L9Q A;  3WTK A;  2KXP B;  3RIU A;  3IBP A;  2ZMA A;  5KZU A;  5HAX A;  4C90 A;  5CA0 E;  2KND A;  4IIJ E;  2YDS A;  5JTG A;  2BVL A;  2VVN A;  2ODU A;  4DV0 T;  1BR1 A;  2Q9Q B;  4JBW F;  4DR4 T;  1WCR A;  4LF6 T;  3ZYK A;  4AFH A;  2VUR A;  3AEF A;  4JI1 T;  3SQ9 A;  1OED B;  2JQQ A;  3VKH A;  3UU6 A;  1XNQ T;  5AFN A;  3NWI A;  2PH9 A;  5JRE A;  1KEY A;  5LHG B;  3ZDG A;  3A7M A;  3FZL B;  3MKD A;  3U78 A;  5FJV A;  3TLT A;  1J5W A;  3ZMT B;  4PJM A;  1MMG A;  3VHL A;  1AJ3 A;  4LMJ A;  3IF8 B;  3PV0 F;  2RA1 A;  2YME A;  3UFE A;  2WB5 A;  2VVS A;  2DWG A;  4FI5 A;  3L39 A;  4ZS3 A;  1D0X A;  2CMR A;  5FXX A;  3GN5 B;  1U4Q A;  3ZYL A;  2W8G A;  4KMC A;  1R8I A;  5L3F B;  3C98 B;  3DJB A;  4H9O C;  5CFB A;  3CWZ B;  5HWX A;  3OTO T;  3U3I A;  3CIR A;  4NUV A;  2BS3 A;  1CUN A;  3AXJ B;  3WAK A;  5LGT B;  3UFG A;  4AQF C;  2E9X D;  2LM9 A;  4DND A;  5LG4 A;  2PGZ A;  1BR2 A;  4AKH A;  2WNL A;  2XAG B;  1OED A;  1ZV4 X;  5HXS A;  3UUB A;  2ACZ A;  3GWH A;  1SE7 A;  2E9X A;  4QKN A;  4TN7 B;  4CN4 A;  4HKA A;  3LK2 B;  3PDY A;  4BAY B;  3ONX A;  5JDG A;  2ACX A;  4I43 B;  1E2A A;  1MIW A;  2VQE T;  3RYF E;  4H9N C;  5J5G A;  4B3S T;  3AAE B;  5FP3 A;  2XJ7 A;  4CXW A;  1T8B A;  3FZM B;  4EB6 E;  3SH1 A;  2UUB T;  3TLW A;  4JI0 T;  2LSJ A;  4DV4 T;  3EDU A;  5F8P A;  5ETW A;  3UUL A;  1E7P A;  1E1H B;  2XZ6 A;  3NKZ A;  4H63 H;  1XMO T;  3FB2 A;  4DR1 T;  2WU2 A;  5LXT E;  3B13 A;  5AQO B;  3ZMZ B;  5AQN B;  4B3M T;  2X9X A;  4HWF A;  3M3Z B;  2BG9 B;  4HWI B;  3SFE A;  4ALX A;  2V5D A;  3L09 A;  5JDM A;  3IHR A;  3AXJ A;  4X1I E;  2KWI B;  4HFV A;  3O4X E;  4DBR A;  1OWA A;  5ABF B;  1KK7 A; 
#chains in the Genus database with same CATH homology
 4HFE A;  5HEH A;  4A98 A;  4HFB A;  3UU8 A;  2LKH A;  5AFK A;  4TNW A;  2Y58 A;  5HEJ A;  4HQP A;  3C79 A;  5J5F A;  3UQ7 A;  2XZ5 A;  3TLV A;  4IRE A;  4ZK1 A;  5L47 A;  2WNC A;  4NPP A;  4XK9 A;  5BW2 A;  2WN9 A;  4COF A;  2WZY A;  2PGZ A;  2BG9 C;  4UM1 A;  5J5I A;  2WNL A;  4AFG A;  5HCJ A;  3RQU A;  4LMK A;  3C84 A;  2C9T A;  1OED A;  2Y56 A;  4AFH A;  3UUB A;  4AFT A;  3RIA A;  4XHE A;  1OED E;  3WTM A;  2XNV A;  4QAB A;  5SYO A;  2XQA A;  2LLY A;  2XQ6 A;  2XNT A;  2BJ0 A;  3UU4 A;  5BP0 A;  3SIO A;  4Z91 A;  4ILB A;  1OED B;  2BYQ A;  3JAE A;  3SQ9 A;  4EZ1 A;  3UU6 A;  3RIF A;  3PMZ A;  4UM3 A;  3EI0 A;  3WIP A;  5AFM A;  5AFN A;  2XQ8 A;  2BR8 A;  4ZJS A;  3UU5 A;  2PH9 A;  4ZJT A;  3GUA A;  4TWD A;  3P50 A;  2BYR A;  3U8J A;  2LM2 A;  2BR7 A;  2XQ5 A;  2XQ9 A;  2YN6 A;  2LKG A;  3RQW A;  3UU3 A;  4HFD A;  3ZDG A;  3EAM A;  4HFI A;  5HCM A;  4FRR A;  2BYN A;  4ZK4 A;  4X5T A;  4UM3 S;  4LML A;  3PEO A;  4UXU A;  5J5G A;  3EHZ A;  1UX2 A;  4UY2 A;  3WTI A;  5AFJ A;  4TWH A;  4BFQ A;  2X00 D;  5L4H A;  4QH5 A;  2Y7Y A;  2UZ6 A;  4NZB A;  5FJV A;  4QH4 A;  4HFH A;  5L4E A;  5AIN A;  3TLS A;  3TLT A;  3U8M A;  3RHW A;  5JME A;  3SH1 A;  3UQ4 A;  3ZKR A;  5CO5 A;  2M6I A;  3TLW A;  5LXB A;  4UM3 P;  4D01 A;  1UW6 A;  4LMJ A;  2QC1 B;  2X00 A;  5AFH A;  2MAW A;  1OED C;  2BYP A;  2XYT A;  4PIR A;  1UV6 A;  2YOE A;  5IUX A;  2XYS A;  5J0Z A;  2XQ4 A;  5LG3 A;  2YME A;  2KSR A;  2ZJV A;  5AFM B;  4QAC A;  2XQ3 A;  4BQT A;  2XZ6 A;  3U8L A;  4TWF A;  2ZJU A;  2W8G A;  2YMD A;  2VL0 A;  2YKS A;  5AFL A;  3WTL A;  2XQ7 A;  5KE4 A;  3WTO A;  3P4W A;  4TNV A;  2BG9 A;  3WTH A;  3JAD A;  5BRX A;  3LSV A;  3JAF A;  3U8N A;  2BG9 E;  5CFB A;  4Z90 A;  2Y54 A;  2M6B A;  3RI5 A;  4ZR6 A;  2BG9 B;  4ZZC A;  5HEG A;  3WTJ A;  4HFC A;  3WTK A;  3WTN A;  4ILA A;  4ALX A;  4F8H A;  5HEO A;  4QAA A;  4B5D A;  4WV9 A;  3U8K A;  5KZU A;  4ZRU A;  4A97 A;  4IL9 A;  2XNU A;  3T4M A;  4DBM A;  4QH1 A;  2W8F A;  2BYS A;  5TVC A;  2Y57 A;  5HEU A;  2WNJ A;  3SQ6 A;  3ZDH A;  5J5H A;  3TLU A;  4IL4 A;  1I9B A;  3IGQ A;  4ZZB A;  4ILC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...