2XQ9A

Pentameric ligand gated ion channel glic mutant e221a in complex with tetraethylarsonium (teas)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYDANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 85
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq9A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq9A01
5KZUA 2BG9A 2ZJUA 3PEOA 4HFCA 2YMDA 4EZ1A 3JADA 2YKSA 2BG9E 5AFMA 5J5FA 2XQ9A 4UY2A 4TWDA 3UQ7A 4HQPA 3RHWA 1UV6A 3WIPA 4HFBA 3U8MA 2Y57A 3JAFA 4NZBA 3SQ6A 2W8GA 2LM2A 3RI5A 1UX2A 4ILAA 3TLSA 1OEDC 4PIRA 2Y56A 5AFJA 3P4WA 4XK9A 4XHEA 3WTHA 2X00D 4F8HA 5J5HA 4TNWA 2YMEA 4UXUA 1I9BA 3U8KA 3WTNA 3U8JA 3C79A 2BG9C 5J5GA 5HEJA 4QH1A 4QAAA 2BR7A 2WNJA 2XQ6A 5HEUA 2C9TA 2WN9A 2M6BA 5TVCA 4BQTA 5AFKA 2XQ4A 4HFEA 3TLUA 4LMJA 5LG3A 2XQAA 2BYNA 4ZJTA 3WTLA 2XQ5A 4TNVA 4A97A 5SYOA 4ILCA 2XNTA 4HFDA 3EHZA 2MAWA 1OEDB 2BJ0A 2X00A 2Y7YA 4ALXA 4HFHA 4LMLA 3UU5A 4AFHA 5BP0A 2BR8A 2BYRA 4Z90A 3GUAA 2XQ7A 2UZ6A 3SQ9A 3SIOA 2QC1B 3UUBA 4ZZCA 2XYSA 4QH5A 5L4HA 2BG9B 4QABA 2BYPA 4ZR6A 3T4MA 3WTJA 2LLYA 3RIAA 3UU4A 4BFQA 2Y58A 2KSRA 5L4EA 2PGZA 4IL9A 3TLTA 4Z91A 3ZDGA 4ZJSA 3WTOA 4COFA 3UU8A 2WNLA 2XZ5A 5HCJA 3C84A 4ZK4A 2XNUA 5HEGA 4WV9A 2M6IA 2XQ8A 2YOEA 2XZ6A 4ILBA 4DBMA 2Y54A 5FJVA 2XQ3A 5BW2A 3ZKRA 1UW6A 3SH1A 5J5IA 4UM1A 3ZDHA 2VL0A 3EI0A 5J0ZA 5HEHA 5HCMA 3TLWA 5AFHA 2WZYA 1OEDE 3UU6A 4FRRA 2XNVA 4AFGA 5AFMB 2XYTA 2BYQA 4NPPA 4QACA 4D01A 3JAEA 3RIFA 2LKGA 4ZZBA 2BYSA 3UQ4A 5L47A 5HEOA 4A98A 3U8NA 5AFLA 3TLVA 4ZRUA 4QH4A 4LMKA 4AFTA 5LXBA 3UU3A 2W8FA 4UM3S 2LKHA 5IUXA 2ZJVA 5CO5A 3WTIA 5JMEA 3U8LA 5AINA 2YN6A 4IL4A 3RQUA 5BRXA 3WTMA 5KE4A 5CFBA 3EAMA 4UM3P 4IREA 4ZK1A 4UM3A 1OEDA 4B5DA 2WNCA 3IGQA 4TWFA 2PH9A 5AFNA 3P50A 3PMZA 3LSVA 3WTKA 4X5TA 3RQWA 4TWHA 4HFIA
chains in the Genus database with same CATH superfamily
2CXDA 4E7ZA 2BKOA 4AKHA 1WYCA 4GOUA 2XHEB 2D2SA 2W0GA 3WI3A 3O1IA 3ZMUB 5AFJA 3ETUA 5JQGE 4EGWA 2DNXA 4EZ4A 3IF8B 4HFVA 2H3RA 3RC8A 1J5WA 3NRXA 5J5GA 4TUYE 4AQFA 3KDSE 1XZYA 5FXVA 4WZXA 2W2UA 2CHOA 4H63V 4ZJTA 1M7KA 2DL1A 1UX5A 3LBXB 3TKLB 2WMNA 3RYIE 3UUBA 3N9OA 4YSYA 5L4HA 4DUZT 3N9MA 3L3PA 1WRDA 4IL9A 2P9BA 3ZDGA 2K9AA 5FY0A 2MTQA 5F8PA 2XNUA 2Y48B 2HN1A 4IE6A 5FJVA 3UUMA 3IA3A 4O4IE 3OVUA 4HWHA 4GYRA 2VVSA 4BA9A 3RIFA 5IYZE 4LF6T 4UV9B 5AQVB 4ZRUA 4XAXB 4KP3C 2EHOC 2Y6XA 1X79A 2CBIA 3RQUA 3ZT7A 2UXCT 2V6YA 2V7MA 4YLHA 4IREA 2SPCA 4L0RA 2JMKA 3LSVA 3RYCE 3WTKA 4K0UA 5ABGA 4ZI3D 2WB5A 5AQOB 4X20E 4JLEA 2Y57A 2W8GA 2LSGA 5LYJE 1FEWA 5C2TA 1WR0A 5LNKA 3DP7A 2MPKA 4KBMB 4PK5A 2N2NA 1KNZA 2X9YA 5AQUB 5LMNT 1GQEA 3CX6B 3AEFA 2V5CA 3UU5A 1MMDA 1YW0A 3C98B 4P0BA 2XQ7A 3GUAA 3VKHA 4QABA 3AVSA 4NXMT 4OX9T 1N34T 2PGZA 2C5IT 2VKHA 4WNKA 3UFGA 3RIUA 4IHJE 2M6IA 5JDGA 4PW8A 5E0OA 3FZMB 1D1CA 3SS1A 3P4PA 1W0BA 3Q5XA 3PUYF 3ZDHA 4K0KT 1BR2A 4QXHB 1E1HB 2JQQA 3B13A 1HFAA 2XASB 3U8NA 5HEOA 5AFLA 2OLTA 5M4YA 3VU7H 3CVRA 5IUXA 2CA5A 1V9DA 5JMEA 2G0UA 5KXJA 4MFRA 3K3QC 2NP9A 4HFCA 1UX4A 3KINB 3ZPOA 3AEEA 3HKEE 1J5ET 3NVOA 3RI5A 2X51A 2DI4A 4PIRA 2Y56A 4DUYT 1XDOA 3V5UA 5AQQB 2XJ7A 3L39A 2JPFA 4OYKA 4LF4T 4UV8B 5BMVE 4UELA 4ILCA 2XNTA 2EHOA 2BJ0A 2K5BB 4HFHA 4IGUA 3AEDA 2K24A 5AQKB 3VRAA 1CUNA 2LJLA 1O3XA 5FVLA 2BVMA 4WBNE 4CI3B 4DR7T 4ZK4A 5HEGA 3CPZA 2XQ8A 3L8RA 3N9NA 3O1JA 2IC6A 2J4GA 4DV0T 3EI0A 3AE2A 1LVFA 4ZI3C 3UU6A 1CHUA 2WY2A 2UUBT 4CI1B 3FXEB 4J2CA 4LFAT 4EV6A 2XYTA 2W67A 4QKNA 4JEUB 4DV2T 2WS3A 3T1YT 3P4RA 3UTKA 1OWAA 4DV1T 3AA1B 3FZHB 2PBIA 2KMFA 4TWFA 4UF0A 3AXJB 1XMOT 2Q9QD 4X1IE 4PFOA 5FNVE 5KZUA 4X66T 3Q5DA 2YKSA 2LEHA 1HG5A 4UY2A 4B6XA 4PAGA 5L3FB 1WR6A 4AKLA 2LM2A 4YTMA 5AQIB 2LM9A 5HXCA 5L3DB 5DJQC 2KXPB 3N9QA 3R6NA 3ZEFB 3CX8B 3P4WA 5JDQA 4EEBA 2E9XD 4I43B 3M65A 2AXDS 4MLKA 2CRBA 5JDFA 3AVRA 1UURA 4G63A 4YXDA 5JRCA 5J2UE 2M6BA 2OA5A 3RYFE 2XQ4A 2JJ9A 4EIWA 4C90A 4ZS2A 3G06A 2BYNA 2BDEA 4KHZF 2D5UA 5LHGB 5HXEA 3MZKB 1UGOA 5LXTE 3FXDB 1YD8G 4ZXLA 2JQHA 2WBLA 2BS2A 4O4JE 4ZI2D 4PJNA 4BAYB 4LF9T 5HXSA 5CJ5A 2XZ6A 3RF1A 3OYZA 3OTOT 3PUWF 2WZIA 3A8YC 4ERRA 2ACXA 5FL0A 5JR9B 5LGUB 3AA7B 1NAFA 2IC9A 2WCAA 2ZM2A 5JREA 2B1EA 3IBPA 2A2FX 2XZEA 5FMNA 5JDHA 3ZMTB 4BJNA 2DHRA 2H88A 2CMRA 2I6HA 3ZSSA 4JI4T 2HH7A 3W15B 4ZK1A 1WCRA 5CA0E 3P4QA 1NEKA 1N32T 2CLYB 2VKOA 2NW9A 2MYSA 4NXNT 2OV9A 2XM2A 4ILAA 2Y8DA 2CHNA 4IDOA 4YTNA 2YMEA 4MBQA 2LSKA 2E5VA 3AAEB 4BQTA 3I0OA 3UUXB 2IIUA 1B7TA 1T8BA 2XAGB 3CMLA 5DQWA 4KMCA 3ZJ1A 3RIAA 5AQRB 1WLXA 2DWKA 2KSRA 3C4ZA 2PG8A 2LOPA 3E22E 3A5XA 2WQYA 2XM1A 4TZ4C 3PUZF 5AQMB 5J5IA 2Q9QC 3VR9A 1OEDE 2ACZA 3JAEA 2LKGA 1MMAA 4ZEYA 2V8SV 3QK6A 2W00A 3K1SA 2L8KA 5AQPB 4X1YE 2V7LA 3ZMVB 2LKHA 4PJLA 2R6GF 2E9XC 1MMGA 3AB3B 3FBZA 5EK2A 4UM3P 3WAJA 1OEDA 4HGAA 4IDNA 4DMWA 5LCYA 2FBWA 5KMGP 4Q25A 4UVCB 2WDRA 2JRKA 2VKJA 1YQ3A 2WSSV 2V26A 2ODUA 1UX2A 4UR9A 1D0ZA 3AEAA 3C79A 1HF8A 5BR8T 2C9TA 4KX6A 2ZM0A 2XQAA 3AE9A 1HS7A 3U3IA 4E7SA 4PK4A 3GN5A 5C3JA 3PU3A 4CQIA 4EEDA 3T4MA 5DABA 2CE7A 4IE5A 3GWHA 2XZ5A 3N2GE 5HCJA 1SE7A 1FJGT 3AE4A 4IDPA 4YT0A 2W4XA 4IE0A 4U7YA 4MHCA 5AFHA 3OPCA 5JRCB 5ABFA 4AFGA 4DMVA 3Q9DA 1HX8A 1IAPA 5LBQB 3CK6A 4IL4A 4LF7T 4CI2B 5LBMA 3HA4A 3KV9A 1WFDA 3OYXA 1IBMT 3FZLB 2B76A 2WMOA 3K8PC 2D0TA 2J1DG 4WBOA 2BG9A 2ZJUA 4EZ1A 2YMDA 5AFMA 5J5FA 2XQ9A 4U31A 3ANWA 3SOLA 3H3MA 4G2AA 5EK4A 2Q9QA 4DV5T 2CCQA 4EOZB 3NBXX 1JNRA 4B3RT 4JUYA 1NENA 2BZBA 2PFVA 3C4WA 2QYWA 3HKCE 1YQ4A 2C0SA 2Y7YA 2E9XA 4IDQA 3KFWX 5BP0A 1QLBA 4Z90A 2RPAA 4QH5A 5CA1E 2KNDA 5LOVE 4YJ2E 4O4LE 4BFQA 5L4EA 1HCIA 4L9IA 1XMQT 4GK5E 5BW2A 3B57A 2N1GA 1R8IA 2NTXA 1D0YA 3F2EA 2E2AA 5LHIB 1VRBA 2QRXA 3BK9A 2ZM8A 3UQ4A 3IHRA 5L47A 2M67A 3ZT5A 3ZN0B 2BS4A 4QH4A 3BQIA 4UM3S 5AQGB 1DU2A 3LK3B 5JDLA 5KE4A 2LSIA 3N2KE 2L9QA 3QB5K 5CB4E 2IHR1 3QUJA 4TN7B 4EB6E 4U33A 4X5TA 3AE5A 3VHLA 4DR1T 4P1NA 4JI1T 2CM0A 4YTPA 4HTEA 4HQPA 3P4SA 2VB6A 5FXZA 4DR5T 5KDMC 2LE8A 4JI5T 4HWIB 3PV0F 4TNWA 4UXUA 5AQNB 1ZP0A 3WTNA 1UK5A 3P7IA 3TLUA 2VL8A 3E0ZA 4ADZA 3GMIA 4TNVA 3NWIA 1OEDB 4ALXA 1VOMA 2YDSA 4XBFB 4O4HE 4CN6A 4XZCA 2XSAA 4AI6A 2XAJB 1ZKEA 1IBKT 2XY8B 3C84A 2A9UA 2ODVA 3KVBA 3J7Yq 2XTLA 5GONE 3ZMSB 3AEBA 4B3ST 3RLFF 4PK6A 3EDUA 4UM1A 3O9XA 2IUBA 4UEMA 5LG4A 4GYSA 4D01A 4NPPA 4CXXA 2VASA 4TV8E 1L0VA 4X62T 1SUMB 2PTFA 2HN2A 1SHZC 2KWIB 3I1AA 5AFNA 3GA8A 2ZM6T 4DR4T 4DO0A 2K48A 3JADA 3N5LA 4L5GA 4NUUA 4AQYT 3UULA 4HFBA 3BQLA 2ZMAA 3PURA 4EZHA 1EZ3A 2NOXA 2WDQA 1U4QA 4U7IA 4O8SA 3ZSTA 2CPTA 1QUUA 4UVBB 4QH1A 2XQ6A 4P09A 5TVCA 5AFKA 2BBHA 3PJAJ 5J1GA 2QVAA 2XQ5A 3HKDE 4A97A 3EHZA 3KBUA 3H37A 3SWHA 5J2TE 4Z8XA 4EYYR 2BG9B 3PUSA 3WAKA 3NZQA 4DV3T 3TLTA 1LVKA 2IDOB 3WTOA 4U2ZA 4WV9A 1VCSA 1N36T 2Y54A 4YY3T 2V6YB 3ZKRA 3VR8A 3A7MA 2X67A 3TLWA 2JQ9A 2CXLA 3LBXA 5L3BB 5A1LA 1KF6A 5AFUL 1XNQT 4DV6T 3CQGB 2D0UA 4H9OC 2KT9A 3U78A 3I9WA 2ES0A 2CXFA 5AQHB 1W09A 4MALA 3LDQB 4CZZB 2V7KA 5TAOA 1HR0T 2YN6A 1KNRA 2AE9A 4JI7T 4OK0A 4UM3A 1YKHB 3PMZA 2X9HA 4M1PA 2XAHB 2XAQB 4AIUA 1FMVA 2CWYA 4OYJA 3JAFA 3ZYLA 5HYAA 2VK9A 3PUVF 5CGMA 4ILUA 2X9WA 2I0MA 2LSYA 3PTRB 5ABHA 3PUAA 2JMHA 3FB2A 2BR8A 2XPKA 5AQJB 2UZ6A 2NW7A 2X68A 4ZR6A 3FHNA 1HG2A 2Y58A 1FIOA 4AKIA 4QX7B 4ZHQE 2FJBA 2KWHA 1ZHCA 2LHRA 4ILBA 4ISTA 4V1Av 5L3CB 1Z0PA 4KHPT 5LB7B 2WZYA 5HXHA 5JH7E 3OJAA 3PE0A 4HEAA 2BYQA 3RGLA 2YU1A 2Z6EA 3FBLA 3X1DA 2WWUA 2VWAA 1T7SA 2VQFT 3QB5A 2NTYA 4DV4T 2NWBA 4JI3T 2CWOA 3UUNA 3KVAA 4KI0F 4I4TE 4PJJA 5LJNA 2PH9A 3PDYA 4JI0T 3JCFA 3NZPA 3RKGA 2F4VT 1MIWA 2EHOB 3FZKB 3U8MA 4H9NC 3P8CD 4NZBA 4O2BE 2N9DA 2LHNA 5AQTB 3EUHA 4OHFA 2W66A 5J5HA 2VKDA 3O1HA 5FVKA 5HEJA 3HI2A 4WYVA 4YFSA 3KV5A 2A72A 4LMLA 3SQ9A 2QC1B 3ONLC 2X0LB 4A5XA 3OKQA 1XNRT 4DR6T 1JNZA 4JYAT 3K3OA 5JR9C 2DLRA 3KBTA 2XAFB 1Y01A 4DBRA 4DBMA 2YDQA 4I0UA 4U74A 5AQLB 3ZCJA 3I9YA 5FXXA 4UF0B 5HCMA 3Q5WA 3LK42 4UIGA 3AE8A 4QACA 2W62A 1MNEA 4H9PC 3VRBA 2CLYC 4LMKA 4NIQA 3F31A 4O2AE 2ZJVA 5CO5A 2IAKA 1H7CA 5JDNA 3AEGA 1MMNA 1ZEEA 5FXWA 1T72A 2K3WA 2LOSA 3PEOA 3LFMA 2BG9E 3MK7C 2UXDT 5H6RB 5ABEA 5DQVA 3UQ7A 1UV6A 4C91A 3SQ6A 4JI2T 3CKDA 2J47A 4AKRB 1IZNB 4QWNB 4WW0A 4F6RC 4YHJA 4F8HA 4IDZA 3H3AA 2WU5A 3BQKA 3U8KA 3U8JA 1U5PA 3AXJA 3C50A 3MA9A 3NKZA 2C5JA 3WTLA 4JEHB 3T1HT 3D0TA 3DJBA 4ZOLE 4FI5A 3ZCIA 3C4XA 4H63H 2BVLA 3ZJ2A 2FJAA 4DIDB 1G8XA 1Z8UA 2WZHA 2PJQA 1LKXA 3UU8A 1X9BA 4X1KE 3T8OA 3JC6D 4U3CA 3AA6B 2E8IA 3SFEA 2YDRA 1M62A 2BS3A 4ISSA 4FRRA 2UUCT 5LJMA 4ZI7E 3HR0A 1US7B 5JTGA 1I6ZA 3DTOA 3QOFA 4PNIA 3TLVA 2HHHT 1T98A 1HNXT 2UU9T 3WTIA 1LRZA 1UCUA 4TV9E 3EDVA 5IWAT 1KNPA 4AISA 4UXNB 4QHOA 4BJMA 2WNCA 3IGQA 2E5LT 4TWHA 5LXBA 4IT4A 5FY7A 4GKKT 3HL6A 3B5MA 2BKNA 3LJCA 5JR9A 5HXRA 2WWVA 5LHHB 3EVYA 2W61A 1W0AA 3N9LA 1WYBA 2I59A 3WTHA 4XHEA 2X00D 3KV4A 1I9BA 1YKEB 4YJ3E 3RX6A 3PUXF 4GK0E 1QSDA 2FUPA 5IHYA 2YINA 2WN9A 5LMUT 3F57A 5F3JA 3M3ZB 4LMJA 4HFDA 2X0YA 5FYMA 4U72A 2X66A 4EAHA 4DR2T 2V7IA 4QXBB 2W63A 2KZ7B 1IJ6A 2FJDA 3Q2MA 3LK2B 3ZC0A 2NW8A 4Z91A 2YK0A 3N9PA 3UT5E 2WM9A 4YSXA 3UFEA 3SRZA 3V5SA 3L09A 1UUSA 5J0ZA 1D1AA 3CX7B 4YSZA 1KEYA 3ZMZB 5KX5E 2DCFA 2X0HA 4DVDA 3PUQA 5L3GB 2YEVC 3S4UA 2QGSA 3RPUA 4DBQA 4IE4A 3U8LA 1OXZA 5BRXA 2VURA 4QXCB 2RP4A 2V7JA 5LA6E 4P0AA 4ASKA 3CQCB 2WU2A 2UXXB 3KV6A 3RQWA 3AE6A 4IE7A 3MACA 1KK7A 4CN1A 1HNZT 1AJ3A 3TLSA 3GN5B 1BR0A 5EK3A 4QAAA 3I0QA 2C5KT 2BR7A 4U2YA 3JC6C 5HWYA 4JI6T 4HFEA 2DWGA 5HAXA 1I94T 2CBJA 5LG3A 3RRCA 1N33T 2IW5B 2H7OA 1E7PA 4ZS3A 2GK9A 4JI8T 3MXZA 4TX5A 1HX1B 5ABFB 3J9X1 5JVDE 1E2AA 1KFYA 3WTJA 2V6XA 3K3NA 3ABVA 2LLYA 3UU4A 3Q5EA 4YHHT 3AECA 1XDPA 4ZJSA 4I55E 1Y64B 4COFA 2WNLA 2BBJA 2YOEA 3ZLIA 2JIWA 2XQ3A 3IEEA 3AE1A 3SH1A 3MKDA 2A3DA 4LF5T 3NRYA 4HKAA 3QC9A 1G73A 1D1BA 4H9QC 5L3EB 2XNVA 5AFMB 4DR3T 3AAAB 4AXPA 3AAIA 2UXNB 1BR4A 4ZZBA 3ANWB 4GKJT 3PUGA 4HN9A 2WP9A 5FL1A 3O4XE 4HWFA 2VVNA 3ETVA 4HWDA 3UU3A 2LRKA 5LGTB 2Q9QB 3RRWA 3EAMA 4B5DA 3CQXC 3FZFB 3RKOA 3P50A 4DV7T 3C64A 1ZOYA 4PFPA 2IMLA 1FMWA 1HTJF 5ETWA 5LGNB 4HE8A 1XWMA 2H89A 4AQGA 3PJAA 4CXWA 2E9XB 3RHWA 4X64T 2L3LA 1OEDC 1VCTA 4XK9A 2LRLA 4ANJA 2ZLYA 5F5WA 3EABA 2WNJA 4X65T 1IJ5A 3OBVE 5FY1A 2MAWA 2RA1A 4JV5T 4OFZA 3N2OA 2BYRA 3CIRA 5HWXA 3SIOA 4IIJE 4HWCA 2XYSA 3MJXA 3ZC1A 3ZYMA 2H7VC 4JBWF 2KINB 2FJEA 1SA0E 2XSBA 2UUAT 2WAUA 1UW6A 1W9RA 2VL0A 5FP3A 5HEHA 1ZV4X 4QX8B 4AQFC 3AE7A 3SFDA 2V1DB 4UVAB 2MBGA 4A98A 5H6QB 3ONXA 3E08A 2W8FA 3RH3A 1MNDA 5AINA 3ZYKA 4KUMB 3WTMA 2HPJA 1MIYA 3AA0B 2YU2A 3ZN1B 2HPLA 3CWZB 3HKBE 4GIWA 3PU8A 4HFIA 2LT3A 5AQSB 2MOZA 2X9XA 1J1JA 5AQFB 4B3MT 4TWDA 3ZT6A 4FJOA 3RYHE 3WIPA 2XQYA 2NR4A 2D9DA 2EHOD 3RC3A 4B3TT 4I50E 5EZYE 1MIVA 2BG9C 4EXTA 5ADXL 4A56A 2BKPA 3QNUA 5LP6E 5HEUA 2XUEA 5FKYA 5SYOA 2X00A 3VKGA 4AFHA 2CEAA 1S94A 4ZZCA 1D0XA 2BYPA 4H9RC 1S35A 4LFCT 4NUVA 4CXYA 5C8YE 5JDMA 4LFBT 3ONJA 4H9SE 2QA7A 1NWMX 2V5DA 3AE3A 3R84B 4AKGA 3ESLA 5L2LA 4EYUA 2JQKA 2BYSA 4LF8T 4CN4A 2VQET 1YXRA 4AFTA 2UXBT 4PJMA 1HNWT 1BR1A 4DNDA 2WDVA 2LSJA 4ZI2C 3LG7A 5CFBA 2J62A 3C51A 2KLQA 1IBLT 3RIUC 4N78D
chains in the Genus database with same CATH topology
5KZUA 2BG9A 2ZJUA 3PEOA 4HFCA 2YMDA 4EZ1A 3JADA 2YKSA 2BG9E 5AFMA 5J5FA 2XQ9A 4UY2A 4TWDA 3UQ7A 4HQPA 3RHWA 1UV6A 3WIPA 4HFBA 3U8MA 2Y57A 3JAFA 4NZBA 3SQ6A 2W8GA 2LM2A 3RI5A 1UX2A 4ILAA 3TLSA 1OEDC 4PIRA 2Y56A 5AFJA 3P4WA 4XK9A 4XHEA 3WTHA 2X00D 4F8HA 5J5HA 4TNWA 2YMEA 4UXUA 1I9BA 3U8KA 3WTNA 3U8JA 3C79A 2BG9C 5J5GA 5HEJA 4QH1A 4QAAA 2BR7A 2WNJA 2XQ6A 5HEUA 2C9TA 2WN9A 2M6BA 5TVCA 4BQTA 5AFKA 2XQ4A 4HFEA 3TLUA 4LMJA 5LG3A 2XQAA 2BYNA 4ZJTA 3WTLA 2XQ5A 4TNVA 4A97A 5SYOA 4ILCA 2XNTA 4HFDA 3EHZA 2MAWA 1OEDB 2BJ0A 2X00A 2Y7YA 4ALXA 4HFHA 4LMLA 3UU5A 4AFHA 5BP0A 2BR8A 2BYRA 4Z90A 3GUAA 2XQ7A 2UZ6A 3SQ9A 3SIOA 2QC1B 3UUBA 4ZZCA 2XYSA 4QH5A 5L4HA 2BG9B 4QABA 2BYPA 4ZR6A 3T4MA 3WTJA 2LLYA 3RIAA 3UU4A 4BFQA 2Y58A 2KSRA 5L4EA 2PGZA 4IL9A 3TLTA 4Z91A 3ZDGA 4ZJSA 3WTOA 4COFA 3UU8A 2WNLA 2XZ5A 5HCJA 3C84A 4ZK4A 2XNUA 5HEGA 4WV9A 2M6IA 2XQ8A 2YOEA 2XZ6A 4ILBA 4DBMA 2Y54A 5FJVA 2XQ3A 5BW2A 3ZKRA 1UW6A 3SH1A 5J5IA 4UM1A 3ZDHA 2VL0A 3EI0A 5J0ZA 5HEHA 5HCMA 3TLWA 5AFHA 2WZYA 1OEDE 3UU6A 4FRRA 2XNVA 4AFGA 5AFMB 2XYTA 2BYQA 4NPPA 4QACA 4D01A 3JAEA 3RIFA 2LKGA 4ZZBA 2BYSA 3UQ4A 5L47A 5HEOA 4A98A 3U8NA 5AFLA 3TLVA 4ZRUA 4QH4A 4LMKA 4AFTA 5LXBA 3UU3A 2W8FA 4UM3S 2LKHA 5IUXA 2ZJVA 5CO5A 3WTIA 5JMEA 3U8LA 5AINA 2YN6A 4IL4A 3RQUA 5BRXA 3WTMA 5KE4A 5CFBA 3EAMA 4UM3P 4IREA 4ZK1A 4UM3A 1OEDA 4B5DA 2WNCA 3IGQA 4TWFA 2PH9A 5AFNA 3P50A 3PMZA 3LSVA 3WTKA 4X5TA 3RQWA 4TWHA 4HFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KZU A;  2BG9 A;  2ZJU A;  3PEO A;  4HFC A;  2YMD A;  4EZ1 A;  3JAD A;  2YKS A;  2BG9 E;  5AFM A;  5J5F A;  2XQ9 A;  4UY2 A;  4TWD A;  3UQ7 A;  4HQP A;  3RHW A;  1UV6 A;  3WIP A;  4HFB A;  3U8M A;  2Y57 A;  3JAF A;  4NZB A;  3SQ6 A;  2W8G A;  2LM2 A;  3RI5 A;  1UX2 A;  4ILA A;  3TLS A;  1OED C;  4PIR A;  2Y56 A;  5AFJ A;  3P4W A;  4XK9 A;  4XHE A;  3WTH A;  2X00 D;  4F8H A;  5J5H A;  4TNW A;  2YME A;  4UXU A;  1I9B A;  3U8K A;  3WTN A;  3U8J A;  3C79 A;  2BG9 C;  5J5G A;  5HEJ A;  4QH1 A;  4QAA A;  2BR7 A;  2WNJ A;  2XQ6 A;  5HEU A;  2C9T A;  2WN9 A;  2M6B A;  5TVC A;  4BQT A;  5AFK A;  2XQ4 A;  4HFE A;  3TLU A;  4LMJ A;  5LG3 A;  2XQA A;  2BYN A;  4ZJT A;  3WTL A;  2XQ5 A;  4TNV A;  4A97 A;  5SYO A;  4ILC A;  2XNT A;  4HFD A;  3EHZ A;  2MAW A;  1OED B;  2BJ0 A;  2X00 A;  2Y7Y A;  4ALX A;  4HFH A;  4LML A;  3UU5 A;  4AFH A;  5BP0 A;  2BR8 A;  2BYR A;  4Z90 A;  3GUA A;  2XQ7 A;  2UZ6 A;  3SQ9 A;  3SIO A;  2QC1 B;  3UUB A;  4ZZC A;  2XYS A;  4QH5 A;  5L4H A;  2BG9 B;  4QAB A;  2BYP A;  4ZR6 A;  3T4M A;  3WTJ A;  2LLY A;  3RIA A;  3UU4 A;  4BFQ A;  2Y58 A;  2KSR A;  5L4E A;  2PGZ A;  4IL9 A;  3TLT A;  4Z91 A;  3ZDG A;  4ZJS A;  3WTO A;  4COF A;  3UU8 A;  2WNL A;  2XZ5 A;  5HCJ A;  3C84 A;  4ZK4 A;  2XNU A;  5HEG A;  4WV9 A;  2M6I A;  2XQ8 A;  2YOE A;  2XZ6 A;  4ILB A;  4DBM A;  2Y54 A;  5FJV A;  2XQ3 A;  5BW2 A;  3ZKR A;  1UW6 A;  3SH1 A;  5J5I A;  4UM1 A;  3ZDH A;  2VL0 A;  3EI0 A;  5J0Z A;  5HEH A;  5HCM A;  3TLW A;  5AFH A;  2WZY A;  1OED E;  3UU6 A;  4FRR A;  2XNV A;  4AFG A;  5AFM B;  2XYT A;  2BYQ A;  4NPP A;  4QAC A;  4D01 A;  3JAE A;  3RIF A;  2LKG A;  4ZZB A;  2BYS A;  3UQ4 A;  5L47 A;  5HEO A;  4A98 A;  3U8N A;  5AFL A;  3TLV A;  4ZRU A;  4QH4 A;  4LMK A;  4AFT A;  5LXB A;  3UU3 A;  2W8F A;  4UM3 S;  2LKH A;  5IUX A;  2ZJV A;  5CO5 A;  3WTI A;  5JME A;  3U8L A;  5AIN A;  2YN6 A;  4IL4 A;  3RQU A;  5BRX A;  3WTM A;  5KE4 A;  5CFB A;  3EAM A;  4UM3 P;  4IRE A;  4ZK1 A;  4UM3 A;  1OED A;  4B5D A;  2WNC A;  3IGQ A;  4TWF A;  2PH9 A;  5AFN A;  3P50 A;  3PMZ A;  3LSV A;  3WTK A;  4X5T A;  3RQW A;  4TWH A;  4HFI A; 
#chains in the Genus database with same CATH topology
 2CXD A;  4E7Z A;  2BKO A;  4AKH A;  1WYC A;  4GOU A;  2XHE B;  2D2S A;  2W0G A;  3WI3 A;  3O1I A;  3ZMU B;  5AFJ A;  3ETU A;  5JQG E;  4EGW A;  2DNX A;  4EZ4 A;  3IF8 B;  4HFV A;  2H3R A;  3RC8 A;  1J5W A;  3NRX A;  5J5G A;  4TUY E;  4AQF A;  3KDS E;  1XZY A;  5FXV A;  4WZX A;  2W2U A;  2CHO A;  4H63 V;  4ZJT A;  1M7K A;  2DL1 A;  1UX5 A;  3LBX B;  3TKL B;  2WMN A;  3RYI E;  3UUB A;  3N9O A;  4YSY A;  5L4H A;  4DUZ T;  3N9M A;  3L3P A;  1WRD A;  4IL9 A;  2P9B A;  3ZDG A;  2K9A A;  5FY0 A;  2MTQ A;  5F8P A;  2XNU A;  2Y48 B;  2HN1 A;  4IE6 A;  5FJV A;  3UUM A;  3IA3 A;  4O4I E;  3OVU A;  4HWH A;  4GYR A;  2VVS A;  4BA9 A;  3RIF A;  5IYZ E;  4LF6 T;  4UV9 B;  5AQV B;  4ZRU A;  4XAX B;  4KP3 C;  2EHO C;  2Y6X A;  1X79 A;  2CBI A;  3RQU A;  3ZT7 A;  2UXC T;  2V6Y A;  2V7M A;  4YLH A;  4IRE A;  2SPC A;  4L0R A;  2JMK A;  3LSV A;  3RYC E;  3WTK A;  4K0U A;  5ABG A;  4ZI3 D;  2WB5 A;  5AQO B;  4X20 E;  4JLE A;  2Y57 A;  2W8G A;  2LSG A;  5LYJ E;  1FEW A;  5C2T A;  1WR0 A;  5LNK A;  3DP7 A;  2MPK A;  4KBM B;  4PK5 A;  2N2N A;  1KNZ A;  2X9Y A;  5AQU B;  5LMN T;  1GQE A;  3CX6 B;  3AEF A;  2V5C A;  3UU5 A;  1MMD A;  1YW0 A;  3C98 B;  4P0B A;  2XQ7 A;  3GUA A;  3VKH A;  4QAB A;  3AVS A;  4NXM T;  4OX9 T;  1N34 T;  2PGZ A;  2C5I T;  2VKH A;  4WNK A;  3UFG A;  3RIU A;  4IHJ E;  2M6I A;  5JDG A;  4PW8 A;  5E0O A;  3FZM B;  1D1C A;  3SS1 A;  3P4P A;  1W0B A;  3Q5X A;  3PUY F;  3ZDH A;  4K0K T;  1BR2 A;  4QXH B;  1E1H B;  2JQQ A;  3B13 A;  1HFA A;  2XAS B;  3U8N A;  5HEO A;  5AFL A;  2OLT A;  5M4Y A;  3VU7 H;  3CVR A;  5IUX A;  2CA5 A;  1V9D A;  5JME A;  2G0U A;  5KXJ A;  4MFR A;  3K3Q C;  2NP9 A;  4HFC A;  1UX4 A;  3KIN B;  3ZPO A;  3AEE A;  3HKE E;  1J5E T;  3NVO A;  3RI5 A;  2X51 A;  2DI4 A;  4PIR A;  2Y56 A;  4DUY T;  1XDO A;  3V5U A;  5AQQ B;  2XJ7 A;  3L39 A;  2JPF A;  4OYK A;  4LF4 T;  4UV8 B;  5BMV E;  4UEL A;  4ILC A;  2XNT A;  2EHO A;  2BJ0 A;  2K5B B;  4HFH A;  4IGU A;  3AED A;  2K24 A;  5AQK B;  3VRA A;  1CUN A;  2LJL A;  1O3X A;  5FVL A;  2BVM A;  4WBN E;  4CI3 B;  4DR7 T;  4ZK4 A;  5HEG A;  3CPZ A;  2XQ8 A;  3L8R A;  3N9N A;  3O1J A;  2IC6 A;  2J4G A;  4DV0 T;  3EI0 A;  3AE2 A;  1LVF A;  4ZI3 C;  3UU6 A;  1CHU A;  2WY2 A;  2UUB T;  4CI1 B;  3FXE B;  4J2C A;  4LFA T;  4EV6 A;  2XYT A;  2W67 A;  4QKN A;  4JEU B;  4DV2 T;  2WS3 A;  3T1Y T;  3P4R A;  3UTK A;  1OWA A;  4DV1 T;  3AA1 B;  3FZH B;  2PBI A;  2KMF A;  4TWF A;  4UF0 A;  3AXJ B;  1XMO T;  2Q9Q D;  4X1I E;  4PFO A;  5FNV E;  5KZU A;  4X66 T;  3Q5D A;  2YKS A;  2LEH A;  1HG5 A;  4UY2 A;  4B6X A;  4PAG A;  5L3F B;  1WR6 A;  4AKL A;  2LM2 A;  4YTM A;  5AQI B;  2LM9 A;  5HXC A;  5L3D B;  5DJQ C;  2KXP B;  3N9Q A;  3R6N A;  3ZEF B;  3CX8 B;  3P4W A;  5JDQ A;  4EEB A;  2E9X D;  4I43 B;  3M65 A;  2AXD S;  4MLK A;  2CRB A;  5JDF A;  3AVR A;  1UUR A;  4G63 A;  4YXD A;  5JRC A;  5J2U E;  2M6B A;  2OA5 A;  3RYF E;  2XQ4 A;  2JJ9 A;  4EIW A;  4C90 A;  4ZS2 A;  3G06 A;  2BYN A;  2BDE A;  4KHZ F;  2D5U A;  5LHG B;  5HXE A;  3MZK B;  1UGO A;  5LXT E;  3FXD B;  1YD8 G;  4ZXL A;  2JQH A;  2WBL A;  2BS2 A;  4O4J E;  4ZI2 D;  4PJN A;  4BAY B;  4LF9 T;  5HXS A;  5CJ5 A;  2XZ6 A;  3RF1 A;  3OYZ A;  3OTO T;  3PUW F;  2WZI A;  3A8Y C;  4ERR A;  2ACX A;  5FL0 A;  5JR9 B;  5LGU B;  3AA7 B;  1NAF A;  2IC9 A;  2WCA A;  2ZM2 A;  5JRE A;  2B1E A;  3IBP A;  2A2F X;  2XZE A;  5FMN A;  5JDH A;  3ZMT B;  4BJN A;  2DHR A;  2H88 A;  2CMR A;  2I6H A;  3ZSS A;  4JI4 T;  2HH7 A;  3W15 B;  4ZK1 A;  1WCR A;  5CA0 E;  3P4Q A;  1NEK A;  1N32 T;  2CLY B;  2VKO A;  2NW9 A;  2MYS A;  4NXN T;  2OV9 A;  2XM2 A;  4ILA A;  2Y8D A;  2CHN A;  4IDO A;  4YTN A;  2YME A;  4MBQ A;  2LSK A;  2E5V A;  3AAE B;  4BQT A;  3I0O A;  3UUX B;  2IIU A;  1B7T A;  1T8B A;  2XAG B;  3CML A;  5DQW A;  4KMC A;  3ZJ1 A;  3RIA A;  5AQR B;  1WLX A;  2DWK A;  2KSR A;  3C4Z A;  2PG8 A;  2LOP A;  3E22 E;  3A5X A;  2WQY A;  2XM1 A;  4TZ4 C;  3PUZ F;  5AQM B;  5J5I A;  2Q9Q C;  3VR9 A;  1OED E;  2ACZ A;  3JAE A;  2LKG A;  1MMA A;  4ZEY A;  2V8S V;  3QK6 A;  2W00 A;  3K1S A;  2L8K A;  5AQP B;  4X1Y E;  2V7L A;  3ZMV B;  2LKH A;  4PJL A;  2R6G F;  2E9X C;  1MMG A;  3AB3 B;  3FBZ A;  5EK2 A;  4UM3 P;  3WAJ A;  1OED A;  4HGA A;  4IDN A;  4DMW A;  5LCY A;  2FBW A;  5KMG P;  4Q25 A;  4UVC B;  2WDR A;  2JRK A;  2VKJ A;  1YQ3 A;  2WSS V;  2V26 A;  2ODU A;  1UX2 A;  4UR9 A;  1D0Z A;  3AEA A;  3C79 A;  1HF8 A;  5BR8 T;  2C9T A;  4KX6 A;  2ZM0 A;  2XQA A;  3AE9 A;  1HS7 A;  3U3I A;  4E7S A;  4PK4 A;  3GN5 A;  5C3J A;  3PU3 A;  4CQI A;  4EED A;  3T4M A;  5DAB A;  2CE7 A;  4IE5 A;  3GWH A;  2XZ5 A;  3N2G E;  5HCJ A;  1SE7 A;  1FJG T;  3AE4 A;  4IDP A;  4YT0 A;  2W4X A;  4IE0 A;  4U7Y A;  4MHC A;  5AFH A;  3OPC A;  5JRC B;  5ABF A;  4AFG A;  4DMV A;  3Q9D A;  1HX8 A;  1IAP A;  5LBQ B;  3CK6 A;  4IL4 A;  4LF7 T;  4CI2 B;  5LBM A;  3HA4 A;  3KV9 A;  1WFD A;  3OYX A;  1IBM T;  3FZL B;  2B76 A;  2WMO A;  3K8P C;  2D0T A;  2J1D G;  4WBO A;  2BG9 A;  2ZJU A;  4EZ1 A;  2YMD A;  5AFM A;  5J5F A;  2XQ9 A;  4U31 A;  3ANW A;  3SOL A;  3H3M A;  4G2A A;  5EK4 A;  2Q9Q A;  4DV5 T;  2CCQ A;  4EOZ B;  3NBX X;  1JNR A;  4B3R T;  4JUY A;  1NEN A;  2BZB A;  2PFV A;  3C4W A;  2QYW A;  3HKC E;  1YQ4 A;  2C0S A;  2Y7Y A;  2E9X A;  4IDQ A;  3KFW X;  5BP0 A;  1QLB A;  4Z90 A;  2RPA A;  4QH5 A;  5CA1 E;  2KND A;  5LOV E;  4YJ2 E;  4O4L E;  4BFQ A;  5L4E A;  1HCI A;  4L9I A;  1XMQ T;  4GK5 E;  5BW2 A;  3B57 A;  2N1G A;  1R8I A;  2NTX A;  1D0Y A;  3F2E A;  2E2A A;  5LHI B;  1VRB A;  2QRX A;  3BK9 A;  2ZM8 A;  3UQ4 A;  3IHR A;  5L47 A;  2M67 A;  3ZT5 A;  3ZN0 B;  2BS4 A;  4QH4 A;  3BQI A;  4UM3 S;  5AQG B;  1DU2 A;  3LK3 B;  5JDL A;  5KE4 A;  2LSI A;  3N2K E;  2L9Q A;  3QB5 K;  5CB4 E;  2IHR 1;  3QUJ A;  4TN7 B;  4EB6 E;  4U33 A;  4X5T A;  3AE5 A;  3VHL A;  4DR1 T;  4P1N A;  4JI1 T;  2CM0 A;  4YTP A;  4HTE A;  4HQP A;  3P4S A;  2VB6 A;  5FXZ A;  4DR5 T;  5KDM C;  2LE8 A;  4JI5 T;  4HWI B;  3PV0 F;  4TNW A;  4UXU A;  5AQN B;  1ZP0 A;  3WTN A;  1UK5 A;  3P7I A;  3TLU A;  2VL8 A;  3E0Z A;  4ADZ A;  3GMI A;  4TNV A;  3NWI A;  1OED B;  4ALX A;  1VOM A;  2YDS A;  4XBF B;  4O4H E;  4CN6 A;  4XZC A;  2XSA A;  4AI6 A;  2XAJ B;  1ZKE A;  1IBK T;  2XY8 B;  3C84 A;  2A9U A;  2ODV A;  3KVB A;  3J7Y q;  2XTL A;  5GON E;  3ZMS B;  3AEB A;  4B3S T;  3RLF F;  4PK6 A;  3EDU A;  4UM1 A;  3O9X A;  2IUB A;  4UEM A;  5LG4 A;  4GYS A;  4D01 A;  4NPP A;  4CXX A;  2VAS A;  4TV8 E;  1L0V A;  4X62 T;  1SUM B;  2PTF A;  2HN2 A;  1SHZ C;  2KWI B;  3I1A A;  5AFN A;  3GA8 A;  2ZM6 T;  4DR4 T;  4DO0 A;  2K48 A;  3JAD A;  3N5L A;  4L5G A;  4NUU A;  4AQY T;  3UUL A;  4HFB A;  3BQL A;  2ZMA A;  3PUR A;  4EZH A;  1EZ3 A;  2NOX A;  2WDQ A;  1U4Q A;  4U7I A;  4O8S A;  3ZST A;  2CPT A;  1QUU A;  4UVB B;  4QH1 A;  2XQ6 A;  4P09 A;  5TVC A;  5AFK A;  2BBH A;  3PJA J;  5J1G A;  2QVA A;  2XQ5 A;  3HKD E;  4A97 A;  3EHZ A;  3KBU A;  3H37 A;  3SWH A;  5J2T E;  4Z8X A;  4EYY R;  2BG9 B;  3PUS A;  3WAK A;  3NZQ A;  4DV3 T;  3TLT A;  1LVK A;  2IDO B;  3WTO A;  4U2Z A;  4WV9 A;  1VCS A;  1N36 T;  2Y54 A;  4YY3 T;  2V6Y B;  3ZKR A;  3VR8 A;  3A7M A;  2X67 A;  3TLW A;  2JQ9 A;  2CXL A;  3LBX A;  5L3B B;  5A1L A;  1KF6 A;  5AFU L;  1XNQ T;  4DV6 T;  3CQG B;  2D0U A;  4H9O C;  2KT9 A;  3U78 A;  3I9W A;  2ES0 A;  2CXF A;  5AQH B;  1W09 A;  4MAL A;  3LDQ B;  4CZZ B;  2V7K A;  5TAO A;  1HR0 T;  2YN6 A;  1KNR A;  2AE9 A;  4JI7 T;  4OK0 A;  4UM3 A;  1YKH B;  3PMZ A;  2X9H A;  4M1P A;  2XAH B;  2XAQ B;  4AIU A;  1FMV A;  2CWY A;  4OYJ A;  3JAF A;  3ZYL A;  5HYA A;  2VK9 A;  3PUV F;  5CGM A;  4ILU A;  2X9W A;  2I0M A;  2LSY A;  3PTR B;  5ABH A;  3PUA A;  2JMH A;  3FB2 A;  2BR8 A;  2XPK A;  5AQJ B;  2UZ6 A;  2NW7 A;  2X68 A;  4ZR6 A;  3FHN A;  1HG2 A;  2Y58 A;  1FIO A;  4AKI A;  4QX7 B;  4ZHQ E;  2FJB A;  2KWH A;  1ZHC A;  2LHR A;  4ILB A;  4IST A;  4V1A v;  5L3C B;  1Z0P A;  4KHP T;  5LB7 B;  2WZY A;  5HXH A;  5JH7 E;  3OJA A;  3PE0 A;  4HEA A;  2BYQ A;  3RGL A;  2YU1 A;  2Z6E A;  3FBL A;  3X1D A;  2WWU A;  2VWA A;  1T7S A;  2VQF T;  3QB5 A;  2NTY A;  4DV4 T;  2NWB A;  4JI3 T;  2CWO A;  3UUN A;  3KVA A;  4KI0 F;  4I4T E;  4PJJ A;  5LJN A;  2PH9 A;  3PDY A;  4JI0 T;  3JCF A;  3NZP A;  3RKG A;  2F4V T;  1MIW A;  2EHO B;  3FZK B;  3U8M A;  4H9N C;  3P8C D;  4NZB A;  4O2B E;  2N9D A;  2LHN A;  5AQT B;  3EUH A;  4OHF A;  2W66 A;  5J5H A;  2VKD A;  3O1H A;  5FVK A;  5HEJ A;  3HI2 A;  4WYV A;  4YFS A;  3KV5 A;  2A72 A;  4LML A;  3SQ9 A;  2QC1 B;  3ONL C;  2X0L B;  4A5X A;  3OKQ A;  1XNR T;  4DR6 T;  1JNZ A;  4JYA T;  3K3O A;  5JR9 C;  2DLR A;  3KBT A;  2XAF B;  1Y01 A;  4DBR A;  4DBM A;  2YDQ A;  4I0U A;  4U74 A;  5AQL B;  3ZCJ A;  3I9Y A;  5FXX A;  4UF0 B;  5HCM A;  3Q5W A;  3LK4 2;  4UIG A;  3AE8 A;  4QAC A;  2W62 A;  1MNE A;  4H9P C;  3VRB A;  2CLY C;  4LMK A;  4NIQ A;  3F31 A;  4O2A E;  2ZJV A;  5CO5 A;  2IAK A;  1H7C A;  5JDN A;  3AEG A;  1MMN A;  1ZEE A;  5FXW A;  1T72 A;  2K3W A;  2LOS A;  3PEO A;  3LFM A;  2BG9 E;  3MK7 C;  2UXD T;  5H6R B;  5ABE A;  5DQV A;  3UQ7 A;  1UV6 A;  4C91 A;  3SQ6 A;  4JI2 T;  3CKD A;  2J47 A;  4AKR B;  1IZN B;  4QWN B;  4WW0 A;  4F6R C;  4YHJ A;  4F8H A;  4IDZ A;  3H3A A;  2WU5 A;  3BQK A;  3U8K A;  3U8J A;  1U5P A;  3AXJ A;  3C50 A;  3MA9 A;  3NKZ A;  2C5J A;  3WTL A;  4JEH B;  3T1H T;  3D0T A;  3DJB A;  4ZOL E;  4FI5 A;  3ZCI A;  3C4X A;  4H63 H;  2BVL A;  3ZJ2 A;  2FJA A;  4DID B;  1G8X A;  1Z8U A;  2WZH A;  2PJQ A;  1LKX A;  3UU8 A;  1X9B A;  4X1K E;  3T8O A;  3JC6 D;  4U3C A;  3AA6 B;  2E8I A;  3SFE A;  2YDR A;  1M62 A;  2BS3 A;  4ISS A;  4FRR A;  2UUC T;  5LJM A;  4ZI7 E;  3HR0 A;  1US7 B;  5JTG A;  1I6Z A;  3DTO A;  3QOF A;  4PNI A;  3TLV A;  2HHH T;  1T98 A;  1HNX T;  2UU9 T;  3WTI A;  1LRZ A;  1UCU A;  4TV9 E;  3EDV A;  5IWA T;  1KNP A;  4AIS A;  4UXN B;  4QHO A;  4BJM A;  2WNC A;  3IGQ A;  2E5L T;  4TWH A;  5LXB A;  4IT4 A;  5FY7 A;  4GKK T;  3HL6 A;  3B5M A;  2BKN A;  3LJC A;  5JR9 A;  5HXR A;  2WWV A;  5LHH B;  3EVY A;  2W61 A;  1W0A A;  3N9L A;  1WYB A;  2I59 A;  3WTH A;  4XHE A;  2X00 D;  3KV4 A;  1I9B A;  1YKE B;  4YJ3 E;  3RX6 A;  3PUX F;  4GK0 E;  1QSD A;  2FUP A;  5IHY A;  2YIN A;  2WN9 A;  5LMU T;  3F57 A;  5F3J A;  3M3Z B;  4LMJ A;  4HFD A;  2X0Y A;  5FYM A;  4U72 A;  2X66 A;  4EAH A;  4DR2 T;  2V7I A;  4QXB B;  2W63 A;  2KZ7 B;  1IJ6 A;  2FJD A;  3Q2M A;  3LK2 B;  3ZC0 A;  2NW8 A;  4Z91 A;  2YK0 A;  3N9P A;  3UT5 E;  2WM9 A;  4YSX A;  3UFE A;  3SRZ A;  3V5S A;  3L09 A;  1UUS A;  5J0Z A;  1D1A A;  3CX7 B;  4YSZ A;  1KEY A;  3ZMZ B;  5KX5 E;  2DCF A;  2X0H A;  4DVD A;  3PUQ A;  5L3G B;  2YEV C;  3S4U A;  2QGS A;  3RPU A;  4DBQ A;  4IE4 A;  3U8L A;  1OXZ A;  5BRX A;  2VUR A;  4QXC B;  2RP4 A;  2V7J A;  5LA6 E;  4P0A A;  4ASK A;  3CQC B;  2WU2 A;  2UXX B;  3KV6 A;  3RQW A;  3AE6 A;  4IE7 A;  3MAC A;  1KK7 A;  4CN1 A;  1HNZ T;  1AJ3 A;  3TLS A;  3GN5 B;  1BR0 A;  5EK3 A;  4QAA A;  3I0Q A;  2C5K T;  2BR7 A;  4U2Y A;  3JC6 C;  5HWY A;  4JI6 T;  4HFE A;  2DWG A;  5HAX A;  1I94 T;  2CBJ A;  5LG3 A;  3RRC A;  1N33 T;  2IW5 B;  2H7O A;  1E7P A;  4ZS3 A;  2GK9 A;  4JI8 T;  3MXZ A;  4TX5 A;  1HX1 B;  5ABF B;  3J9X 1;  5JVD E;  1E2A A;  1KFY A;  3WTJ A;  2V6X A;  3K3N A;  3ABV A;  2LLY A;  3UU4 A;  3Q5E A;  4YHH T;  3AEC A;  1XDP A;  4ZJS A;  4I55 E;  1Y64 B;  4COF A;  2WNL A;  2BBJ A;  2YOE A;  3ZLI A;  2JIW A;  2XQ3 A;  3IEE A;  3AE1 A;  3SH1 A;  3MKD A;  2A3D A;  4LF5 T;  3NRY A;  4HKA A;  3QC9 A;  1G73 A;  1D1B A;  4H9Q C;  5L3E B;  2XNV A;  5AFM B;  4DR3 T;  3AAA B;  4AXP A;  3AAI A;  2UXN B;  1BR4 A;  4ZZB A;  3ANW B;  4GKJ T;  3PUG A;  4HN9 A;  2WP9 A;  5FL1 A;  3O4X E;  4HWF A;  2VVN A;  3ETV A;  4HWD A;  3UU3 A;  2LRK A;  5LGT B;  2Q9Q B;  3RRW A;  3EAM A;  4B5D A;  3CQX C;  3FZF B;  3RKO A;  3P50 A;  4DV7 T;  3C64 A;  1ZOY A;  4PFP A;  2IML A;  1FMW A;  1HTJ F;  5ETW A;  5LGN B;  4HE8 A;  1XWM A;  2H89 A;  4AQG A;  3PJA A;  4CXW A;  2E9X B;  3RHW A;  4X64 T;  2L3L A;  1OED C;  1VCT A;  4XK9 A;  2LRL A;  4ANJ A;  2ZLY A;  5F5W A;  3EAB A;  2WNJ A;  4X65 T;  1IJ5 A;  3OBV E;  5FY1 A;  2MAW A;  2RA1 A;  4JV5 T;  4OFZ A;  3N2O A;  2BYR A;  3CIR A;  5HWX A;  3SIO A;  4IIJ E;  4HWC A;  2XYS A;  3MJX A;  3ZC1 A;  3ZYM A;  2H7V C;  4JBW F;  2KIN B;  2FJE A;  1SA0 E;  2XSB A;  2UUA T;  2WAU A;  1UW6 A;  1W9R A;  2VL0 A;  5FP3 A;  5HEH A;  1ZV4 X;  4QX8 B;  4AQF C;  3AE7 A;  3SFD A;  2V1D B;  4UVA B;  2MBG A;  4A98 A;  5H6Q B;  3ONX A;  3E08 A;  2W8F A;  3RH3 A;  1MND A;  5AIN A;  3ZYK A;  4KUM B;  3WTM A;  2HPJ A;  1MIY A;  3AA0 B;  2YU2 A;  3ZN1 B;  2HPL A;  3CWZ B;  3HKB E;  4GIW A;  3PU8 A;  4HFI A;  2LT3 A;  5AQS B;  2MOZ A;  2X9X A;  1J1J A;  5AQF B;  4B3M T;  4TWD A;  3ZT6 A;  4FJO A;  3RYH E;  3WIP A;  2XQY A;  2NR4 A;  2D9D A;  2EHO D;  3RC3 A;  4B3T T;  4I50 E;  5EZY E;  1MIV A;  2BG9 C;  4EXT A;  5ADX L;  4A56 A;  2BKP A;  3QNU A;  5LP6 E;  5HEU A;  2XUE A;  5FKY A;  5SYO A;  2X00 A;  3VKG A;  4AFH A;  2CEA A;  1S94 A;  4ZZC A;  1D0X A;  2BYP A;  4H9R C;  1S35 A;  4LFC T;  4NUV A;  4CXY A;  5C8Y E;  5JDM A;  4LFB T;  3ONJ A;  4H9S E;  2QA7 A;  1NWM X;  2V5D A;  3AE3 A;  3R84 B;  4AKG A;  3ESL A;  5L2L A;  4EYU A;  2JQK A;  2BYS A;  4LF8 T;  4CN4 A;  2VQE T;  1YXR A;  4AFT A;  2UXB T;  4PJM A;  1HNW T;  1BR1 A;  4DND A;  2WDV A;  2LSJ A;  4ZI2 C;  3LG7 A;  5CFB A;  2J62 A;  3C51 A;  2KLQ A;  1IBL T;  3RIU C;  4N78 D; 
#chains in the Genus database with same CATH homology
 5KZU A;  2BG9 A;  2ZJU A;  3PEO A;  4HFC A;  2YMD A;  4EZ1 A;  3JAD A;  2YKS A;  2BG9 E;  5AFM A;  5J5F A;  2XQ9 A;  4UY2 A;  4TWD A;  3UQ7 A;  4HQP A;  3RHW A;  1UV6 A;  3WIP A;  4HFB A;  3U8M A;  2Y57 A;  3JAF A;  4NZB A;  3SQ6 A;  2W8G A;  2LM2 A;  3RI5 A;  1UX2 A;  4ILA A;  3TLS A;  1OED C;  4PIR A;  2Y56 A;  5AFJ A;  3P4W A;  4XK9 A;  4XHE A;  3WTH A;  2X00 D;  4F8H A;  5J5H A;  4TNW A;  2YME A;  4UXU A;  1I9B A;  3U8K A;  3WTN A;  3U8J A;  3C79 A;  2BG9 C;  5J5G A;  5HEJ A;  4QH1 A;  4QAA A;  2BR7 A;  2WNJ A;  2XQ6 A;  5HEU A;  2C9T A;  2WN9 A;  2M6B A;  5TVC A;  4BQT A;  5AFK A;  2XQ4 A;  4HFE A;  3TLU A;  4LMJ A;  5LG3 A;  2XQA A;  2BYN A;  4ZJT A;  3WTL A;  2XQ5 A;  4TNV A;  4A97 A;  5SYO A;  4ILC A;  2XNT A;  4HFD A;  3EHZ A;  2MAW A;  1OED B;  2BJ0 A;  2X00 A;  2Y7Y A;  4ALX A;  4HFH A;  4LML A;  3UU5 A;  4AFH A;  5BP0 A;  2BR8 A;  2BYR A;  4Z90 A;  3GUA A;  2XQ7 A;  2UZ6 A;  3SQ9 A;  3SIO A;  2QC1 B;  3UUB A;  4ZZC A;  2XYS A;  4QH5 A;  5L4H A;  2BG9 B;  4QAB A;  2BYP A;  4ZR6 A;  3T4M A;  3WTJ A;  2LLY A;  3RIA A;  3UU4 A;  4BFQ A;  2Y58 A;  2KSR A;  5L4E A;  2PGZ A;  4IL9 A;  3TLT A;  4Z91 A;  3ZDG A;  4ZJS A;  3WTO A;  4COF A;  3UU8 A;  2WNL A;  2XZ5 A;  5HCJ A;  3C84 A;  4ZK4 A;  2XNU A;  5HEG A;  4WV9 A;  2M6I A;  2XQ8 A;  2YOE A;  2XZ6 A;  4ILB A;  4DBM A;  2Y54 A;  5FJV A;  2XQ3 A;  5BW2 A;  3ZKR A;  1UW6 A;  3SH1 A;  5J5I A;  4UM1 A;  3ZDH A;  2VL0 A;  3EI0 A;  5J0Z A;  5HEH A;  5HCM A;  3TLW A;  5AFH A;  2WZY A;  1OED E;  3UU6 A;  4FRR A;  2XNV A;  4AFG A;  5AFM B;  2XYT A;  2BYQ A;  4NPP A;  4QAC A;  4D01 A;  3JAE A;  3RIF A;  2LKG A;  4ZZB A;  2BYS A;  3UQ4 A;  5L47 A;  5HEO A;  4A98 A;  3U8N A;  5AFL A;  3TLV A;  4ZRU A;  4QH4 A;  4LMK A;  4AFT A;  5LXB A;  3UU3 A;  2W8F A;  4UM3 S;  2LKH A;  5IUX A;  2ZJV A;  5CO5 A;  3WTI A;  5JME A;  3U8L A;  5AIN A;  2YN6 A;  4IL4 A;  3RQU A;  5BRX A;  3WTM A;  5KE4 A;  5CFB A;  3EAM A;  4UM3 P;  4IRE A;  4ZK1 A;  4UM3 A;  1OED A;  4B5D A;  2WNC A;  3IGQ A;  4TWF A;  2PH9 A;  5AFN A;  3P50 A;  3PMZ A;  3LSV A;  3WTK A;  4X5T A;  3RQW A;  4TWH A;  4HFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...