2XQ9A

Pentameric ligand gated ion channel glic mutant e221a in complex with tetraethylarsonium (teas)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYDANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
total genus 85
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq9A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq9A01
1UW6A 4LMKA 3WIPA 3SIOA 3C79A 3WTIA 5AFNA 3EHZA 4IL9A 4ZR6A 3UQ4A 4QH1A 4QH4A 4ZJTA 5J5HA 4QAAA 3ZDHA 2LKGA 5JMEA 2ZJUA 4XK9A 2QC1B 4UM3A 2X00D 2YN6A 5AFJA 2BJ0A 3WTKA 4HFIA 2Y7YA 2BG9E 5LXBA 2XQ4A 2UZ6A 3UU5A 5IUXA 4TNVA 5LG3A 5CFBA 3TLVA 5TVCA 5BRXA 2WNJA 4ZK4A 3UU4A 1OEDC 4AFTA 4UM3S 5L47A 3T4MA 2MAWA 4ZK1A 5AINA 3WTLA 2XQ3A 4HQPA 3PMZA 2Y57A 5J5FA 5J5IA 4HFEA 4X5TA 5J5GA 3SQ6A 3GUAA 2XZ5A 4IL4A 3WTNA 4LMLA 3RIFA 3IGQA 3U8KA 2XNTA 3JAFA 2BYSA 2WZYA 2BR8A 4NPPA 2YMEA 4UXUA 2PH9A 2WNCA 3UU6A 4ILBA 2Y58A 5HCMA 4EZ1A 2YOEA 3RQWA 4ZZCA 4QACA 2LKHA 3WTJA 4D01A 2X00A 5AFKA 2PGZA 4UM3P 5AFMB 2XQ9A 2XYSA 3EAMA 2Y56A 5HEGA 3WTOA 2BYNA 3LSVA 3ZKRA 4UM1A 4DBMA 3EI0A 4HFHA 5KE4A 4HFBA 4HFCA 3UU3A 4ZJSA 2VL0A 2BG9C 2C9TA 1UX2A 2XNUA 4XHEA 5HEJA 3WTHA 4WV9A 3C84A 4Z90A 1I9BA 2WNLA 4COFA 2W8GA 4TWDA 3ZDGA 4BQTA 1OEDB 3U8JA 5HEUA 5L4HA 4PIRA 2XNVA 4TWFA 4F8HA 4ZZBA 3P4WA 3WTMA 4BFQA 4IREA 4QABA 4B5DA 1UV6A 4A98A 2BG9B 5AFHA 2XZ6A 3RHWA 5KZUA 5AFMA 2XQAA 5HEHA 3RI5A 3TLUA 3U8MA 2ZJVA 2XQ5A 4ILCA 4AFHA 3TLWA 2XQ7A 2WN9A 4HFDA 4QH5A 4FRRA 2YKSA 3TLSA 1OEDE 2XQ6A 2YMDA 3UUBA 3U8NA 3SH1A 2BYRA 2XQ8A 2XYTA 5BP0A 4A97A 3RIAA 1OEDA 5BW2A 5FJVA 2M6BA 2M6IA 4Z91A 5J0ZA 2KSRA 4LMJA 3UU8A 3U8LA 3SQ9A 2W8FA 5L4EA 3TLTA 4NZBA 5HCJA 5CO5A 3PEOA 4ZRUA 4AFGA 2BG9A 5HEOA 2LM2A 2BYQA 2LLYA 4TNWA 5AFLA 3P50A 3RQUA 4ALXA 5SYOA 2BR7A 4ILAA 3JAEA 2Y54A 2BYPA 4UY2A 3UQ7A 4TWHA 3JADA
chains in the Genus database with same CATH superfamily
3ZJ2A 3ONXA 5AQQB 3WTIA 4P0BA 5JMEA 5H6RB 4B6XA 2PJQA 3AAAB 3LK3B 4YSXA 1ZOYA 3D0TA 3UU5A 2UZ6A 4YSZA 3V5UA 2CCQA 4PNIA 3AE4A 1JNRA 3KVAA 3AVRA 4V1Av 1MMDA 2HN2A 4HFEA 3AAEB 3NKZA 2XZ5A 3UUNA 5LG4A 2BR8A 2LRKA 5LNKA 4QACA 1N34T 2JQHA 1VRBA 4ASKA 5J1GA 2XQYA 5KE4A 3GN5A 2N2NA 4WV9A 4Z90A 4ANJA 3PUAA 4ZI2D 3CQXC 3ZSSA 4IREA 4J2CA 3RIUA 5F8PA 3UULA 5AFMA 4HWHA 4L9IA 4ILCA 3U78A 2XQ7A 5C2TA 4UF0A 3FZKB 1QSDA 1OEDA 2Z6EA 3C4XA 5LCYA 3FBLA 2L8KA 4U2ZA 3ZLIA 2IC6A 4DR3T 3PEOA 4LFAT 4P1NA 4WYVA 4AXPA 5KX5E 1FIOA 4TX5A 5HXCA 4BJMA 2H3RA 2CXDA 3KINB 4WNKA 2ACZA 3ZT6A 2UXNB 4JI5T 4H9PC 4IE5A 3C50A 2WZHA 4U2YA 5AQMB 1T72A 2MTQA 5CFBA 3AEDA 3CPZA 4UM3S 4CQIA 5L47A 5ABHA 5J5FA 4O4LE 2V1DB 2JQ9A 1D0XA 2UUCT 3WAJA 4LMLA 3AECA 3ESLA 2PBIA 5HXSA 2BYSA 4JI3T 2IC9A 3UU6A 2PFVA 3RYHE 1HG5A 3CQCB 4YT0A 2XYSA 3EAMA 3O1IA 4ZI3D 2UXCT 2LSGA 4GIWA 2EHOA 5FXXA 1R8IA 5JH7E 3WTHA 2LSIA 5FVKA 3K8PC 2BS3A 4LF5T 2DWKA 2DI4A 2DHRA 3MJXA 4QABA 4ZI7E 4A98A 3A8YC 2JMKA 2NOXA 3J9X1 3Q9DA 4U74A 2YDQA 2NW8A 2WMNA 2YKSA 3TLSA 2Q9QB 3A7MA 5BP0A 4GKJT 2W2UA 4PJLA 1NWMX 1QLBA 3ZMSB 4K0KT 4AKRB 2KWIB 5KDMC 5LHIB 2LOPA 2VURA 3CMLA 1SE7A 4FI5A 2CRBA 3L8RA 4LMKA 5FNVE 4GYRA 1LKXA 4O8SA 2WS3A 3W15B 3KVBA 1NEKA 4IE6A 4UIGA 3TLVA 2ZMAA 5TVCA 3PE0A 2V6XA 1XDOA 2LHRA 3SOLA 2FJEA 3CX8B 1YQ3A 3U8KA 4AKHA 5IWAT 2LRLA 4OHFA 4UM1A 3C64A 3GN5B 4QX8B 2X0LB 1SUMB 3AEAA 3Q2MA 5AQSB 5L3BB 2VQFT 2W8GA 2ZM0A 2J1DG 3MZKB 2FJDA 2UUBT 4OYJA 3ZMTB 1Z8UA 4DNDA 3HKBE 5AQRB 5JVDE 3TLUA 3JC6C 2A3DA 5DQWA 3U8NA 3BQIA 3NWIA 2E8IA 1BR4A 5AFUL 1FMWA 3ONLC 4QX7B 5HCJA 3T1YT 5AQOB 2WY2A 4H9NC 4MBQA 5HXHA 4BJNA 2PG8A 2MOZA 4X66T 3N9NA 2UXBT 1CHUA 1IAPA 2Y7YA 5AQNB 4U72A 1HR0T 2V6YA 4MFRA 3I0OA 3SRZA 2WNJA 5BRXA 1I94T 2IAKA 3OVUA 3I0QA 2J62A 3FZLB 1E1HB 3ZMUB 1G8XA 2ES0A 2XAGB 5JDMA 3T1HT 3QK6A 3JAFA 2YMEA 4IIJE 5DABA 2PH9A 1M7KA 5KXJA 2X66A 4YTNA 3AA6B 3LSVA 5CGMA 3FZFB 4CN4A 1W9RA 3OYZA 3C84A 4KUMB 3FZHB 2V7JA 4GOUA 4IDZA 2A72A 2CA5A 2BG9B 3AE8A 2UU9T 4YHJA 1D1AA 1O3XA 4NXMT 3SS1A 3U8MA 4KMCA 4PJJA 5DJQC 3AA1B 3VKHA 4YSYA 4WBNE 2CWOA 5FYMA 2X0HA 4LMJA 2B1EA 2W8FA 4WZXA 2WWVA 4NZBA 5HEOA 4N78D 4X64T 4HWCA 3JADA 4JI7T 1UW6A 4H63H 3SIOA 3LBXB 4QH4A 3C98B 2AXDS 1WYCA 3ZYMA 4JI0T 4DMVA 2H7OA 5LXBA 5A1LA 4I55E 4JBWF 5AQLB 1W0BA 2D0TA 3CQGB 4JV5T 4I43B 4AFTA 3EVYA 3HL6A 2CM0A 1W09A 4LF9T 2CMRA 2DCFA 2KZ7B 2WBLA 3NZPA 3EDVA 3SFDA 2X51A 3QUJA 2JRKA 4NUVA 5FXZA 3ETUA 5HCMA 2XY8B 4DR1T 4JI8T 4AQFA 2H89A 3WTOA 1CUNA 5EK4A 3EI0A 4ZI2C 4GYSA 3K3OA 5ABGA 5HEJA 1SA0E 5L3FB 2WNLA 4LFCT 4TWDA 2WB5A 2W63A 1XNRT 4MALA 4YJ2E 4Z8XA 1UUSA 1BR2A 1NAFA 2WDRA 5EK3A 1U4QA 1NENA 3CX6B 2KNDA 3Q5DA 2V7IA 1IJ6A 4CI1B 3JCFA 4U33A 2YEVC 4GKKT 3VR9A 4ZXLA 4ZRUA 4AFGA 3H37A 4CI2B 5AFLA 5SYOA 3RX6A 3O1HA 2WWUA 2ZM2A 3B13A 2BYPA 4UY2A 1Y01A 5ETWA 3RYIE 2LT3A 2XTLA 4IDPA 2WCAA 4ZJTA 2Q9QA 4O2BE 2E9XB 4LF6T 4UM3A 4QXHB 4I50E 5EZYE 4EZ4A 5J2UE 4JI4T 5LGUB 3CX7B 2LM9A 2XQ3A 2NWBA 4X5TA 3VRAA 3PUXF 3WTNA 1N32T 2GK9A 4ZEYA 3VR8A 4L5GA 4IE4A 2WNCA 4EZ1A 3EABA 4ADZA 4ZI3C 4KHPT 4DBRA 4UM3P 2QRXA 5LOVE 3BQLA 5HEGA 2BYNA 4DBMA 4HWDA 3KV9A 3NVOA 4HFVA 2W4XA 3PUWF 4COFA 4U3CA 3U8JA 4CI3B 3RF1A 3RPUA 5BMVE 4ZOLE 3WTMA 4TV9E 1T8BA 2Y48B 5DQVA 4F6RC 2LEHA 3I9YA 2ZJVA 2XQ5A 5LGNB 4DV3T 4AFHA 2YMDA 2DWGA 4MLKA 3F57A 5HAXA 3AE6A 3PUGA 2K24A 4DV1T 4EIWA 5ABFB 3JAEA 2W61A 2V7LA 3N9LA 3N9OA 4CXWA 3C79A 5J5HA 4EEDA 2K9AA 2ZJUA 4OYKA 1HS7A 2V5DA 4DMWA 3RYFE 4I0UA 3O1JA 2W0GA 3IEEA 4O4JE 1XMOT 4HWIB 2X9WA 2XM1A 3ANWB 3LFMA 4IE0A 2Y57A 4IDQA 3AXJB 4YTMA 2LSYA 4HN9A 3N9MA 4H9QC 2VB6A 3MKDA 3PU3A 4CZZB 1VCTA 4NPPA 3PUQA 2SPCA 4ISTA 1Y64B 3H3MA 2VWAA 3ZCJA 3ZEFB 3P4SA 3PU8A 3ZMZB 3ZT7A 1ZKEA 3UU3A 3MXZA 2BG9C 3P7IA 2XNUA 4TV8E 1J1JA 3N2GE 4IDOA 1MNEA 5AQGB 5L4HA 4XZCA 4BA9A 3KBTA 3HI2A 4B5DA 2XZEA 3RH3A 5FXVA 4KX6A 4EV6A 2V5CA 1U5PA 2X68A 2W66A 5AQJB 4A97A 4JI1T 4PFOA 1ZP0A 4PJNA 5J0ZA 5FY0A 3AE3A 4BAYB 2BG9A 5LHHB 2LLYA 1ZHCA 4ALXA 4ILAA 4AQYT 4JI2T 4O2AE 2CXFA 3ZYKA 3PUVF 4EAHA 1HX1B 3U3IA 2ODVA 2FBWA 1T7SA 3GA8A 2YK0A 3A5XA 4EZHA 3F31A 4QHOA 3M3ZB 1LRZA 5BR8T 4E7ZA 2VASA 2BKPA 5JDHA 4C90A 3LBXA 3SQ6A 4EOZB 3AEEA 3PURA 1E7PA 2CXLA 1UX4A 2XAJB 2K5BB 3NRXA 1D1BA 2VKOA 3KFWX 5AFKA 4X1IE 2LHNA 3RC8A 2XQ9A 2HPJA 3N2OA 1IBMT 3ZKRA 3K3QC 3K1SA 4HFCA 4UVCB 3FXEB 3P4QA 3RC3A 4EEBA 3ZDGA 1DU2A 2PTFA 2YDRA 1WLXA 4BFQA 3OJAA 2XM2A 5AQKB 2R6GF 2XPKA 5HEHA 4U7YA 3GMIA 4OX9T 5LBMA 4YY3T 4QH5A 1MNDA 2XQ6A 2XQ8A 2BS4A 3ZPOA 4DBQA 4EYUA 2FJAA 4QXCB 1J5ET 3TLTA 1LVFA 2DLRA 2EHOD 2E9XC 4IT4A 5JDGA 5LHGB 5FMNA 2M67A 4NIQA 3AE1A 3ZDHA 2BBHA 5FVLA 1N33T 2JJ9A 4DV0T 2HH7A 3PV0F 4H9SE 3MACA 3TKLB 2FUPA 2MAWA 3KV5A 3P4PA 2E9XA 5AQFB 3DJBA 3HKDE 2WZYA 4UXUA 1MMAA 5JRCB 4NUUA 3EUHA 2BKOA 2FJBA 5LB7B 4D01A 3PUYF 2IW5B 1T98A 4ZHQE 1MIYA 2QA7A 2IHR1 2E5LT 3LK2B 4JEHB 2WDQA 4IGUA 3N2KE 1YD8G 2V8SV 2X9HA 4DUYT 3LK42 1WFDA 4UV9B 2XQAA 4EGWA 2W62A 5LJNA 2BKNA 1HG2A 3UT5E 4AKGA 2YINA 2N1GA 4DR4T 4Z91A 1WR6A 5LP6E 1D1CA 1FEWA 2WSSV 4CXXA 1US7B 4QWNB 4TNWA 4DR7T 3E08A 4AKIA 5LMUT 4H63V 1B7TA 4DV6T 3Q5WA 3HA4A 2WM9A 3PTRB 2YN6A 4GK5E 2YDSA 3LJCA 4UR9A 4KHZF 4ZS2A 1ZV4X 2DL1A 4B3RT 5ABFA 2UXDT 4HWFA 5AINA 3WTLA 3RLFF 2A2FX 4ILUA 3GUAA 3ETVA 5AQUB 2B76A 3QB5A 2Y58A 4YHHT 2XASB 2NW7A 2VVNA 2Y56A 4PW8A 3ANWA 2VL0A 3AXJA 2C9TA 3JC6D 2LJLA 3AE5A 2RA1A 3IBPA 3HR0A 3GWHA 5HEUA 3UFEA 4PIRA 2XNVA 4TWFA 4F8HA 3P4WA 2VVSA 1D0ZA 2CWYA 3Q5EA 1SHZC 4YTPA 4HEAA 1YXRA 2J47A 2WN9A 5JR9C 2C5KT 2CHOA 3B5MA 2XYTA 3C51A 1YW0A 3N9QA 4PAGA 2BZBA 5FJVA 3AA7B 4JEUB 2KSRA 3AE9A 4PJMA 4QXBB 5FL0A 2X9YA 2BYQA 3P50A 3RQUA 5FKYA 4M1PA 3N9PA 4B3TT 3EHZA 2H88A 5M4YA 1YKEB 4DV2T 2ODUA 1G73A 5ADXL 3KV4A 5LG3A 5FY1A 4ZK4A 1KNRA 1UURA 4O4IE 3PDYA 5CJ5A 5TAOA 5FXWA 4H9RC 4JYAT 4HTEA 3RIFA 2KWHA 3AE2A 5HWYA 3ZC0A 2HN1A 2UXXB 2ZM8A 2LKHA 1KEYA 2HPLA 3ZN1B 3ABVA 2KXPB 1IBLT 3HKEE 2BVLA 1UX2A 3E0ZA 4O4HE 1WR0A 4TN7B 4ZS3A 4XBFB 4HE8A 2OLTA 2CLYC 2I0MA 5CB4E 2AE9A 1UK5A 2XSAA 1QUUA 4DO0A 5L3DB 3NZQA 3I1AA 3OYXA 2D2SA 3RYCE 2IUBA 2YU2A 1S35A 1IJ5A 1KF6A 2VL8A 1AJ3A 3EDUA 4DIDB 4CN1A 1E2AA 3RGLA 4B3ST 3QOFA 4LF7T 1YQ4A 3ZCIA 5LGTB 2XAHB 2CBIA 3F2EA 3RIUC 4E7SA 4ZR6A 4QH1A 2LKGA 1MIVA 3QB5K 3ZC1A 2BDEA 5FL1A 4XK9A 2QC1B 3FBZA 4LFBT 3ZN0B 2X00D 5AFJA 2BJ0A 4UVAB 5J2TE 2BG9E 1FJGT 5H6QB 5E0OA 5IUXA 1H7CA 2YU1A 1OEDC 3T4MA 2NTXA 2WDVA 2LOSA 3NBXX 3WAKA 2JPFA 2NTYA 1VOMA 1UGOA 3ZJ1A 4U31A 2UUAT 1X9BA 1I6ZA 5IYZE 1MMGA 3QC9A 4A56A 2BVMA 3CVRA 1WYBA 4ZZCA 3WTJA 2V7KA 4X1KE 1IBKT 2Q9QD 2PGZA 4TUYE 2D0UA 3UUMA 2XAFB 4HFHA 3DP7A 5IHYA 2JMHA 3VRBA 3BQKA 4GK0E 5JRCA 4X20E 2MBGA 2Y8DA 3IHRA 5KZUA 3SFEA 4H9OC 5CA1E 3UUXB 4HFDA 5JDQA 2WZIA 2WU2A 3DTOA 4OK0A 4AI6A 5BW2A 2EHOC 4LF8T 2E2AA 1UX5A 1S94A 3UU8A 1HFAA 1OWAA 5JQGE 3G06A 5AQTB 2D9DA 2NW9A 3FZMB 2WAUA 5FY7A 3CK6A 4X1YE 2Y54A 4KBMB 3T8OA 5FP3A 3WIPA 3O9XA 4IL9A 4ERRA 2CHNA 1OXZA 3WTKA 5AQHB 1MMNA 3AEGA 5JDLA 5JR9B 4AISA 3OBVE 3PMZA 1XZYA 5EK2A 3NRYA 1W0AA 4UV8B 4DV5T 2WQYA 4KI0F 3R84B 2JQKA 5GONE 1XNQT 2W67A 3OPCA 2YOEA 4A5XA 2VK9A 4DV4T 4HFBA 4XHEA 1I9BA 1HX8A 4I4TE 3FHNA 5AFHA 3PJAJ 1HF8A 1KK7A 2DNXA 2CBJA 3LDQB 2X67A 1WCRA 3IF8B 3TLWA 4FRRA 3ONJA 1HNWT 4AQGA 3UUBA 4EXTA 5CA0E 2V7MA 1LVKA 3S4UA 2L3LA 3LG7A 2M6IA 4QKNA 3MA9A 5F3JA 1WRDA 3H3AA 2F4VT 2NP9A 5CO5A 2P9BA 2K3WA 4KP3C 2BR7A 3CWZB 4TWHA 2QGSA 2N9DA 3R6NA 1VCSA 1XMQT 2KMFA 3MK7C 2CLYB 3PJAA 3AB3B 4UXNB 2V26A 4JLEA 1KNZA 4DR6T 1JNZA 2XUEA 4DR2T 4ZK1A 3RKOA 5J5IA 5J5GA 3AVSA 4AKLA 2OA5A 4L0RA 2JIWA 2L9QA 3AA0B 3N5LA 5JTGA 2VKJA 2HHHT 3KDSE 5LA6E 4PFPA 2E5VA 1XWMA 5AFMB 3Q5XA 4MHCA 2C5IT 4UF0B 1YKHB 2BS2A 3KBUA 1OEDB 2QYWA 3BK9A 3L3PA 5HWXA 2NR4A 4JUYA 2KLQA 2WU5A 4PK4A 5ABEA 2I59A 3RI5A 1GQEA 4EB6E 3AEFA 4Q25A 2WP9A 3SH1A 2VQET 3VHLA 2RPAA 3U8LA 5L4EA 4CXYA 2K48A 3J7Yq 1BR1A 3RRWA 2C5JA 4LF4T 4HGAA 3UQ4A 3P4RA 3WI3A 2D5UA 3P8CD 4PK6A 4IDNA 2XSBA 2ZLYA 3M65A 4WW0A 3ZSTA 1FMVA 1UCUA 3AAIA 4C91A 4UELA 2IIUA 4IE7A 3RKGA 2EHOB 2XJ7A 2C0SA 4EYYR 4IL4A 4X65T 5F5WA 3RRCA 3IGQA 1N36T 1EZ3A 1Z0PA 4P09A 3UFGA 2IDOB 5AQPB 5C3JA 2LSJA 4JI6T 3CKDA 4K0UA 5HYAA 3RQWA 3K3NA 2QVAA 4ISSA 3ZT5A 1HTJF 2IMLA 1X79A 5HXRA 2JQQA 5C8YE 5LBQB 4OFZA 3PUSA 4BQTA 4G63A 4DVDA 3ZMVB 1J5WA 4ZZBA 3PUZF 4UEMA 1UV6A 1KFYA 4YXDA 4G2AA 3AE7A 2E9XD 2A9UA 1BR0A 2X0YA 4AQFC 2KINB 1XDPA 1KNPA 4FJOA 3E22E 3RIAA 2OV9A 1IZNB 2M6BA 5JDFA 5LYJE 1V9DA 2CEAA 2LM2A 3CIRA 2LE8A 5JREA 4DUZT 2X9XA 3UQ7A 2CPTA 5AFNA 4YFSA 2BBJA 4QAAA 2WMOA 3OTOT 5LMNT 1HCIA 3ZYLA 4HFIA 3L09A 1D0YA 2XQ4A 4IHJE 4TNVA 3UTKA 4X62T 2LSKA 3UU4A 3QNUA 2J4GA 4P0AA 3O4XE 4NXNT 3C4WA 4HQPA 3C4ZA 4XAXB 3FXDB 3X1DA 2XNTA 5L3CB 2W00A 4PK5A 4TZ4C 5AQIB 4ILBA 2Q9QC 3I9WA 2X00A 5KMGP 5LXTE 2ACXA 5JR9A 3B57A 4YJ3E 2VKHA 3IA3A 4AIUA 4ZJSA 3HKCE 4WBOA 4DR5T 2MPKA 5L3GB 2RP4A 3KV6A 5L2LA 4U7IA 5LJMA 5L3EB 2MYSA 3AEBA 3VKGA 3OKQA 4UVBB 1HNXT 2Y6XA 5HXEA 3RHWA 2XZ6A 2ZM6T 5AQVB 2I6HA 3L39A 4B3MT 4DV7T 1OEDE 4YLHA 2XAQB 2VKDA 3SWHA 2BYRA 1M62A 5JDNA 2CE7A 3V5SA 1L0VA 2G0UA 2H7VC 1MIWA 3SQ9A 1ZEEA 2XHEB 2V6YB 2KT9A 3FB2A 1HNZT 4CN6A 4HKAA 3VU7H
chains in the Genus database with same CATH topology
1UW6A 4LMKA 3WIPA 3SIOA 3C79A 3WTIA 5AFNA 3EHZA 4IL9A 4ZR6A 3UQ4A 4QH1A 4QH4A 4ZJTA 5J5HA 4QAAA 3ZDHA 2LKGA 5JMEA 2ZJUA 4XK9A 2QC1B 4UM3A 2X00D 2YN6A 5AFJA 2BJ0A 3WTKA 4HFIA 2Y7YA 2BG9E 5LXBA 2XQ4A 2UZ6A 3UU5A 5IUXA 4TNVA 5LG3A 5CFBA 3TLVA 5TVCA 5BRXA 2WNJA 4ZK4A 3UU4A 1OEDC 4AFTA 4UM3S 5L47A 3T4MA 2MAWA 4ZK1A 5AINA 3WTLA 2XQ3A 4HQPA 3PMZA 2Y57A 5J5FA 5J5IA 4HFEA 4X5TA 5J5GA 3SQ6A 3GUAA 2XZ5A 4IL4A 3WTNA 4LMLA 3RIFA 3IGQA 3U8KA 2XNTA 3JAFA 2BYSA 2WZYA 2BR8A 4NPPA 2YMEA 4UXUA 2PH9A 2WNCA 3UU6A 4ILBA 2Y58A 5HCMA 4EZ1A 2YOEA 3RQWA 4ZZCA 4QACA 2LKHA 3WTJA 4D01A 2X00A 5AFKA 2PGZA 4UM3P 5AFMB 2XQ9A 2XYSA 3EAMA 2Y56A 5HEGA 3WTOA 2BYNA 3LSVA 3ZKRA 4UM1A 4DBMA 3EI0A 4HFHA 5KE4A 4HFBA 4HFCA 3UU3A 4ZJSA 2VL0A 2BG9C 2C9TA 1UX2A 2XNUA 4XHEA 5HEJA 3WTHA 4WV9A 3C84A 4Z90A 1I9BA 2WNLA 4COFA 2W8GA 4TWDA 3ZDGA 4BQTA 1OEDB 3U8JA 5HEUA 5L4HA 4PIRA 2XNVA 4TWFA 4F8HA 4ZZBA 3P4WA 3WTMA 4BFQA 4IREA 4QABA 4B5DA 1UV6A 4A98A 2BG9B 5AFHA 2XZ6A 3RHWA 5KZUA 5AFMA 2XQAA 5HEHA 3RI5A 3TLUA 3U8MA 2ZJVA 2XQ5A 4ILCA 4AFHA 3TLWA 2XQ7A 2WN9A 4HFDA 4QH5A 4FRRA 2YKSA 3TLSA 1OEDE 2XQ6A 2YMDA 3UUBA 3U8NA 3SH1A 2BYRA 2XQ8A 2XYTA 5BP0A 4A97A 3RIAA 1OEDA 5BW2A 5FJVA 2M6BA 2M6IA 4Z91A 5J0ZA 2KSRA 4LMJA 3UU8A 3U8LA 3SQ9A 2W8FA 5L4EA 3TLTA 4NZBA 5HCJA 5CO5A 3PEOA 4ZRUA 4AFGA 2BG9A 5HEOA 2LM2A 2BYQA 2LLYA 4TNWA 5AFLA 3P50A 3RQUA 4ALXA 5SYOA 2BR7A 4ILAA 3JAEA 2Y54A 2BYPA 4UY2A 3UQ7A 4TWHA 3JADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UW6 A;  4LMK A;  3WIP A;  3SIO A;  3C79 A;  3WTI A;  5AFN A;  3EHZ A;  4IL9 A;  4ZR6 A;  3UQ4 A;  4QH1 A;  4QH4 A;  4ZJT A;  5J5H A;  4QAA A;  3ZDH A;  2LKG A;  5JME A;  2ZJU A;  4XK9 A;  2QC1 B;  4UM3 A;  2X00 D;  2YN6 A;  5AFJ A;  2BJ0 A;  3WTK A;  4HFI A;  2Y7Y A;  2BG9 E;  5LXB A;  2XQ4 A;  2UZ6 A;  3UU5 A;  5IUX A;  4TNV A;  5LG3 A;  5CFB A;  3TLV A;  5TVC A;  5BRX A;  2WNJ A;  4ZK4 A;  3UU4 A;  1OED C;  4AFT A;  4UM3 S;  5L47 A;  3T4M A;  2MAW A;  4ZK1 A;  5AIN A;  3WTL A;  2XQ3 A;  4HQP A;  3PMZ A;  2Y57 A;  5J5F A;  5J5I A;  4HFE A;  4X5T A;  5J5G A;  3SQ6 A;  3GUA A;  2XZ5 A;  4IL4 A;  3WTN A;  4LML A;  3RIF A;  3IGQ A;  3U8K A;  2XNT A;  3JAF A;  2BYS A;  2WZY A;  2BR8 A;  4NPP A;  2YME A;  4UXU A;  2PH9 A;  2WNC A;  3UU6 A;  4ILB A;  2Y58 A;  5HCM A;  4EZ1 A;  2YOE A;  3RQW A;  4ZZC A;  4QAC A;  2LKH A;  3WTJ A;  4D01 A;  2X00 A;  5AFK A;  2PGZ A;  4UM3 P;  5AFM B;  2XQ9 A;  2XYS A;  3EAM A;  2Y56 A;  5HEG A;  3WTO A;  2BYN A;  3LSV A;  3ZKR A;  4UM1 A;  4DBM A;  3EI0 A;  4HFH A;  5KE4 A;  4HFB A;  4HFC A;  3UU3 A;  4ZJS A;  2VL0 A;  2BG9 C;  2C9T A;  1UX2 A;  2XNU A;  4XHE A;  5HEJ A;  3WTH A;  4WV9 A;  3C84 A;  4Z90 A;  1I9B A;  2WNL A;  4COF A;  2W8G A;  4TWD A;  3ZDG A;  4BQT A;  1OED B;  3U8J A;  5HEU A;  5L4H A;  4PIR A;  2XNV A;  4TWF A;  4F8H A;  4ZZB A;  3P4W A;  3WTM A;  4BFQ A;  4IRE A;  4QAB A;  4B5D A;  1UV6 A;  4A98 A;  2BG9 B;  5AFH A;  2XZ6 A;  3RHW A;  5KZU A;  5AFM A;  2XQA A;  5HEH A;  3RI5 A;  3TLU A;  3U8M A;  2ZJV A;  2XQ5 A;  4ILC A;  4AFH A;  3TLW A;  2XQ7 A;  2WN9 A;  4HFD A;  4QH5 A;  4FRR A;  2YKS A;  3TLS A;  1OED E;  2XQ6 A;  2YMD A;  3UUB A;  3U8N A;  3SH1 A;  2BYR A;  2XQ8 A;  2XYT A;  5BP0 A;  4A97 A;  3RIA A;  1OED A;  5BW2 A;  5FJV A;  2M6B A;  2M6I A;  4Z91 A;  5J0Z A;  2KSR A;  4LMJ A;  3UU8 A;  3U8L A;  3SQ9 A;  2W8F A;  5L4E A;  3TLT A;  4NZB A;  5HCJ A;  5CO5 A;  3PEO A;  4ZRU A;  4AFG A;  2BG9 A;  5HEO A;  2LM2 A;  2BYQ A;  2LLY A;  4TNW A;  5AFL A;  3P50 A;  3RQU A;  4ALX A;  5SYO A;  2BR7 A;  4ILA A;  3JAE A;  2Y54 A;  2BYP A;  4UY2 A;  3UQ7 A;  4TWH A;  3JAD A; 
#chains in the Genus database with same CATH topology
 3ZJ2 A;  3ONX A;  5AQQ B;  3WTI A;  4P0B A;  5JME A;  5H6R B;  4B6X A;  2PJQ A;  3AAA B;  3LK3 B;  4YSX A;  1ZOY A;  3D0T A;  3UU5 A;  2UZ6 A;  4YSZ A;  3V5U A;  2CCQ A;  4PNI A;  3AE4 A;  1JNR A;  3KVA A;  3AVR A;  4V1A v;  1MMD A;  2HN2 A;  4HFE A;  3AAE B;  3NKZ A;  2XZ5 A;  3UUN A;  5LG4 A;  2BR8 A;  2LRK A;  5LNK A;  4QAC A;  1N34 T;  2JQH A;  1VRB A;  4ASK A;  5J1G A;  2XQY A;  5KE4 A;  3GN5 A;  2N2N A;  4WV9 A;  4Z90 A;  4ANJ A;  3PUA A;  4ZI2 D;  3CQX C;  3ZSS A;  4IRE A;  4J2C A;  3RIU A;  5F8P A;  3UUL A;  5AFM A;  4HWH A;  4L9I A;  4ILC A;  3U78 A;  2XQ7 A;  5C2T A;  4UF0 A;  3FZK B;  1QSD A;  1OED A;  2Z6E A;  3C4X A;  5LCY A;  3FBL A;  2L8K A;  4U2Z A;  3ZLI A;  2IC6 A;  4DR3 T;  3PEO A;  4LFA T;  4P1N A;  4WYV A;  4AXP A;  5KX5 E;  1FIO A;  4TX5 A;  5HXC A;  4BJM A;  2H3R A;  2CXD A;  3KIN B;  4WNK A;  2ACZ A;  3ZT6 A;  2UXN B;  4JI5 T;  4H9P C;  4IE5 A;  3C50 A;  2WZH A;  4U2Y A;  5AQM B;  1T72 A;  2MTQ A;  5CFB A;  3AED A;  3CPZ A;  4UM3 S;  4CQI A;  5L47 A;  5ABH A;  5J5F A;  4O4L E;  2V1D B;  2JQ9 A;  1D0X A;  2UUC T;  3WAJ A;  4LML A;  3AEC A;  3ESL A;  2PBI A;  5HXS A;  2BYS A;  4JI3 T;  2IC9 A;  3UU6 A;  2PFV A;  3RYH E;  1HG5 A;  3CQC B;  4YT0 A;  2XYS A;  3EAM A;  3O1I A;  4ZI3 D;  2UXC T;  2LSG A;  4GIW A;  2EHO A;  5FXX A;  1R8I A;  5JH7 E;  3WTH A;  2LSI A;  5FVK A;  3K8P C;  2BS3 A;  4LF5 T;  2DWK A;  2DI4 A;  2DHR A;  3MJX A;  4QAB A;  4ZI7 E;  4A98 A;  3A8Y C;  2JMK A;  2NOX A;  3J9X 1;  3Q9D A;  4U74 A;  2YDQ A;  2NW8 A;  2WMN A;  2YKS A;  3TLS A;  2Q9Q B;  3A7M A;  5BP0 A;  4GKJ T;  2W2U A;  4PJL A;  1NWM X;  1QLB A;  3ZMS B;  4K0K T;  4AKR B;  2KWI B;  5KDM C;  5LHI B;  2LOP A;  2VUR A;  3CML A;  1SE7 A;  4FI5 A;  2CRB A;  3L8R A;  4LMK A;  5FNV E;  4GYR A;  1LKX A;  4O8S A;  2WS3 A;  3W15 B;  3KVB A;  1NEK A;  4IE6 A;  4UIG A;  3TLV A;  2ZMA A;  5TVC A;  3PE0 A;  2V6X A;  1XDO A;  2LHR A;  3SOL A;  2FJE A;  3CX8 B;  1YQ3 A;  3U8K A;  4AKH A;  5IWA T;  2LRL A;  4OHF A;  4UM1 A;  3C64 A;  3GN5 B;  4QX8 B;  2X0L B;  1SUM B;  3AEA A;  3Q2M A;  5AQS B;  5L3B B;  2VQF T;  2W8G A;  2ZM0 A;  2J1D G;  3MZK B;  2FJD A;  2UUB T;  4OYJ A;  3ZMT B;  1Z8U A;  4DND A;  3HKB E;  5AQR B;  5JVD E;  3TLU A;  3JC6 C;  2A3D A;  5DQW A;  3U8N A;  3BQI A;  3NWI A;  2E8I A;  1BR4 A;  5AFU L;  1FMW A;  3ONL C;  4QX7 B;  5HCJ A;  3T1Y T;  5AQO B;  2WY2 A;  4H9N C;  4MBQ A;  5HXH A;  4BJN A;  2PG8 A;  2MOZ A;  4X66 T;  3N9N A;  2UXB T;  1CHU A;  1IAP A;  2Y7Y A;  5AQN B;  4U72 A;  1HR0 T;  2V6Y A;  4MFR A;  3I0O A;  3SRZ A;  2WNJ A;  5BRX A;  1I94 T;  2IAK A;  3OVU A;  3I0Q A;  2J62 A;  3FZL B;  1E1H B;  3ZMU B;  1G8X A;  2ES0 A;  2XAG B;  5JDM A;  3T1H T;  3QK6 A;  3JAF A;  2YME A;  4IIJ E;  5DAB A;  2PH9 A;  1M7K A;  5KXJ A;  2X66 A;  4YTN A;  3AA6 B;  3LSV A;  5CGM A;  3FZF B;  4CN4 A;  1W9R A;  3OYZ A;  3C84 A;  4KUM B;  3FZH B;  2V7J A;  4GOU A;  4IDZ A;  2A72 A;  2CA5 A;  2BG9 B;  3AE8 A;  2UU9 T;  4YHJ A;  1D1A A;  1O3X A;  4NXM T;  3SS1 A;  3U8M A;  4KMC A;  4PJJ A;  5DJQ C;  3AA1 B;  3VKH A;  4YSY A;  4WBN E;  2CWO A;  5FYM A;  2X0H A;  4LMJ A;  2B1E A;  2W8F A;  4WZX A;  2WWV A;  4NZB A;  5HEO A;  4N78 D;  4X64 T;  4HWC A;  3JAD A;  4JI7 T;  1UW6 A;  4H63 H;  3SIO A;  3LBX B;  4QH4 A;  3C98 B;  2AXD S;  1WYC A;  3ZYM A;  4JI0 T;  4DMV A;  2H7O A;  5LXB A;  5A1L A;  4I55 E;  4JBW F;  5AQL B;  1W0B A;  2D0T A;  3CQG B;  4JV5 T;  4I43 B;  4AFT A;  3EVY A;  3HL6 A;  2CM0 A;  1W09 A;  4LF9 T;  2CMR A;  2DCF A;  2KZ7 B;  2WBL A;  3NZP A;  3EDV A;  3SFD A;  2X51 A;  3QUJ A;  2JRK A;  4NUV A;  5FXZ A;  3ETU A;  5HCM A;  2XY8 B;  4DR1 T;  4JI8 T;  4AQF A;  2H89 A;  3WTO A;  1CUN A;  5EK4 A;  3EI0 A;  4ZI2 C;  4GYS A;  3K3O A;  5ABG A;  5HEJ A;  1SA0 E;  5L3F B;  2WNL A;  4LFC T;  4TWD A;  2WB5 A;  2W63 A;  1XNR T;  4MAL A;  4YJ2 E;  4Z8X A;  1UUS A;  1BR2 A;  1NAF A;  2WDR A;  5EK3 A;  1U4Q A;  1NEN A;  3CX6 B;  2KND A;  3Q5D A;  2V7I A;  1IJ6 A;  4CI1 B;  3JCF A;  4U33 A;  2YEV C;  4GKK T;  3VR9 A;  4ZXL A;  4ZRU A;  4AFG A;  3H37 A;  4CI2 B;  5AFL A;  5SYO A;  3RX6 A;  3O1H A;  2WWU A;  2ZM2 A;  3B13 A;  2BYP A;  4UY2 A;  1Y01 A;  5ETW A;  3RYI E;  2LT3 A;  2XTL A;  4IDP A;  2WCA A;  4ZJT A;  2Q9Q A;  4O2B E;  2E9X B;  4LF6 T;  4UM3 A;  4QXH B;  4I50 E;  5EZY E;  4EZ4 A;  5J2U E;  4JI4 T;  5LGU B;  3CX7 B;  2LM9 A;  2XQ3 A;  2NWB A;  4X5T A;  3VRA A;  3PUX F;  3WTN A;  1N32 T;  2GK9 A;  4ZEY A;  3VR8 A;  4L5G A;  4IE4 A;  2WNC A;  4EZ1 A;  3EAB A;  4ADZ A;  4ZI3 C;  4KHP T;  4DBR A;  4UM3 P;  2QRX A;  5LOV E;  3BQL A;  5HEG A;  2BYN A;  4DBM A;  4HWD A;  3KV9 A;  3NVO A;  4HFV A;  2W4X A;  3PUW F;  4COF A;  4U3C A;  3U8J A;  4CI3 B;  3RF1 A;  3RPU A;  5BMV E;  4ZOL E;  3WTM A;  4TV9 E;  1T8B A;  2Y48 B;  5DQV A;  4F6R C;  2LEH A;  3I9Y A;  2ZJV A;  2XQ5 A;  5LGN B;  4DV3 T;  4AFH A;  2YMD A;  2DWG A;  4MLK A;  3F57 A;  5HAX A;  3AE6 A;  3PUG A;  2K24 A;  4DV1 T;  4EIW A;  5ABF B;  3JAE A;  2W61 A;  2V7L A;  3N9L A;  3N9O A;  4CXW A;  3C79 A;  5J5H A;  4EED A;  2K9A A;  2ZJU A;  4OYK A;  1HS7 A;  2V5D A;  4DMW A;  3RYF E;  4I0U A;  3O1J A;  2W0G A;  3IEE A;  4O4J E;  1XMO T;  4HWI B;  2X9W A;  2XM1 A;  3ANW B;  3LFM A;  4IE0 A;  2Y57 A;  4IDQ A;  3AXJ B;  4YTM A;  2LSY A;  4HN9 A;  3N9M A;  4H9Q C;  2VB6 A;  3MKD A;  3PU3 A;  4CZZ B;  1VCT A;  4NPP A;  3PUQ A;  2SPC A;  4IST A;  1Y64 B;  3H3M A;  2VWA A;  3ZCJ A;  3ZEF B;  3P4S A;  3PU8 A;  3ZMZ B;  3ZT7 A;  1ZKE A;  3UU3 A;  3MXZ A;  2BG9 C;  3P7I A;  2XNU A;  4TV8 E;  1J1J A;  3N2G E;  4IDO A;  1MNE A;  5AQG B;  5L4H A;  4XZC A;  4BA9 A;  3KBT A;  3HI2 A;  4B5D A;  2XZE A;  3RH3 A;  5FXV A;  4KX6 A;  4EV6 A;  2V5C A;  1U5P A;  2X68 A;  2W66 A;  5AQJ B;  4A97 A;  4JI1 T;  4PFO A;  1ZP0 A;  4PJN A;  5J0Z A;  5FY0 A;  3AE3 A;  4BAY B;  2BG9 A;  5LHH B;  2LLY A;  1ZHC A;  4ALX A;  4ILA A;  4AQY T;  4JI2 T;  4O2A E;  2CXF A;  3ZYK A;  3PUV F;  4EAH A;  1HX1 B;  3U3I A;  2ODV A;  2FBW A;  1T7S A;  3GA8 A;  2YK0 A;  3A5X A;  4EZH A;  3F31 A;  4QHO A;  3M3Z B;  1LRZ A;  5BR8 T;  4E7Z A;  2VAS A;  2BKP A;  5JDH A;  4C90 A;  3LBX A;  3SQ6 A;  4EOZ B;  3AEE A;  3PUR A;  1E7P A;  2CXL A;  1UX4 A;  2XAJ B;  2K5B B;  3NRX A;  1D1B A;  2VKO A;  3KFW X;  5AFK A;  4X1I E;  2LHN A;  3RC8 A;  2XQ9 A;  2HPJ A;  3N2O A;  1IBM T;  3ZKR A;  3K3Q C;  3K1S A;  4HFC A;  4UVC B;  3FXE B;  3P4Q A;  3RC3 A;  4EEB A;  3ZDG A;  1DU2 A;  2PTF A;  2YDR A;  1WLX A;  4BFQ A;  3OJA A;  2XM2 A;  5AQK B;  2R6G F;  2XPK A;  5HEH A;  4U7Y A;  3GMI A;  4OX9 T;  5LBM A;  4YY3 T;  4QH5 A;  1MND A;  2XQ6 A;  2XQ8 A;  2BS4 A;  3ZPO A;  4DBQ A;  4EYU A;  2FJA A;  4QXC B;  1J5E T;  3TLT A;  1LVF A;  2DLR A;  2EHO D;  2E9X C;  4IT4 A;  5JDG A;  5LHG B;  5FMN A;  2M67 A;  4NIQ A;  3AE1 A;  3ZDH A;  2BBH A;  5FVL A;  1N33 T;  2JJ9 A;  4DV0 T;  2HH7 A;  3PV0 F;  4H9S E;  3MAC A;  3TKL B;  2FUP A;  2MAW A;  3KV5 A;  3P4P A;  2E9X A;  5AQF B;  3DJB A;  3HKD E;  2WZY A;  4UXU A;  1MMA A;  5JRC B;  4NUU A;  3EUH A;  2BKO A;  2FJB A;  5LB7 B;  4D01 A;  3PUY F;  2IW5 B;  1T98 A;  4ZHQ E;  1MIY A;  2QA7 A;  2IHR 1;  2E5L T;  3LK2 B;  4JEH B;  2WDQ A;  4IGU A;  3N2K E;  1YD8 G;  2V8S V;  2X9H A;  4DUY T;  3LK4 2;  1WFD A;  4UV9 B;  2XQA A;  4EGW A;  2W62 A;  5LJN A;  2BKN A;  1HG2 A;  3UT5 E;  4AKG A;  2YIN A;  2N1G A;  4DR4 T;  4Z91 A;  1WR6 A;  5LP6 E;  1D1C A;  1FEW A;  2WSS V;  4CXX A;  1US7 B;  4QWN B;  4TNW A;  4DR7 T;  3E08 A;  4AKI A;  5LMU T;  4H63 V;  1B7T A;  4DV6 T;  3Q5W A;  3HA4 A;  2WM9 A;  3PTR B;  2YN6 A;  4GK5 E;  2YDS A;  3LJC A;  4UR9 A;  4KHZ F;  4ZS2 A;  1ZV4 X;  2DL1 A;  4B3R T;  5ABF A;  2UXD T;  4HWF A;  5AIN A;  3WTL A;  3RLF F;  2A2F X;  4ILU A;  3GUA A;  3ETV A;  5AQU B;  2B76 A;  3QB5 A;  2Y58 A;  4YHH T;  2XAS B;  2NW7 A;  2VVN A;  2Y56 A;  4PW8 A;  3ANW A;  2VL0 A;  3AXJ A;  2C9T A;  3JC6 D;  2LJL A;  3AE5 A;  2RA1 A;  3IBP A;  3HR0 A;  3GWH A;  5HEU A;  3UFE A;  4PIR A;  2XNV A;  4TWF A;  4F8H A;  3P4W A;  2VVS A;  1D0Z A;  2CWY A;  3Q5E A;  1SHZ C;  4YTP A;  4HEA A;  1YXR A;  2J47 A;  2WN9 A;  5JR9 C;  2C5K T;  2CHO A;  3B5M A;  2XYT A;  3C51 A;  1YW0 A;  3N9Q A;  4PAG A;  2BZB A;  5FJV A;  3AA7 B;  4JEU B;  2KSR A;  3AE9 A;  4PJM A;  4QXB B;  5FL0 A;  2X9Y A;  2BYQ A;  3P50 A;  3RQU A;  5FKY A;  4M1P A;  3N9P A;  4B3T T;  3EHZ A;  2H88 A;  5M4Y A;  1YKE B;  4DV2 T;  2ODU A;  1G73 A;  5ADX L;  3KV4 A;  5LG3 A;  5FY1 A;  4ZK4 A;  1KNR A;  1UUR A;  4O4I E;  3PDY A;  5CJ5 A;  5TAO A;  5FXW A;  4H9R C;  4JYA T;  4HTE A;  3RIF A;  2KWH A;  3AE2 A;  5HWY A;  3ZC0 A;  2HN1 A;  2UXX B;  2ZM8 A;  2LKH A;  1KEY A;  2HPL A;  3ZN1 B;  3ABV A;  2KXP B;  1IBL T;  3HKE E;  2BVL A;  1UX2 A;  3E0Z A;  4O4H E;  1WR0 A;  4TN7 B;  4ZS3 A;  4XBF B;  4HE8 A;  2OLT A;  2CLY C;  2I0M A;  5CB4 E;  2AE9 A;  1UK5 A;  2XSA A;  1QUU A;  4DO0 A;  5L3D B;  3NZQ A;  3I1A A;  3OYX A;  2D2S A;  3RYC E;  2IUB A;  2YU2 A;  1S35 A;  1IJ5 A;  1KF6 A;  2VL8 A;  1AJ3 A;  3EDU A;  4DID B;  4CN1 A;  1E2A A;  3RGL A;  4B3S T;  3QOF A;  4LF7 T;  1YQ4 A;  3ZCI A;  5LGT B;  2XAH B;  2CBI A;  3F2E A;  3RIU C;  4E7S A;  4ZR6 A;  4QH1 A;  2LKG A;  1MIV A;  3QB5 K;  3ZC1 A;  2BDE A;  5FL1 A;  4XK9 A;  2QC1 B;  3FBZ A;  4LFB T;  3ZN0 B;  2X00 D;  5AFJ A;  2BJ0 A;  4UVA B;  5J2T E;  2BG9 E;  1FJG T;  5H6Q B;  5E0O A;  5IUX A;  1H7C A;  2YU1 A;  1OED C;  3T4M A;  2NTX A;  2WDV A;  2LOS A;  3NBX X;  3WAK A;  2JPF A;  2NTY A;  1VOM A;  1UGO A;  3ZJ1 A;  4U31 A;  2UUA T;  1X9B A;  1I6Z A;  5IYZ E;  1MMG A;  3QC9 A;  4A56 A;  2BVM A;  3CVR A;  1WYB A;  4ZZC A;  3WTJ A;  2V7K A;  4X1K E;  1IBK T;  2Q9Q D;  2PGZ A;  4TUY E;  2D0U A;  3UUM A;  2XAF B;  4HFH A;  3DP7 A;  5IHY A;  2JMH A;  3VRB A;  3BQK A;  4GK0 E;  5JRC A;  4X20 E;  2MBG A;  2Y8D A;  3IHR A;  5KZU A;  3SFE A;  4H9O C;  5CA1 E;  3UUX B;  4HFD A;  5JDQ A;  2WZI A;  2WU2 A;  3DTO A;  4OK0 A;  4AI6 A;  5BW2 A;  2EHO C;  4LF8 T;  2E2A A;  1UX5 A;  1S94 A;  3UU8 A;  1HFA A;  1OWA A;  5JQG E;  3G06 A;  5AQT B;  2D9D A;  2NW9 A;  3FZM B;  2WAU A;  5FY7 A;  3CK6 A;  4X1Y E;  2Y54 A;  4KBM B;  3T8O A;  5FP3 A;  3WIP A;  3O9X A;  4IL9 A;  4ERR A;  2CHN A;  1OXZ A;  3WTK A;  5AQH B;  1MMN A;  3AEG A;  5JDL A;  5JR9 B;  4AIS A;  3OBV E;  3PMZ A;  1XZY A;  5EK2 A;  3NRY A;  1W0A A;  4UV8 B;  4DV5 T;  2WQY A;  4KI0 F;  3R84 B;  2JQK A;  5GON E;  1XNQ T;  2W67 A;  3OPC A;  2YOE A;  4A5X A;  2VK9 A;  4DV4 T;  4HFB A;  4XHE A;  1I9B A;  1HX8 A;  4I4T E;  3FHN A;  5AFH A;  3PJA J;  1HF8 A;  1KK7 A;  2DNX A;  2CBJ A;  3LDQ B;  2X67 A;  1WCR A;  3IF8 B;  3TLW A;  4FRR A;  3ONJ A;  1HNW T;  4AQG A;  3UUB A;  4EXT A;  5CA0 E;  2V7M A;  1LVK A;  3S4U A;  2L3L A;  3LG7 A;  2M6I A;  4QKN A;  3MA9 A;  5F3J A;  1WRD A;  3H3A A;  2F4V T;  2NP9 A;  5CO5 A;  2P9B A;  2K3W A;  4KP3 C;  2BR7 A;  3CWZ B;  4TWH A;  2QGS A;  2N9D A;  3R6N A;  1VCS A;  1XMQ T;  2KMF A;  3MK7 C;  2CLY B;  3PJA A;  3AB3 B;  4UXN B;  2V26 A;  4JLE A;  1KNZ A;  4DR6 T;  1JNZ A;  2XUE A;  4DR2 T;  4ZK1 A;  3RKO A;  5J5I A;  5J5G A;  3AVS A;  4AKL A;  2OA5 A;  4L0R A;  2JIW A;  2L9Q A;  3AA0 B;  3N5L A;  5JTG A;  2VKJ A;  2HHH T;  3KDS E;  5LA6 E;  4PFP A;  2E5V A;  1XWM A;  5AFM B;  3Q5X A;  4MHC A;  2C5I T;  4UF0 B;  1YKH B;  2BS2 A;  3KBU A;  1OED B;  2QYW A;  3BK9 A;  3L3P A;  5HWX A;  2NR4 A;  4JUY A;  2KLQ A;  2WU5 A;  4PK4 A;  5ABE A;  2I59 A;  3RI5 A;  1GQE A;  4EB6 E;  3AEF A;  4Q25 A;  2WP9 A;  3SH1 A;  2VQE T;  3VHL A;  2RPA A;  3U8L A;  5L4E A;  4CXY A;  2K48 A;  3J7Y q;  1BR1 A;  3RRW A;  2C5J A;  4LF4 T;  4HGA A;  3UQ4 A;  3P4R A;  3WI3 A;  2D5U A;  3P8C D;  4PK6 A;  4IDN A;  2XSB A;  2ZLY A;  3M65 A;  4WW0 A;  3ZST A;  1FMV A;  1UCU A;  3AAI A;  4C91 A;  4UEL A;  2IIU A;  4IE7 A;  3RKG A;  2EHO B;  2XJ7 A;  2C0S A;  4EYY R;  4IL4 A;  4X65 T;  5F5W A;  3RRC A;  3IGQ A;  1N36 T;  1EZ3 A;  1Z0P A;  4P09 A;  3UFG A;  2IDO B;  5AQP B;  5C3J A;  2LSJ A;  4JI6 T;  3CKD A;  4K0U A;  5HYA A;  3RQW A;  3K3N A;  2QVA A;  4ISS A;  3ZT5 A;  1HTJ F;  2IML A;  1X79 A;  5HXR A;  2JQQ A;  5C8Y E;  5LBQ B;  4OFZ A;  3PUS A;  4BQT A;  4G63 A;  4DVD A;  3ZMV B;  1J5W A;  4ZZB A;  3PUZ F;  4UEM A;  1UV6 A;  1KFY A;  4YXD A;  4G2A A;  3AE7 A;  2E9X D;  2A9U A;  1BR0 A;  2X0Y A;  4AQF C;  2KIN B;  1XDP A;  1KNP A;  4FJO A;  3E22 E;  3RIA A;  2OV9 A;  1IZN B;  2M6B A;  5JDF A;  5LYJ E;  1V9D A;  2CEA A;  2LM2 A;  3CIR A;  2LE8 A;  5JRE A;  4DUZ T;  2X9X A;  3UQ7 A;  2CPT A;  5AFN A;  4YFS A;  2BBJ A;  4QAA A;  2WMO A;  3OTO T;  5LMN T;  1HCI A;  3ZYL A;  4HFI A;  3L09 A;  1D0Y A;  2XQ4 A;  4IHJ E;  4TNV A;  3UTK A;  4X62 T;  2LSK A;  3UU4 A;  3QNU A;  2J4G A;  4P0A A;  3O4X E;  4NXN T;  3C4W A;  4HQP A;  3C4Z A;  4XAX B;  3FXD B;  3X1D A;  2XNT A;  5L3C B;  2W00 A;  4PK5 A;  4TZ4 C;  5AQI B;  4ILB A;  2Q9Q C;  3I9W A;  2X00 A;  5KMG P;  5LXT E;  2ACX A;  5JR9 A;  3B57 A;  4YJ3 E;  2VKH A;  3IA3 A;  4AIU A;  4ZJS A;  3HKC E;  4WBO A;  4DR5 T;  2MPK A;  5L3G B;  2RP4 A;  3KV6 A;  5L2L A;  4U7I A;  5LJM A;  5L3E B;  2MYS A;  3AEB A;  3VKG A;  3OKQ A;  4UVB B;  1HNX T;  2Y6X A;  5HXE A;  3RHW A;  2XZ6 A;  2ZM6 T;  5AQV B;  2I6H A;  3L39 A;  4B3M T;  4DV7 T;  1OED E;  4YLH A;  2XAQ B;  2VKD A;  3SWH A;  2BYR A;  1M62 A;  5JDN A;  2CE7 A;  3V5S A;  1L0V A;  2G0U A;  2H7V C;  1MIW A;  3SQ9 A;  1ZEE A;  2XHE B;  2V6Y B;  2KT9 A;  3FB2 A;  1HNZ T;  4CN6 A;  4HKA A;  3VU7 H; 
#chains in the Genus database with same CATH homology
 1UW6 A;  4LMK A;  3WIP A;  3SIO A;  3C79 A;  3WTI A;  5AFN A;  3EHZ A;  4IL9 A;  4ZR6 A;  3UQ4 A;  4QH1 A;  4QH4 A;  4ZJT A;  5J5H A;  4QAA A;  3ZDH A;  2LKG A;  5JME A;  2ZJU A;  4XK9 A;  2QC1 B;  4UM3 A;  2X00 D;  2YN6 A;  5AFJ A;  2BJ0 A;  3WTK A;  4HFI A;  2Y7Y A;  2BG9 E;  5LXB A;  2XQ4 A;  2UZ6 A;  3UU5 A;  5IUX A;  4TNV A;  5LG3 A;  5CFB A;  3TLV A;  5TVC A;  5BRX A;  2WNJ A;  4ZK4 A;  3UU4 A;  1OED C;  4AFT A;  4UM3 S;  5L47 A;  3T4M A;  2MAW A;  4ZK1 A;  5AIN A;  3WTL A;  2XQ3 A;  4HQP A;  3PMZ A;  2Y57 A;  5J5F A;  5J5I A;  4HFE A;  4X5T A;  5J5G A;  3SQ6 A;  3GUA A;  2XZ5 A;  4IL4 A;  3WTN A;  4LML A;  3RIF A;  3IGQ A;  3U8K A;  2XNT A;  3JAF A;  2BYS A;  2WZY A;  2BR8 A;  4NPP A;  2YME A;  4UXU A;  2PH9 A;  2WNC A;  3UU6 A;  4ILB A;  2Y58 A;  5HCM A;  4EZ1 A;  2YOE A;  3RQW A;  4ZZC A;  4QAC A;  2LKH A;  3WTJ A;  4D01 A;  2X00 A;  5AFK A;  2PGZ A;  4UM3 P;  5AFM B;  2XQ9 A;  2XYS A;  3EAM A;  2Y56 A;  5HEG A;  3WTO A;  2BYN A;  3LSV A;  3ZKR A;  4UM1 A;  4DBM A;  3EI0 A;  4HFH A;  5KE4 A;  4HFB A;  4HFC A;  3UU3 A;  4ZJS A;  2VL0 A;  2BG9 C;  2C9T A;  1UX2 A;  2XNU A;  4XHE A;  5HEJ A;  3WTH A;  4WV9 A;  3C84 A;  4Z90 A;  1I9B A;  2WNL A;  4COF A;  2W8G A;  4TWD A;  3ZDG A;  4BQT A;  1OED B;  3U8J A;  5HEU A;  5L4H A;  4PIR A;  2XNV A;  4TWF A;  4F8H A;  4ZZB A;  3P4W A;  3WTM A;  4BFQ A;  4IRE A;  4QAB A;  4B5D A;  1UV6 A;  4A98 A;  2BG9 B;  5AFH A;  2XZ6 A;  3RHW A;  5KZU A;  5AFM A;  2XQA A;  5HEH A;  3RI5 A;  3TLU A;  3U8M A;  2ZJV A;  2XQ5 A;  4ILC A;  4AFH A;  3TLW A;  2XQ7 A;  2WN9 A;  4HFD A;  4QH5 A;  4FRR A;  2YKS A;  3TLS A;  1OED E;  2XQ6 A;  2YMD A;  3UUB A;  3U8N A;  3SH1 A;  2BYR A;  2XQ8 A;  2XYT A;  5BP0 A;  4A97 A;  3RIA A;  1OED A;  5BW2 A;  5FJV A;  2M6B A;  2M6I A;  4Z91 A;  5J0Z A;  2KSR A;  4LMJ A;  3UU8 A;  3U8L A;  3SQ9 A;  2W8F A;  5L4E A;  3TLT A;  4NZB A;  5HCJ A;  5CO5 A;  3PEO A;  4ZRU A;  4AFG A;  2BG9 A;  5HEO A;  2LM2 A;  2BYQ A;  2LLY A;  4TNW A;  5AFL A;  3P50 A;  3RQU A;  4ALX A;  5SYO A;  2BR7 A;  4ILA A;  3JAE A;  2Y54 A;  2BYP A;  4UY2 A;  3UQ7 A;  4TWH A;  3JAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...