2XQ9A

Pentameric ligand gated ion channel glic mutant e221a in complex with tetraethylarsonium (teas)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYDANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
total genus 85
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq9A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq9A01
4ILAA 2BYRA 4UM3A 2M6BA 3ZDGA 3WTHA 3RI5A 3TLTA 4TNWA 4ZZCA 2XQ7A 2WNJA 2XQ8A 4AFTA 3RQUA 4UM3S 2M6IA 3U8LA 5L4EA 3UQ7A 2YMEA 4IL4A 3SQ9A 2BYPA 4TNVA 3U8KA 1UW6A 4HFDA 4WV9A 4ZJTA 2BG9E 5J5FA 3JADA 5LG3A 4ZZBA 5HEJA 2C9TA 4BQTA 4BFQA 5BRXA 3ZDHA 2W8GA 4B5DA 2LKGA 5HEUA 4TWHA 2XNUA 5J5IA 5HEOA 3UU3A 3UUBA 2BR8A 3IGQA 5L47A 5FJVA 4XHEA 5BP0A 5AFMB 2BG9B 2XNTA 2LKHA 3T4MA 3TLWA 5AINA 4PIRA 2BR7A 2YKSA 4IREA 3U8NA 5J5GA 4ILBA 4EZ1A 4LMKA 3RQWA 3C79A 5JMEA 2LM2A 2YOEA 3UU6A 5KZUA 2WZYA 2Y54A 3JAEA 4HFEA 4ZK1A 4ZJSA 1I9BA 2WNCA 4ZK4A 4HFHA 3RHWA 4QACA 4QH1A 4IL9A 2XQAA 4A98A 4UXUA 4LMJA 3WIPA 5AFJA 2PGZA 2Y58A 1OEDB 2BYQA 3UU8A 3C84A 5AFLA 5SYOA 2X00D 2W8FA 3RIFA 2BG9C 5HEGA 5HCMA 3GUAA 4HQPA 3U8MA 5TVCA 2WN9A 4F8HA 2XYSA 3PEOA 4XK9A 1OEDE 4AFGA 3EHZA 3EI0A 4ALXA 3TLSA 3PMZA 2BYNA 3UQ4A 2VL0A 5CO5A 4UM1A 5AFKA 2XQ9A 3EAMA 3WTOA 2MAWA 3LSVA 4Z91A 4X5TA 2XQ3A 1UV6A 4DBMA 2YN6A 4UM3P 5LXBA 3WTIA 4COFA 2X00A 4LMLA 3P50A 4QH4A 3U8JA 3RIAA 2WNLA 3TLVA 3WTMA 2BYSA 4HFIA 2XYTA 2ZJUA 5AFMA 4D01A 4QABA 3JAFA 4NPPA 5KE4A 2KSRA 2YMDA 5HEHA 2BG9A 4UY2A 2QC1B 3WTLA 4FRRA 3WTKA 5HCJA 3TLUA 4QAAA 4AFHA 3ZKRA 2XQ5A 2UZ6A 2XQ4A 4TWFA 5AFNA 2LLYA 5L4HA 2ZJVA 3WTJA 1UX2A 2BJ0A 2Y57A 3P4WA 3SIOA 3WTNA 5J0ZA 4NZBA 4ZR6A 4Z90A 4HFBA 2XZ6A 4ILCA 4QH5A 3SH1A 2Y56A 2Y7YA 2XZ5A 4TWDA 5CFBA 2PH9A 3UU5A 2XQ6A 3SQ6A 5J5HA 5AFHA 5BW2A 1OEDA 1OEDC 4HFCA 5IUXA 4ZRUA 2XNVA 4A97A 3UU4A
chains in the Genus database with same CATH superfamily
1UUSA 3U8LA 1HNWT 1L0VA 2C5JA 4ZJTA 4O4HE 2VWAA 1LVFA 5F3JA 5JH7E 3PTRB 3UUBA 1UK5A 4ZI2C 1YQ4A 2BG9B 1VOMA 3MK7C 5FKYA 2UUCT 2WZYA 5CB4E 3GWHA 2V6YB 1T72A 4H9RC 2ODVA 2AXDS 3OYZA 2LM9A 2JQKA 2D0TA 3H3AA 2CXFA 2Q9QB 3GUAA 2X66A 1S94A 2ZLYA 2UXDT 2PTFA 4X5TA 3P7IA 3AAEB 3CK6A 3B57A 3ANWB 3RIAA 1ZEEA 3OBVE 3NZQA 5J1GA 4AXPA 3LJCA 1N34T 2XQ5A 2C5KT 4TWFA 3ZYKA 3PUQA 4YXDA 2P9BA 2B1EA 2V7MA 2Y56A 4EYYR 4P0AA 4PNIA 5FL1A 2E8IA 1BR1A 5FVLA 3LBXA 1UGOA 2CBJA 3C98B 4AKIA 3KDSE 4YT0A 3R6NA 2X9YA 2VKOA 3HL6A 5EK2A 2C0SA 4WBNE 3PDYA 2MBGA 1J5ET 2XAGB 5JVDE 5ABFB 1YKHB 4HTEA 5ABFA 2LSYA 3U3IA 5IWAT 2FJDA 5HXHA 4YHHT 4KBMB 4ZI3C 3GN5B 3UTKA 5J5GA 5TAOA 3JAEA 2X9HA 3C64A 4JI8T 1D0ZA 4DV5T 2V7JA 5LBMA 5BMVE 2JQ9A 1QLBA 4TX5A 4KUMB 2X0HA 5LMNT 2XTLA 1OEDE 5DQWA 2LHRA 3CMLA 2IC6A 3Q9DA 4ADZA 2LOPA 1XZYA 3AXJA 1MIWA 2ZJUA 4MFRA 4DMWA 1IBMT 2WQYA 5KE4A 4N78D 2E9XB 2NW9A 2XQ4A 2XM1A 2K24A 2V6XA 2CXDA 4NXNT 4ZR6A 5FXVA 3AE1A 3LBXB 2XM2A 3M3ZB 4ERRA 4DIDB 4UVAB 2XQ6A 3VRAA 5BW2A 4B3MT 3CQXC 4ZI3D 4DV1T 3EUHA 1HF8A 2CLYB 2KWHA 5DABA 4UM3A 2M6BA 3WTHA 2Q9QA 3ZC1A 4UM3S 4PFOA 1HX8A 3Q5EA 2BG9E 4UVBB 3V5SA 2X9XA 5AQNB 4H9OC 1G8XA 3SRZA 5J2UE 2N9DA 2XPKA 4I43B 4YY3T 3IGQA 2XAQB 3ZN0B 3X1DA 2UXBT 3LK42 2KZ7B 5KX5E 4GK0E 1HNZT 4YSXA 1YD8G 5FVKA 3GA8A 5HEGA 5HCMA 1MMGA 5L3BB 4L5GA 3PEOA 4AFGA 2WS3A 1IBLT 2V7KA 1X79A 5KDMC 4CI2B 4EOZB 3OYXA 1XDPA 1YW0A 3B5MA 4WW0A 4D01A 2KSRA 4OK0A 3WTLA 5HCJA 2V6YA 2UZ6A 2FBWA 2BDEA 5AQVB 4DR7T 4KHZF 3C4XA 3ESLA 4MALA 4DO0A 5CFBA 4L9IA 3BK9A 1W0AA 3LK3B 4GKKT 4MBQA 2DWGA 4AISA 2FUPA 1ZOYA 3IA3A 3TLTA 4AFTA 2CCQA 1Z0PA 2NTYA 2XAFB 4KP3C 4WV9A 1NWMX 5C8YE 3EABA 3AE3A 3PUXF 4YLHA 3PU8A 3AEFA 4BQTA 2I59A 4OYJA 2IUBA 5HEUA 2YDRA 4X1KE 5HEOA 2DLRA 4CN4A 3F2EA 4BJMA 4AQFA 4IREA 3RQWA 3AVRA 2LM2A 2MOZA 4U3CA 3DTOA 2NR4A 3C4ZA 5LXTE 1IAPA 4ZOLE 2PGZA 3AAIA 5AQUB 1MIVA 5HAXA 2V8SV 4QWNB 4UV8B 2XHEB 3VR8A 5AQGB 3PUSA 2D9DA 2IHR1 2IAKA 5JDNA 4Z91A 4AQGA 4DR5T 3ETUA 4DV7T 4XZCA 3H37A 2WU5A 5E0OA 3ZJ2A 3IEEA 4CXWA 4DV3T 2JQHA 2YDSA 4FJOA 3AEAA 4M1PA 2YMDA 2UXXB 2CPTA 4YJ2E 5L3EB 3A5XA 5L2LA 3SH1A 5GONE 3RYCE 3MKDA 3SQ6A 1W0BA 2MTQA 2Y6XA 2FJBA 2C5IT 4HFCA 4DNDA 4YTNA 2WNJA 2YMEA 3SQ9A 4EIWA 3JADA 4ZZBA 3KV5A 3I0OA 2K3WA 5LJNA 4B5DA 2A9UA 2XNUA 5LJMA 4ILUA 2KLQA 3P4SA 5F8PA 1WFDA 4TV9E 2A2FX 5A1LA 4G63A 4IE0A 4XAXB 5LA6E 4HFEA 3ZYLA 1I9BA 3C4WA 2JIWA 4QH1A 5AQTB 2RP4A 2KT9A 2ZMAA 1OEDB 5AQLB 5AQRB 4B3ST 3HI2A 3WI3A 3L09A 4HEAA 4XK9A 2VVSA 4GYSA 4NUVA 5CO5A 2NW7A 4U2ZA 2LE8A 4IDNA 1UV6A 5L3FB 4DBMA 2DHRA 1V9DA 5EK4A 4IIJE 3AA1B 2PG8A 2WDVA 4PFPA 1YXRA 2YEVC 2XJ7A 3L39A 2WZHA 2RPAA 3RX6A 3ZKRA 5LNKA 2LLYA 5L4HA 2L8KA 3WTJA 2CWYA 2VVNA 4H9QC 3O1HA 4NZBA 1ZV4X 4HFBA 3T1YT 1I94T 5C2TA 2JQQA 2BS4A 2IMLA 3PJAA 2NOXA 4AQYT 2WY2A 1T98A 3I9YA 1T7SA 5AQHB 2IIUA 5IUXA 2VURA 2XSBA 5FP3A 2NW8A 2WDRA 4PK4A 4A5XA 1WYCA 2VKHA 5JMEA 4KI0F 2M6IA 3UQ7A 2WBLA 3E22E 2KMFA 4JEHB 3O1JA 3P4RA 4JI6T 1CUNA 3KV4A 3N9NA 1N36T 2X0YA 3C50A 3RC3A 5JDQA 2W8GA 2ZM0A 3K1SA 3UU3A 4PK6A 2XNTA 2LKHA 4PIRA 2BR7A 4LFAT 3RYHE 1AJ3A 4O8SA 4UIGA 4CQIA 2V1DB 4A98A 1UCUA 3ZJ1A 5AQPB 3KBTA 4A56A 4ZS2A 4U31A 2VQET 2BVLA 3EHZA 3I1AA 2LSGA 4UR9A 1UX4A 1UX5A 2KWIB 4JUYA 3NVOA 2V26A 4ASKA 3AXJB 1QSDA 3TLVA 2N2NA 4JI4T 2PFVA 4YTMA 1Y01A 2HN1A 4F6RC 4NPPA 4JI1T 2XZ6A 4QH5A 2BBJA 2LRLA 5IHYA 3ONXA 3FZKB 2WSSV 4UEMA 2NTXA 3N2KE 2CA5A 3ETVA 1NEKA 3UU4A 2W62A 4IE4A 4HGAA 4U72A 2UUAT 4CN1A 3NBXX 2XSAA 4HFDA 5ADXL 5LG3A 3NRXA 3ZMVB 2DCFA 3U78A 4AI6A 4DR4T 1MIYA 2JMHA 1X9BA 5FMNA 4DR1T 4EGWA 5CA0E 2Q9QC 5JQGE 4AQFC 3T4MA 4MHCA 4EZ1A 4ILBA 1VCSA 3QNUA 1SA0E 3D0TA 2WNCA 3KFWX 2PJQA 4CXXA 3WIPA 5AQQB 4X20E 2D2SA 2D0UA 2K9AA 4TN7B 3UU8A 5LHIB 2X67A 4HQPA 4O2AE 3N2GE 3EI0A 4QXHB 4UV9B 2L9QA 3O1IA 4NIQA 5FXWA 4AKHA 5FY7A 4ZEYA 4LMLA 3HKEE 5JR9C 2VQFT 2YDQA 5L3GB 2QGSA 3PUZF 1WCRA 3JCFA 1IZNB 2ZM6T 3LDQB 4H9PC 2MYSA 4AKRB 1MNDA 1JNZA 3RRCA 2XY8B 5KMGP 3ZT5A 1OEDA 3PE0A 2XQ7A 3G06A 3I0QA 4I0UA 2BYPA 2H88A 3AE2A 2WCAA 5J5FA 3CVRA 2WM9A 1W09A 3ZDHA 2ZM8A 4LF8T 3EDUA 4TWHA 3UUMA 2L3LA 4NXMT 2HPLA 3Q5WA 1ZKEA 2EHOA 2YKSA 3VHLA 2EHOB 3WAKA 3UU6A 1ZP0A 4H9NC 2OLTA 4QXCB 4QX8B 4LF7T 4X62T 3ZSTA 2W0GA 5J2TE 4PK5A 3AEDA 5SYOA 4PAGA 3U8MA 3ZEFB 3UULA 4YSZA 5CJ5A 3V5UA 4PJJA 3OPCA 3QB5K 5ABEA 1XMOT 4UM3P 3NRYA 4TUYE 1HX1B 4HFIA 2WDQA 3DJBA 3GN5A 5AQOB 5LGTB 3F57A 3N5LA 4AFHA 4QKNA 1I6ZA 2IC9A 1U5PA 2ES0A 3RLFF 3ZC0A 2IW5B 2E2AA 2E9XD 4UF0A 3UFEA 5KXJA 3HKCE 4CXYA 1XDOA 3T8OA 5JDLA 1QUUA 1HFAA 3O4XE 4JBWF 3JC6C 2E9XA 4HWFA 2HHHT 4K0UA 2WP9A 4X1YE 3NZPA 2UXCT 1Y64B 2FJAA 4DV4T 1HNXT 2CM0A 1HS7A 2DWKA 4CI3B 4ZK4A 2V7LA 5AFJA 3K3NA 4DR6T 4QXBB 1DU2A 2WU2A 1J5WA 5LHGB 1SE7A 2F4VT 3CX6B 2UU9T 2XYSA 5LOVE 3KV6A 2VL0A 3FXDB 3EAMA 5LB7B 4ISSA 4QHOA 2Q9QD 5H6QB 4IDPA 2YN6A 2AE9A 2X0LB 3RGLA 3U8JA 3SFEA 3AE9A 3N9LA 4HFVA 1IBKT 2D5UA 3QK6A 3TLUA 3AB3B 2LSJA 1XMQT 4AKLA 3AA7B 2LJLA 3P4WA 3SIOA 2VKDA 4C90A 4PJNA 4GKJT 5JREA 4I50E 4KHPT 3EVYA 3SWHA 4LFCT 2QYWA 2LSIA 1US7B 2CWOA 4ZRUA 1KNZA 1XWMA 3CIRA 4ZZCA 2W61A 1UW6A 4OX9T 4KMCA 3S4UA 2H89A 3H3MA 1M7KA 5JRCA 5AQKB 3PUGA 5FY0A 3ZYMA 5LGNB 2BR8A 4B3RT 5FJVA 2BVMA 4I4TE 5AINA 4EYUA 3ZT7A 4G2AA 1KFYA 4EB6E 3HKBE 3C79A 2YOEA 4OFZA 4AKGA 1J1JA 2VKJA 4IDQA 3RYIE 4ISTA 2VB6A 2IDOB 1Z8UA 3QUJA 4LMJA 3PUYF 2CXLA 1SHZC 3ONLC 3FZFB 2BS2A 4TZ4C 3PMZA 3P4QA 2OV9A 3WTOA 1VRBA 3UUXB 2KNDA 1CHUA 2XQ3A 2CMRA 2HH7A 3KV9A 3J7Yq 4IDOA 4ZHQE 1B7TA 5JDGA 3WTMA 2XYTA 4EEDA 5EZYE 3W15B 4IE7A 5HXSA 2CBIA 3JAFA 1BR2A 2K48A 3QB5A 2ZJVA 1UX2A 2Y57A 2XZEA 4LF9T 5LGUB 4CI1B 4ZI2D 1O3XA 4ILCA 2XASB 3HKDE 3E0ZA 5AFHA 4V1Av 1OEDC 2VL8A 3BQIA 2V5DA 3KBUA 3C51A 5JDHA 5CA1E 5JRCB 4YSYA 2C9TA 5JDMA 4EEBA 5LMUT 3RIUA 5CGMA 5HWXA 3ZMTB 2LKGA 2Y48B 2X51A 5J5IA 4P09A 4O4JE 2LSKA 4U33A 5L47A 3AE7A 3AE6A 5AFMB 5LCYA 4GYRA 4EAHA 2G0UA 4J2CA 2VASA 5LP6E 3AEBA 4HWDA 3OTOT 3T1HT 4UXUA 3TKLB 5JR9A 2W4XA 3K3QC 4U74A 2I0MA 5AFLA 2X00D 2BG9C 4BAYB 5FY1A 5FL0A 4U2YA 4IHJE 5M4YA 3VKHA 2LT3A 3DP7A 4WNKA 1E1HB 5FNVE 4COFA 2X00A 4JI0T 3PUWF 3IHRA 3OVUA 3VKGA 2CEAA 3SS1A 4WZXA 3LK2B 1OWAA 2BS3A 3OJAA 3FZLB 3L8RA 3UT5E 3UFGA 4IGUA 4DV2T 1WRDA 4IDZA 4PJLA 5HXRA 2CLYC 3J9X1 2RA1A 5AFNA 2FJEA 3Q2MA 1D1BA 3RI5A 1D0XA 2VK9A 3RPUA 2XQ8A 2ZM2A 3JC6D 2H7VC 1YQ3A 3CQGB 3AECA 4IL4A 3U8KA 3QC9A 4H9SE 4JI5T 4YJ3E 5ABGA 3ZCJA 2CHOA 4U7YA 4C91A 5AQMB 2E9XC 4DR3T 2BKPA 5BP0A 3TLWA 3A8YC 3LFMA 4LMKA 4H63V 1XNQT 2MPKA 4AIUA 5AQSB 3Q5DA 2QA7A 1FMWA 3RHWA 4QACA 1IJ5A 2LRKA 2LHNA 2A72A 2X9WA 4PW8A 4BJNA 1N32T 1MMDA 2WAUA 4IE6A 2Y58A 4OYKA 2J47A 3RIFA 3PU3A 3FB2A 2H3RA 1EZ3A 4ALXA 3AEGA 2BYNA 4UXNB 5HWYA 3AE5A 4P1NA 3VU7H 1HCIA 2PBIA 3IF8B 3P50A 1U4QA 2BYSA 4EZ4A 3WTKA 3RF1A 3NWIA 1H7CA 3N9OA 1JNRA 3MXZA 2XAJB 3K8PC 1NAFA 4HWIB 2BJ0A 1W9RA 3RC8A 4L0RA 4X65T 2SPCA 2CHNA 4CZZB 5JTGA 2XZ5A 1KK7A 4TWDA 3FZHB 4JI3T 4ANJA 3PUVF 4DBRA 2BBHA 4UVCB 5L3CB 4Z8XA 1FJGT 3LG7A 2NWBA 4GIWA 4K0KT 4TNWA 3QOFA 2R6GF 1SUMB 4HWCA 4LF6T 4B6XA 1HG2A 4YHJA 5HEJA 4X64T 3PUAA 3P4PA 3ZLIA 4BFQA 3E08A 4JI2T 4EV6A 3BQLA 3ONJA 2JJ9A 5AFUL 2WZIA 1XNRT 4XHEA 4UELA 3PJAJ 2W66A 2EHOC 3MA9A 1S35A 1YKEB 4ZJSA 2DL1A 2B76A 3UUNA 2W67A 1GQEA 3EDVA 3ZMZB 3ZMUB 4CN6A 4TV8E 2BZBA 4ZS3A 4O4LE 2HPJA 2JPFA 4MLKA 4KX6A 4U7IA 4JV5T 2BKNA 3P8CD 2ACXA 3KVBA 1FMVA 5F5WA 1MMNA 2YK0A 4DUZT 3ZT6A 3RYFE 5IYZE 5AFMA 3RRWA 2XQYA 3AAAB 3N2OA 1D0YA 5AQFB 2W00A 3CX8B 3RKOA 1HR0T 3AA0B 3FHNA 4JYAT 1VCTA 2WMNA 5JR9B 5J5HA 4LF4T 3O9XA 3AVSA 1FEWA 2Z6EA 2Y8DA 4UF0B 3ZDGA 4DV6T 4JLEA 4WBOA 4NUUA 3A7MA 2JMKA 2KINB 1OXZA 2XAHB 3N9PA 3BQKA 2XUEA 3ZMSB 2WB5A 3M65A 3F31A 3CKDA 4ZK1A 4DR2T 3MACA 1LVKA 5HXEA 5LYJE 4YFSA 4EZHA 1KNPA 3NKZA 1KNRA 2E5LT 3VRBA 5BR8T 3PURA 1T8BA 2UUBT 5DQVA 2WN9A 4QX7B 2J1DG 3TLSA 1E2AA 3UQ4A 5FYMA 3MJXA 2XQ9A 4DUYT 2MAWA 3LSVA 1E7PA 4PJMA 2YU2A 3WTIA 2CRBA 3AEEA 2YINA 4I55E 3FXEB 4QH4A 2CE7A 2NP9A 3N9QA 4QABA 1M62A 1HTJF 4O2BE 5HEHA 4FRRA 3RKGA 2WMOA 4QAAA 5EK3A 2WWVA 5J0ZA 4EXTA 4HWHA 2GK9A 2V5CA 2M67A 2UXNB 2N1GA 5LG4A 4YTPA 1ZHCA 5LBQB 2ACZA 3CWZB 2XNVA 4HE8A 2BYRA 2DI4A 3R84B 5FXZA 3RH3A 5C3JA 4Q25A 4TNVA 5AQJB 4LF5T 2X68A 3FZMB 3ZCIA 4DV0T 1BR4A 2OA5A 1R8IA 5BRXA 1MMAA 4ZXLA 3ANWA 1UURA 1N33T 4O4IE 2I6HA 4DMVA 2HN2A 1KEYA 3U8NA 2A3DA 5DJQC 4JEUB 2H7OA 3SOLA 1KF6A 4HFHA 4IL9A 3RIUC 2DNXA 2XQAA 4LFBT 3PV0F 3KINB 4WYVA 4B3TT 3ZSSA 3HR0A 4X66T 5L3DB 4FI5A 4F8HA 1LRZA 2E5VA 4UM1A 5H6RB 4OHFA 2ODUA 5LXBA 3I9WA 2WNLA 4JI7T 1IJ6A 4IT4A 3ABVA 2BG9A 4UY2A 2QC1B 4E7SA 2QRXA 1WR6A 3K3OA 3SFDA 4ZI7E 4Z90A 3AE8A 3N9MA 3AE4A 2Y7YA 1D1CA 1NENA 3L3PA 2W2UA 1FIOA 5AQIB 4A97A 4ILAA 5ETWA 2JRKA 3RQUA 5L4EA 3Q5XA 2J4GA 2J62A 3AA6B 4IE5A 1LKXA 2WWUA 4HKAA 4GK5E 1D1AA 2W63A 4H63H 5KZUA 3ZN1B 2Y54A 2EHOD 3ZPOA 4GOUA 5ABHA 5HXCA 3B13A 2BYQA 2LEHA 1MNEA 1WYBA 3C84A 3CPZA 2W8FA 4X1IE 3MZKB 5TVCA 5LHHB 4E7ZA 5AFKA 3HA4A 5JDFA 3OKQA 2BKOA 1HG5A 3KVAA 3VR9A 3GMIA 5FXXA 2YU1A 4P0BA 3IBPA 2V7IA 1BR0A 2K5BB 4BA9A 4DVDA 3WTNA 2KXPB 5HYAA 1G73A 2QVAA 2LOSA 4HN9A 3FBZA 2PH9A 3FBLA 3UU5A 3WAJA 3CQCB 4XBFB 1WR0A 4DBQA 1WLXA 3CX7B
chains in the Genus database with same CATH topology
4ILAA 2BYRA 4UM3A 2M6BA 3ZDGA 3WTHA 3RI5A 3TLTA 4TNWA 4ZZCA 2XQ7A 2WNJA 2XQ8A 4AFTA 3RQUA 4UM3S 2M6IA 3U8LA 5L4EA 3UQ7A 2YMEA 4IL4A 3SQ9A 2BYPA 4TNVA 3U8KA 1UW6A 4HFDA 4WV9A 4ZJTA 2BG9E 5J5FA 3JADA 5LG3A 4ZZBA 5HEJA 2C9TA 4BQTA 4BFQA 5BRXA 3ZDHA 2W8GA 4B5DA 2LKGA 5HEUA 4TWHA 2XNUA 5J5IA 5HEOA 3UU3A 3UUBA 2BR8A 3IGQA 5L47A 5FJVA 4XHEA 5BP0A 5AFMB 2BG9B 2XNTA 2LKHA 3T4MA 3TLWA 5AINA 4PIRA 2BR7A 2YKSA 4IREA 3U8NA 5J5GA 4ILBA 4EZ1A 4LMKA 3RQWA 3C79A 5JMEA 2LM2A 2YOEA 3UU6A 5KZUA 2WZYA 2Y54A 3JAEA 4HFEA 4ZK1A 4ZJSA 1I9BA 2WNCA 4ZK4A 4HFHA 3RHWA 4QACA 4QH1A 4IL9A 2XQAA 4A98A 4UXUA 4LMJA 3WIPA 5AFJA 2PGZA 2Y58A 1OEDB 2BYQA 3UU8A 3C84A 5AFLA 5SYOA 2X00D 2W8FA 3RIFA 2BG9C 5HEGA 5HCMA 3GUAA 4HQPA 3U8MA 5TVCA 2WN9A 4F8HA 2XYSA 3PEOA 4XK9A 1OEDE 4AFGA 3EHZA 3EI0A 4ALXA 3TLSA 3PMZA 2BYNA 3UQ4A 2VL0A 5CO5A 4UM1A 5AFKA 2XQ9A 3EAMA 3WTOA 2MAWA 3LSVA 4Z91A 4X5TA 2XQ3A 1UV6A 4DBMA 2YN6A 4UM3P 5LXBA 3WTIA 4COFA 2X00A 4LMLA 3P50A 4QH4A 3U8JA 3RIAA 2WNLA 3TLVA 3WTMA 2BYSA 4HFIA 2XYTA 2ZJUA 5AFMA 4D01A 4QABA 3JAFA 4NPPA 5KE4A 2KSRA 2YMDA 5HEHA 2BG9A 4UY2A 2QC1B 3WTLA 4FRRA 3WTKA 5HCJA 3TLUA 4QAAA 4AFHA 3ZKRA 2XQ5A 2UZ6A 2XQ4A 4TWFA 5AFNA 2LLYA 5L4HA 2ZJVA 3WTJA 1UX2A 2BJ0A 2Y57A 3P4WA 3SIOA 3WTNA 5J0ZA 4NZBA 4ZR6A 4Z90A 4HFBA 2XZ6A 4ILCA 4QH5A 3SH1A 2Y56A 2Y7YA 2XZ5A 4TWDA 5CFBA 2PH9A 3UU5A 2XQ6A 3SQ6A 5J5HA 5AFHA 5BW2A 1OEDA 1OEDC 4HFCA 5IUXA 4ZRUA 2XNVA 4A97A 3UU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILA A;  2BYR A;  4UM3 A;  2M6B A;  3ZDG A;  3WTH A;  3RI5 A;  3TLT A;  4TNW A;  4ZZC A;  2XQ7 A;  2WNJ A;  2XQ8 A;  4AFT A;  3RQU A;  4UM3 S;  2M6I A;  3U8L A;  5L4E A;  3UQ7 A;  2YME A;  4IL4 A;  3SQ9 A;  2BYP A;  4TNV A;  3U8K A;  1UW6 A;  4HFD A;  4WV9 A;  4ZJT A;  2BG9 E;  5J5F A;  3JAD A;  5LG3 A;  4ZZB A;  5HEJ A;  2C9T A;  4BQT A;  4BFQ A;  5BRX A;  3ZDH A;  2W8G A;  4B5D A;  2LKG A;  5HEU A;  4TWH A;  2XNU A;  5J5I A;  5HEO A;  3UU3 A;  3UUB A;  2BR8 A;  3IGQ A;  5L47 A;  5FJV A;  4XHE A;  5BP0 A;  5AFM B;  2BG9 B;  2XNT A;  2LKH A;  3T4M A;  3TLW A;  5AIN A;  4PIR A;  2BR7 A;  2YKS A;  4IRE A;  3U8N A;  5J5G A;  4ILB A;  4EZ1 A;  4LMK A;  3RQW A;  3C79 A;  5JME A;  2LM2 A;  2YOE A;  3UU6 A;  5KZU A;  2WZY A;  2Y54 A;  3JAE A;  4HFE A;  4ZK1 A;  4ZJS A;  1I9B A;  2WNC A;  4ZK4 A;  4HFH A;  3RHW A;  4QAC A;  4QH1 A;  4IL9 A;  2XQA A;  4A98 A;  4UXU A;  4LMJ A;  3WIP A;  5AFJ A;  2PGZ A;  2Y58 A;  1OED B;  2BYQ A;  3UU8 A;  3C84 A;  5AFL A;  5SYO A;  2X00 D;  2W8F A;  3RIF A;  2BG9 C;  5HEG A;  5HCM A;  3GUA A;  4HQP A;  3U8M A;  5TVC A;  2WN9 A;  4F8H A;  2XYS A;  3PEO A;  4XK9 A;  1OED E;  4AFG A;  3EHZ A;  3EI0 A;  4ALX A;  3TLS A;  3PMZ A;  2BYN A;  3UQ4 A;  2VL0 A;  5CO5 A;  4UM1 A;  5AFK A;  2XQ9 A;  3EAM A;  3WTO A;  2MAW A;  3LSV A;  4Z91 A;  4X5T A;  2XQ3 A;  1UV6 A;  4DBM A;  2YN6 A;  4UM3 P;  5LXB A;  3WTI A;  4COF A;  2X00 A;  4LML A;  3P50 A;  4QH4 A;  3U8J A;  3RIA A;  2WNL A;  3TLV A;  3WTM A;  2BYS A;  4HFI A;  2XYT A;  2ZJU A;  5AFM A;  4D01 A;  4QAB A;  3JAF A;  4NPP A;  5KE4 A;  2KSR A;  2YMD A;  5HEH A;  2BG9 A;  4UY2 A;  2QC1 B;  3WTL A;  4FRR A;  3WTK A;  5HCJ A;  3TLU A;  4QAA A;  4AFH A;  3ZKR A;  2XQ5 A;  2UZ6 A;  2XQ4 A;  4TWF A;  5AFN A;  2LLY A;  5L4H A;  2ZJV A;  3WTJ A;  1UX2 A;  2BJ0 A;  2Y57 A;  3P4W A;  3SIO A;  3WTN A;  5J0Z A;  4NZB A;  4ZR6 A;  4Z90 A;  4HFB A;  2XZ6 A;  4ILC A;  4QH5 A;  3SH1 A;  2Y56 A;  2Y7Y A;  2XZ5 A;  4TWD A;  5CFB A;  2PH9 A;  3UU5 A;  2XQ6 A;  3SQ6 A;  5J5H A;  5AFH A;  5BW2 A;  1OED A;  1OED C;  4HFC A;  5IUX A;  4ZRU A;  2XNV A;  4A97 A;  3UU4 A; 
#chains in the Genus database with same CATH topology
 1UUS A;  3U8L A;  1HNW T;  1L0V A;  2C5J A;  4ZJT A;  4O4H E;  2VWA A;  1LVF A;  5F3J A;  5JH7 E;  3PTR B;  3UUB A;  1UK5 A;  4ZI2 C;  1YQ4 A;  2BG9 B;  1VOM A;  3MK7 C;  5FKY A;  2UUC T;  2WZY A;  5CB4 E;  3GWH A;  2V6Y B;  1T72 A;  4H9R C;  2ODV A;  2AXD S;  3OYZ A;  2LM9 A;  2JQK A;  2D0T A;  3H3A A;  2CXF A;  2Q9Q B;  3GUA A;  2X66 A;  1S94 A;  2ZLY A;  2UXD T;  2PTF A;  4X5T A;  3P7I A;  3AAE B;  3CK6 A;  3B57 A;  3ANW B;  3RIA A;  1ZEE A;  3OBV E;  3NZQ A;  5J1G A;  4AXP A;  3LJC A;  1N34 T;  2XQ5 A;  2C5K T;  4TWF A;  3ZYK A;  3PUQ A;  4YXD A;  2P9B A;  2B1E A;  2V7M A;  2Y56 A;  4EYY R;  4P0A A;  4PNI A;  5FL1 A;  2E8I A;  1BR1 A;  5FVL A;  3LBX A;  1UGO A;  2CBJ A;  3C98 B;  4AKI A;  3KDS E;  4YT0 A;  3R6N A;  2X9Y A;  2VKO A;  3HL6 A;  5EK2 A;  2C0S A;  4WBN E;  3PDY A;  2MBG A;  1J5E T;  2XAG B;  5JVD E;  5ABF B;  1YKH B;  4HTE A;  5ABF A;  2LSY A;  3U3I A;  5IWA T;  2FJD A;  5HXH A;  4YHH T;  4KBM B;  4ZI3 C;  3GN5 B;  3UTK A;  5J5G A;  5TAO A;  3JAE A;  2X9H A;  3C64 A;  4JI8 T;  1D0Z A;  4DV5 T;  2V7J A;  5LBM A;  5BMV E;  2JQ9 A;  1QLB A;  4TX5 A;  4KUM B;  2X0H A;  5LMN T;  2XTL A;  1OED E;  5DQW A;  2LHR A;  3CML A;  2IC6 A;  3Q9D A;  4ADZ A;  2LOP A;  1XZY A;  3AXJ A;  1MIW A;  2ZJU A;  4MFR A;  4DMW A;  1IBM T;  2WQY A;  5KE4 A;  4N78 D;  2E9X B;  2NW9 A;  2XQ4 A;  2XM1 A;  2K24 A;  2V6X A;  2CXD A;  4NXN T;  4ZR6 A;  5FXV A;  3AE1 A;  3LBX B;  2XM2 A;  3M3Z B;  4ERR A;  4DID B;  4UVA B;  2XQ6 A;  3VRA A;  5BW2 A;  4B3M T;  3CQX C;  4ZI3 D;  4DV1 T;  3EUH A;  1HF8 A;  2CLY B;  2KWH A;  5DAB A;  4UM3 A;  2M6B A;  3WTH A;  2Q9Q A;  3ZC1 A;  4UM3 S;  4PFO A;  1HX8 A;  3Q5E A;  2BG9 E;  4UVB B;  3V5S A;  2X9X A;  5AQN B;  4H9O C;  1G8X A;  3SRZ A;  5J2U E;  2N9D A;  2XPK A;  4I43 B;  4YY3 T;  3IGQ A;  2XAQ B;  3ZN0 B;  3X1D A;  2UXB T;  3LK4 2;  2KZ7 B;  5KX5 E;  4GK0 E;  1HNZ T;  4YSX A;  1YD8 G;  5FVK A;  3GA8 A;  5HEG A;  5HCM A;  1MMG A;  5L3B B;  4L5G A;  3PEO A;  4AFG A;  2WS3 A;  1IBL T;  2V7K A;  1X79 A;  5KDM C;  4CI2 B;  4EOZ B;  3OYX A;  1XDP A;  1YW0 A;  3B5M A;  4WW0 A;  4D01 A;  2KSR A;  4OK0 A;  3WTL A;  5HCJ A;  2V6Y A;  2UZ6 A;  2FBW A;  2BDE A;  5AQV B;  4DR7 T;  4KHZ F;  3C4X A;  3ESL A;  4MAL A;  4DO0 A;  5CFB A;  4L9I A;  3BK9 A;  1W0A A;  3LK3 B;  4GKK T;  4MBQ A;  2DWG A;  4AIS A;  2FUP A;  1ZOY A;  3IA3 A;  3TLT A;  4AFT A;  2CCQ A;  1Z0P A;  2NTY A;  2XAF B;  4KP3 C;  4WV9 A;  1NWM X;  5C8Y E;  3EAB A;  3AE3 A;  3PUX F;  4YLH A;  3PU8 A;  3AEF A;  4BQT A;  2I59 A;  4OYJ A;  2IUB A;  5HEU A;  2YDR A;  4X1K E;  5HEO A;  2DLR A;  4CN4 A;  3F2E A;  4BJM A;  4AQF A;  4IRE A;  3RQW A;  3AVR A;  2LM2 A;  2MOZ A;  4U3C A;  3DTO A;  2NR4 A;  3C4Z A;  5LXT E;  1IAP A;  4ZOL E;  2PGZ A;  3AAI A;  5AQU B;  1MIV A;  5HAX A;  2V8S V;  4QWN B;  4UV8 B;  2XHE B;  3VR8 A;  5AQG B;  3PUS A;  2D9D A;  2IHR 1;  2IAK A;  5JDN A;  4Z91 A;  4AQG A;  4DR5 T;  3ETU A;  4DV7 T;  4XZC A;  3H37 A;  2WU5 A;  5E0O A;  3ZJ2 A;  3IEE A;  4CXW A;  4DV3 T;  2JQH A;  2YDS A;  4FJO A;  3AEA A;  4M1P A;  2YMD A;  2UXX B;  2CPT A;  4YJ2 E;  5L3E B;  3A5X A;  5L2L A;  3SH1 A;  5GON E;  3RYC E;  3MKD A;  3SQ6 A;  1W0B A;  2MTQ A;  2Y6X A;  2FJB A;  2C5I T;  4HFC A;  4DND A;  4YTN A;  2WNJ A;  2YME A;  3SQ9 A;  4EIW A;  3JAD A;  4ZZB A;  3KV5 A;  3I0O A;  2K3W A;  5LJN A;  4B5D A;  2A9U A;  2XNU A;  5LJM A;  4ILU A;  2KLQ A;  3P4S A;  5F8P A;  1WFD A;  4TV9 E;  2A2F X;  5A1L A;  4G63 A;  4IE0 A;  4XAX B;  5LA6 E;  4HFE A;  3ZYL A;  1I9B A;  3C4W A;  2JIW A;  4QH1 A;  5AQT B;  2RP4 A;  2KT9 A;  2ZMA A;  1OED B;  5AQL B;  5AQR B;  4B3S T;  3HI2 A;  3WI3 A;  3L09 A;  4HEA A;  4XK9 A;  2VVS A;  4GYS A;  4NUV A;  5CO5 A;  2NW7 A;  4U2Z A;  2LE8 A;  4IDN A;  1UV6 A;  5L3F B;  4DBM A;  2DHR A;  1V9D A;  5EK4 A;  4IIJ E;  3AA1 B;  2PG8 A;  2WDV A;  4PFP A;  1YXR A;  2YEV C;  2XJ7 A;  3L39 A;  2WZH A;  2RPA A;  3RX6 A;  3ZKR A;  5LNK A;  2LLY A;  5L4H A;  2L8K A;  3WTJ A;  2CWY A;  2VVN A;  4H9Q C;  3O1H A;  4NZB A;  1ZV4 X;  4HFB A;  3T1Y T;  1I94 T;  5C2T A;  2JQQ A;  2BS4 A;  2IML A;  3PJA A;  2NOX A;  4AQY T;  2WY2 A;  1T98 A;  3I9Y A;  1T7S A;  5AQH B;  2IIU A;  5IUX A;  2VUR A;  2XSB A;  5FP3 A;  2NW8 A;  2WDR A;  4PK4 A;  4A5X A;  1WYC A;  2VKH A;  5JME A;  4KI0 F;  2M6I A;  3UQ7 A;  2WBL A;  3E22 E;  2KMF A;  4JEH B;  3O1J A;  3P4R A;  4JI6 T;  1CUN A;  3KV4 A;  3N9N A;  1N36 T;  2X0Y A;  3C50 A;  3RC3 A;  5JDQ A;  2W8G A;  2ZM0 A;  3K1S A;  3UU3 A;  4PK6 A;  2XNT A;  2LKH A;  4PIR A;  2BR7 A;  4LFA T;  3RYH E;  1AJ3 A;  4O8S A;  4UIG A;  4CQI A;  2V1D B;  4A98 A;  1UCU A;  3ZJ1 A;  5AQP B;  3KBT A;  4A56 A;  4ZS2 A;  4U31 A;  2VQE T;  2BVL A;  3EHZ A;  3I1A A;  2LSG A;  4UR9 A;  1UX4 A;  1UX5 A;  2KWI B;  4JUY A;  3NVO A;  2V26 A;  4ASK A;  3AXJ B;  1QSD A;  3TLV A;  2N2N A;  4JI4 T;  2PFV A;  4YTM A;  1Y01 A;  2HN1 A;  4F6R C;  4NPP A;  4JI1 T;  2XZ6 A;  4QH5 A;  2BBJ A;  2LRL A;  5IHY A;  3ONX A;  3FZK B;  2WSS V;  4UEM A;  2NTX A;  3N2K E;  2CA5 A;  3ETV A;  1NEK A;  3UU4 A;  2W62 A;  4IE4 A;  4HGA A;  4U72 A;  2UUA T;  4CN1 A;  3NBX X;  2XSA A;  4HFD A;  5ADX L;  5LG3 A;  3NRX A;  3ZMV B;  2DCF A;  3U78 A;  4AI6 A;  4DR4 T;  1MIY A;  2JMH A;  1X9B A;  5FMN A;  4DR1 T;  4EGW A;  5CA0 E;  2Q9Q C;  5JQG E;  4AQF C;  3T4M A;  4MHC A;  4EZ1 A;  4ILB A;  1VCS A;  3QNU A;  1SA0 E;  3D0T A;  2WNC A;  3KFW X;  2PJQ A;  4CXX A;  3WIP A;  5AQQ B;  4X20 E;  2D2S A;  2D0U A;  2K9A A;  4TN7 B;  3UU8 A;  5LHI B;  2X67 A;  4HQP A;  4O2A E;  3N2G E;  3EI0 A;  4QXH B;  4UV9 B;  2L9Q A;  3O1I A;  4NIQ A;  5FXW A;  4AKH A;  5FY7 A;  4ZEY A;  4LML A;  3HKE E;  5JR9 C;  2VQF T;  2YDQ A;  5L3G B;  2QGS A;  3PUZ F;  1WCR A;  3JCF A;  1IZN B;  2ZM6 T;  3LDQ B;  4H9P C;  2MYS A;  4AKR B;  1MND A;  1JNZ A;  3RRC A;  2XY8 B;  5KMG P;  3ZT5 A;  1OED A;  3PE0 A;  2XQ7 A;  3G06 A;  3I0Q A;  4I0U A;  2BYP A;  2H88 A;  3AE2 A;  2WCA A;  5J5F A;  3CVR A;  2WM9 A;  1W09 A;  3ZDH A;  2ZM8 A;  4LF8 T;  3EDU A;  4TWH A;  3UUM A;  2L3L A;  4NXM T;  2HPL A;  3Q5W A;  1ZKE A;  2EHO A;  2YKS A;  3VHL A;  2EHO B;  3WAK A;  3UU6 A;  1ZP0 A;  4H9N C;  2OLT A;  4QXC B;  4QX8 B;  4LF7 T;  4X62 T;  3ZST A;  2W0G A;  5J2T E;  4PK5 A;  3AED A;  5SYO A;  4PAG A;  3U8M A;  3ZEF B;  3UUL A;  4YSZ A;  5CJ5 A;  3V5U A;  4PJJ A;  3OPC A;  3QB5 K;  5ABE A;  1XMO T;  4UM3 P;  3NRY A;  4TUY E;  1HX1 B;  4HFI A;  2WDQ A;  3DJB A;  3GN5 A;  5AQO B;  5LGT B;  3F57 A;  3N5L A;  4AFH A;  4QKN A;  1I6Z A;  2IC9 A;  1U5P A;  2ES0 A;  3RLF F;  3ZC0 A;  2IW5 B;  2E2A A;  2E9X D;  4UF0 A;  3UFE A;  5KXJ A;  3HKC E;  4CXY A;  1XDO A;  3T8O A;  5JDL A;  1QUU A;  1HFA A;  3O4X E;  4JBW F;  3JC6 C;  2E9X A;  4HWF A;  2HHH T;  4K0U A;  2WP9 A;  4X1Y E;  3NZP A;  2UXC T;  1Y64 B;  2FJA A;  4DV4 T;  1HNX T;  2CM0 A;  1HS7 A;  2DWK A;  4CI3 B;  4ZK4 A;  2V7L A;  5AFJ A;  3K3N A;  4DR6 T;  4QXB B;  1DU2 A;  2WU2 A;  1J5W A;  5LHG B;  1SE7 A;  2F4V T;  3CX6 B;  2UU9 T;  2XYS A;  5LOV E;  3KV6 A;  2VL0 A;  3FXD B;  3EAM A;  5LB7 B;  4ISS A;  4QHO A;  2Q9Q D;  5H6Q B;  4IDP A;  2YN6 A;  2AE9 A;  2X0L B;  3RGL A;  3U8J A;  3SFE A;  3AE9 A;  3N9L A;  4HFV A;  1IBK T;  2D5U A;  3QK6 A;  3TLU A;  3AB3 B;  2LSJ A;  1XMQ T;  4AKL A;  3AA7 B;  2LJL A;  3P4W A;  3SIO A;  2VKD A;  4C90 A;  4PJN A;  4GKJ T;  5JRE A;  4I50 E;  4KHP T;  3EVY A;  3SWH A;  4LFC T;  2QYW A;  2LSI A;  1US7 B;  2CWO A;  4ZRU A;  1KNZ A;  1XWM A;  3CIR A;  4ZZC A;  2W61 A;  1UW6 A;  4OX9 T;  4KMC A;  3S4U A;  2H89 A;  3H3M A;  1M7K A;  5JRC A;  5AQK B;  3PUG A;  5FY0 A;  3ZYM A;  5LGN B;  2BR8 A;  4B3R T;  5FJV A;  2BVM A;  4I4T E;  5AIN A;  4EYU A;  3ZT7 A;  4G2A A;  1KFY A;  4EB6 E;  3HKB E;  3C79 A;  2YOE A;  4OFZ A;  4AKG A;  1J1J A;  2VKJ A;  4IDQ A;  3RYI E;  4IST A;  2VB6 A;  2IDO B;  1Z8U A;  3QUJ A;  4LMJ A;  3PUY F;  2CXL A;  1SHZ C;  3ONL C;  3FZF B;  2BS2 A;  4TZ4 C;  3PMZ A;  3P4Q A;  2OV9 A;  3WTO A;  1VRB A;  3UUX B;  2KND A;  1CHU A;  2XQ3 A;  2CMR A;  2HH7 A;  3KV9 A;  3J7Y q;  4IDO A;  4ZHQ E;  1B7T A;  5JDG A;  3WTM A;  2XYT A;  4EED A;  5EZY E;  3W15 B;  4IE7 A;  5HXS A;  2CBI A;  3JAF A;  1BR2 A;  2K48 A;  3QB5 A;  2ZJV A;  1UX2 A;  2Y57 A;  2XZE A;  4LF9 T;  5LGU B;  4CI1 B;  4ZI2 D;  1O3X A;  4ILC A;  2XAS B;  3HKD E;  3E0Z A;  5AFH A;  4V1A v;  1OED C;  2VL8 A;  3BQI A;  2V5D A;  3KBU A;  3C51 A;  5JDH A;  5CA1 E;  5JRC B;  4YSY A;  2C9T A;  5JDM A;  4EEB A;  5LMU T;  3RIU A;  5CGM A;  5HWX A;  3ZMT B;  2LKG A;  2Y48 B;  2X51 A;  5J5I A;  4P09 A;  4O4J E;  2LSK A;  4U33 A;  5L47 A;  3AE7 A;  3AE6 A;  5AFM B;  5LCY A;  4GYR A;  4EAH A;  2G0U A;  4J2C A;  2VAS A;  5LP6 E;  3AEB A;  4HWD A;  3OTO T;  3T1H T;  4UXU A;  3TKL B;  5JR9 A;  2W4X A;  3K3Q C;  4U74 A;  2I0M A;  5AFL A;  2X00 D;  2BG9 C;  4BAY B;  5FY1 A;  5FL0 A;  4U2Y A;  4IHJ E;  5M4Y A;  3VKH A;  2LT3 A;  3DP7 A;  4WNK A;  1E1H B;  5FNV E;  4COF A;  2X00 A;  4JI0 T;  3PUW F;  3IHR A;  3OVU A;  3VKG A;  2CEA A;  3SS1 A;  4WZX A;  3LK2 B;  1OWA A;  2BS3 A;  3OJA A;  3FZL B;  3L8R A;  3UT5 E;  3UFG A;  4IGU A;  4DV2 T;  1WRD A;  4IDZ A;  4PJL A;  5HXR A;  2CLY C;  3J9X 1;  2RA1 A;  5AFN A;  2FJE A;  3Q2M A;  1D1B A;  3RI5 A;  1D0X A;  2VK9 A;  3RPU A;  2XQ8 A;  2ZM2 A;  3JC6 D;  2H7V C;  1YQ3 A;  3CQG B;  3AEC A;  4IL4 A;  3U8K A;  3QC9 A;  4H9S E;  4JI5 T;  4YJ3 E;  5ABG A;  3ZCJ A;  2CHO A;  4U7Y A;  4C91 A;  5AQM B;  2E9X C;  4DR3 T;  2BKP A;  5BP0 A;  3TLW A;  3A8Y C;  3LFM A;  4LMK A;  4H63 V;  1XNQ T;  2MPK A;  4AIU A;  5AQS B;  3Q5D A;  2QA7 A;  1FMW A;  3RHW A;  4QAC A;  1IJ5 A;  2LRK A;  2LHN A;  2A72 A;  2X9W A;  4PW8 A;  4BJN A;  1N32 T;  1MMD A;  2WAU A;  4IE6 A;  2Y58 A;  4OYK A;  2J47 A;  3RIF A;  3PU3 A;  3FB2 A;  2H3R A;  1EZ3 A;  4ALX A;  3AEG A;  2BYN A;  4UXN B;  5HWY A;  3AE5 A;  4P1N A;  3VU7 H;  1HCI A;  2PBI A;  3IF8 B;  3P50 A;  1U4Q A;  2BYS A;  4EZ4 A;  3WTK A;  3RF1 A;  3NWI A;  1H7C A;  3N9O A;  1JNR A;  3MXZ A;  2XAJ B;  3K8P C;  1NAF A;  4HWI B;  2BJ0 A;  1W9R A;  3RC8 A;  4L0R A;  4X65 T;  2SPC A;  2CHN A;  4CZZ B;  5JTG A;  2XZ5 A;  1KK7 A;  4TWD A;  3FZH B;  4JI3 T;  4ANJ A;  3PUV F;  4DBR A;  2BBH A;  4UVC B;  5L3C B;  4Z8X A;  1FJG T;  3LG7 A;  2NWB A;  4GIW A;  4K0K T;  4TNW A;  3QOF A;  2R6G F;  1SUM B;  4HWC A;  4LF6 T;  4B6X A;  1HG2 A;  4YHJ A;  5HEJ A;  4X64 T;  3PUA A;  3P4P A;  3ZLI A;  4BFQ A;  3E08 A;  4JI2 T;  4EV6 A;  3BQL A;  3ONJ A;  2JJ9 A;  5AFU L;  2WZI A;  1XNR T;  4XHE A;  4UEL A;  3PJA J;  2W66 A;  2EHO C;  3MA9 A;  1S35 A;  1YKE B;  4ZJS A;  2DL1 A;  2B76 A;  3UUN A;  2W67 A;  1GQE A;  3EDV A;  3ZMZ B;  3ZMU B;  4CN6 A;  4TV8 E;  2BZB A;  4ZS3 A;  4O4L E;  2HPJ A;  2JPF A;  4MLK A;  4KX6 A;  4U7I A;  4JV5 T;  2BKN A;  3P8C D;  2ACX A;  3KVB A;  1FMV A;  5F5W A;  1MMN A;  2YK0 A;  4DUZ T;  3ZT6 A;  3RYF E;  5IYZ E;  5AFM A;  3RRW A;  2XQY A;  3AAA B;  3N2O A;  1D0Y A;  5AQF B;  2W00 A;  3CX8 B;  3RKO A;  1HR0 T;  3AA0 B;  3FHN A;  4JYA T;  1VCT A;  2WMN A;  5JR9 B;  5J5H A;  4LF4 T;  3O9X A;  3AVS A;  1FEW A;  2Z6E A;  2Y8D A;  4UF0 B;  3ZDG A;  4DV6 T;  4JLE A;  4WBO A;  4NUU A;  3A7M A;  2JMK A;  2KIN B;  1OXZ A;  2XAH B;  3N9P A;  3BQK A;  2XUE A;  3ZMS B;  2WB5 A;  3M65 A;  3F31 A;  3CKD A;  4ZK1 A;  4DR2 T;  3MAC A;  1LVK A;  5HXE A;  5LYJ E;  4YFS A;  4EZH A;  1KNP A;  3NKZ A;  1KNR A;  2E5L T;  3VRB A;  5BR8 T;  3PUR A;  1T8B A;  2UUB T;  5DQV A;  2WN9 A;  4QX7 B;  2J1D G;  3TLS A;  1E2A A;  3UQ4 A;  5FYM A;  3MJX A;  2XQ9 A;  4DUY T;  2MAW A;  3LSV A;  1E7P A;  4PJM A;  2YU2 A;  3WTI A;  2CRB A;  3AEE A;  2YIN A;  4I55 E;  3FXE B;  4QH4 A;  2CE7 A;  2NP9 A;  3N9Q A;  4QAB A;  1M62 A;  1HTJ F;  4O2B E;  5HEH A;  4FRR A;  3RKG A;  2WMO A;  4QAA A;  5EK3 A;  2WWV A;  5J0Z A;  4EXT A;  4HWH A;  2GK9 A;  2V5C A;  2M67 A;  2UXN B;  2N1G A;  5LG4 A;  4YTP A;  1ZHC A;  5LBQ B;  2ACZ A;  3CWZ B;  2XNV A;  4HE8 A;  2BYR A;  2DI4 A;  3R84 B;  5FXZ A;  3RH3 A;  5C3J A;  4Q25 A;  4TNV A;  5AQJ B;  4LF5 T;  2X68 A;  3FZM B;  3ZCI A;  4DV0 T;  1BR4 A;  2OA5 A;  1R8I A;  5BRX A;  1MMA A;  4ZXL A;  3ANW A;  1UUR A;  1N33 T;  4O4I E;  2I6H A;  4DMV A;  2HN2 A;  1KEY A;  3U8N A;  2A3D A;  5DJQ C;  4JEU B;  2H7O A;  3SOL A;  1KF6 A;  4HFH A;  4IL9 A;  3RIU C;  2DNX A;  2XQA A;  4LFB T;  3PV0 F;  3KIN B;  4WYV A;  4B3T T;  3ZSS A;  3HR0 A;  4X66 T;  5L3D B;  4FI5 A;  4F8H A;  1LRZ A;  2E5V A;  4UM1 A;  5H6R B;  4OHF A;  2ODU A;  5LXB A;  3I9W A;  2WNL A;  4JI7 T;  1IJ6 A;  4IT4 A;  3ABV A;  2BG9 A;  4UY2 A;  2QC1 B;  4E7S A;  2QRX A;  1WR6 A;  3K3O A;  3SFD A;  4ZI7 E;  4Z90 A;  3AE8 A;  3N9M A;  3AE4 A;  2Y7Y A;  1D1C A;  1NEN A;  3L3P A;  2W2U A;  1FIO A;  5AQI B;  4A97 A;  4ILA A;  5ETW A;  2JRK A;  3RQU A;  5L4E A;  3Q5X A;  2J4G A;  2J62 A;  3AA6 B;  4IE5 A;  1LKX A;  2WWU A;  4HKA A;  4GK5 E;  1D1A A;  2W63 A;  4H63 H;  5KZU A;  3ZN1 B;  2Y54 A;  2EHO D;  3ZPO A;  4GOU A;  5ABH A;  5HXC A;  3B13 A;  2BYQ A;  2LEH A;  1MNE A;  1WYB A;  3C84 A;  3CPZ A;  2W8F A;  4X1I E;  3MZK B;  5TVC A;  5LHH B;  4E7Z A;  5AFK A;  3HA4 A;  5JDF A;  3OKQ A;  2BKO A;  1HG5 A;  3KVA A;  3VR9 A;  3GMI A;  5FXX A;  2YU1 A;  4P0B A;  3IBP A;  2V7I A;  1BR0 A;  2K5B B;  4BA9 A;  4DVD A;  3WTN A;  2KXP B;  5HYA A;  1G73 A;  2QVA A;  2LOS A;  4HN9 A;  3FBZ A;  2PH9 A;  3FBL A;  3UU5 A;  3WAJ A;  3CQC B;  4XBF B;  1WR0 A;  4DBQ A;  1WLX A;  3CX7 B; 
#chains in the Genus database with same CATH homology
 4ILA A;  2BYR A;  4UM3 A;  2M6B A;  3ZDG A;  3WTH A;  3RI5 A;  3TLT A;  4TNW A;  4ZZC A;  2XQ7 A;  2WNJ A;  2XQ8 A;  4AFT A;  3RQU A;  4UM3 S;  2M6I A;  3U8L A;  5L4E A;  3UQ7 A;  2YME A;  4IL4 A;  3SQ9 A;  2BYP A;  4TNV A;  3U8K A;  1UW6 A;  4HFD A;  4WV9 A;  4ZJT A;  2BG9 E;  5J5F A;  3JAD A;  5LG3 A;  4ZZB A;  5HEJ A;  2C9T A;  4BQT A;  4BFQ A;  5BRX A;  3ZDH A;  2W8G A;  4B5D A;  2LKG A;  5HEU A;  4TWH A;  2XNU A;  5J5I A;  5HEO A;  3UU3 A;  3UUB A;  2BR8 A;  3IGQ A;  5L47 A;  5FJV A;  4XHE A;  5BP0 A;  5AFM B;  2BG9 B;  2XNT A;  2LKH A;  3T4M A;  3TLW A;  5AIN A;  4PIR A;  2BR7 A;  2YKS A;  4IRE A;  3U8N A;  5J5G A;  4ILB A;  4EZ1 A;  4LMK A;  3RQW A;  3C79 A;  5JME A;  2LM2 A;  2YOE A;  3UU6 A;  5KZU A;  2WZY A;  2Y54 A;  3JAE A;  4HFE A;  4ZK1 A;  4ZJS A;  1I9B A;  2WNC A;  4ZK4 A;  4HFH A;  3RHW A;  4QAC A;  4QH1 A;  4IL9 A;  2XQA A;  4A98 A;  4UXU A;  4LMJ A;  3WIP A;  5AFJ A;  2PGZ A;  2Y58 A;  1OED B;  2BYQ A;  3UU8 A;  3C84 A;  5AFL A;  5SYO A;  2X00 D;  2W8F A;  3RIF A;  2BG9 C;  5HEG A;  5HCM A;  3GUA A;  4HQP A;  3U8M A;  5TVC A;  2WN9 A;  4F8H A;  2XYS A;  3PEO A;  4XK9 A;  1OED E;  4AFG A;  3EHZ A;  3EI0 A;  4ALX A;  3TLS A;  3PMZ A;  2BYN A;  3UQ4 A;  2VL0 A;  5CO5 A;  4UM1 A;  5AFK A;  2XQ9 A;  3EAM A;  3WTO A;  2MAW A;  3LSV A;  4Z91 A;  4X5T A;  2XQ3 A;  1UV6 A;  4DBM A;  2YN6 A;  4UM3 P;  5LXB A;  3WTI A;  4COF A;  2X00 A;  4LML A;  3P50 A;  4QH4 A;  3U8J A;  3RIA A;  2WNL A;  3TLV A;  3WTM A;  2BYS A;  4HFI A;  2XYT A;  2ZJU A;  5AFM A;  4D01 A;  4QAB A;  3JAF A;  4NPP A;  5KE4 A;  2KSR A;  2YMD A;  5HEH A;  2BG9 A;  4UY2 A;  2QC1 B;  3WTL A;  4FRR A;  3WTK A;  5HCJ A;  3TLU A;  4QAA A;  4AFH A;  3ZKR A;  2XQ5 A;  2UZ6 A;  2XQ4 A;  4TWF A;  5AFN A;  2LLY A;  5L4H A;  2ZJV A;  3WTJ A;  1UX2 A;  2BJ0 A;  2Y57 A;  3P4W A;  3SIO A;  3WTN A;  5J0Z A;  4NZB A;  4ZR6 A;  4Z90 A;  4HFB A;  2XZ6 A;  4ILC A;  4QH5 A;  3SH1 A;  2Y56 A;  2Y7Y A;  2XZ5 A;  4TWD A;  5CFB A;  2PH9 A;  3UU5 A;  2XQ6 A;  3SQ6 A;  5J5H A;  5AFH A;  5BW2 A;  1OED A;  1OED C;  4HFC A;  5IUX A;  4ZRU A;  2XNV A;  4A97 A;  3UU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...