2Y58A

Fragment growing induces conformational changes in acetylcholine- binding protein: a structural and thermodynamic analysis - (compound 6)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Fragment Growing Induces Conformational Changes in Acetylcholine-Binding Protein: A Structural and Thermodynamic Analysis.
pubmed doi rcsb
source organism Aplysia californica
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2y58A00
3UU3A 2Y54A 3U8MA 5L4EA 4QH5A 1UW6A 3RQWA 3SH1A 3U8KA 2WNCA 3WIPA 5JMEA 2XNUA 5L47A 3WTKA 3UQ7A 4NZBA 4UM3P 5CFBA 4IREA 4QACA 2ZJVA 3TLTA 5HCMA 4Z90A 4UM3S 2BYQA 2UZ6A 3WTOA 3C79A 2XZ6A 2XYSA 2XQ6A 3LSVA 5KE4A 1UX2A 2Y57A 2BG9A 2BG9B 2YOEA 3TLSA 3WTHA 3P50A 4LMKA 4TWDA 3WTJA 2WN9A 4TWFA 4UY2A 4HQPA 3JAFA 3UUBA 4HFBA 4WV9A 5HEJA 4QAAA 4XHEA 4HFEA 2QC1B 4IL4A 3PMZA 2X00D 4ZK4A 5AFMA 4FRRA 1UV6A 5J5GA 3UU8A 3TLVA 3EHZA 4LMLA 4TWHA 4IL9A 4ILCA 3EI0A 2BJ0A 5IUXA 3SQ6A 3SIOA 5KZUA 2Y7YA 5J0ZA 5HEHA 4ZK1A 4HFCA 4BQTA 2XQ3A 4Z91A 2XYTA 5HEOA 4ZRUA 3C84A 4BFQA 5AFLA 5BP0A 2XQ7A 2PH9A 2WNLA 2YMEA 3WTMA 5LG3A 4QABA 4NPPA 4PIRA 4ALXA 5AFHA 4ZJTA 4QH1A 4F8HA 3WTNA 4UM1A 4ILAA 5J5HA 2XQAA 2BR7A 3PEOA 3UU5A 2W8GA 2ZJUA 3RHWA 4LMJA 4ZJSA 4ZZCA 2BYNA 5HEUA 4QH4A 2XQ5A 5FJVA 5HCJA 3U8LA 4DBMA 3P4WA 4HFDA 3TLWA 2XQ8A 5AINA 2XQ9A 2YKSA 5J5FA 4AFTA 4ZZBA 2BYRA 2Y56A 2BG9C 3JAEA 2BYSA 5HEGA 5AFMB 5AFKA 4XK9A 5L4HA 2XZ5A 4HFHA 3UU4A 3UU6A 3IGQA 2Y58A 5SYOA 2VL0A 4A98A 4A97A 2BR8A 3ZKRA 4HFIA 3RQUA 3SQ9A 2XNTA 3JADA 3U8JA 3RIAA 5AFNA 2XQ4A 4COFA 2C9TA 3T4MA 3WTLA 2YMDA 5BW2A 4TNWA 3RIFA 1I9BA 5BRXA 4AFGA 2BYPA 5J5IA 4UXUA 2XNVA 5AFJA 3ZDGA 2X00A 3ZDHA 3EAMA 4TNVA 3WTIA 3UQ4A 4AFHA 3TLUA 4B5DA 2WZYA 5TVCA 2W8FA 4X5TA 5LXBA 3U8NA 4ZR6A 4ILBA 3GUAA 4UM3A 2YN6A 3RI5A 2BG9E 4D01A 2PGZA 2WNJA 4EZ1A 5CO5A
chains in the Genus database with same CATH superfamily
3UU3A 2Y54A 3U8MA 5L4EA 4QH5A 1UW6A 3RQWA 3SH1A 3U8KA 2WNCA 3WIPA 5JMEA 2XNUA 5L47A 3WTKA 3UQ7A 4NZBA 4UM3P 5CFBA 4IREA 4QACA 2ZJVA 3TLTA 5HCMA 4Z90A 4UM3S 2BYQA 2UZ6A 3WTOA 3C79A 2XZ6A 2XYSA 2XQ6A 3LSVA 5KE4A 1UX2A 2Y57A 2BG9A 2BG9B 2YOEA 3TLSA 3WTHA 3P50A 4LMKA 4TWDA 3WTJA 2WN9A 4TWFA 4UY2A 4HQPA 3JAFA 3UUBA 4HFBA 4WV9A 5HEJA 4QAAA 4XHEA 4HFEA 2QC1B 4IL4A 3PMZA 2X00D 4ZK4A 5AFMA 4FRRA 1UV6A 5J5GA 3UU8A 3TLVA 3EHZA 4LMLA 4TWHA 4IL9A 4ILCA 3EI0A 2BJ0A 5IUXA 3SQ6A 3SIOA 5KZUA 2Y7YA 5J0ZA 5HEHA 4ZK1A 4HFCA 4BQTA 2XQ3A 4Z91A 2XYTA 5HEOA 4ZRUA 3C84A 4BFQA 5AFLA 5BP0A 2XQ7A 2PH9A 2WNLA 2YMEA 3WTMA 5LG3A 4QABA 4NPPA 4PIRA 4ALXA 5AFHA 4ZJTA 4QH1A 4F8HA 3WTNA 4UM1A 4ILAA 5J5HA 2XQAA 2BR7A 3PEOA 3UU5A 2W8GA 2ZJUA 3RHWA 4LMJA 4ZJSA 4ZZCA 2BYNA 5HEUA 4QH4A 2XQ5A 5FJVA 5HCJA 3U8LA 4DBMA 3P4WA 4HFDA 3TLWA 2XQ8A 5AINA 2XQ9A 2YKSA 5J5FA 4AFTA 4ZZBA 2BYRA 2Y56A 2BG9C 3JAEA 2BYSA 5HEGA 5AFMB 5AFKA 4XK9A 5L4HA 2XZ5A 4HFHA 3UU4A 3UU6A 3IGQA 2Y58A 5SYOA 2VL0A 4A98A 4A97A 2BR8A 3ZKRA 4HFIA 3RQUA 3SQ9A 2XNTA 3JADA 3U8JA 3RIAA 5AFNA 2XQ4A 4COFA 2C9TA 3T4MA 3WTLA 2YMDA 5BW2A 4TNWA 3RIFA 1I9BA 5BRXA 4AFGA 2BYPA 5J5IA 4UXUA 2XNVA 5AFJA 3ZDGA 2X00A 3ZDHA 3EAMA 4TNVA 3WTIA 3UQ4A 4AFHA 3TLUA 4B5DA 2WZYA 5TVCA 2W8FA 4X5TA 5LXBA 3U8NA 4ZR6A 4ILBA 3GUAA 4UM3A 2YN6A 3RI5A 2BG9E 4D01A 2PGZA 2WNJA 4EZ1A 5CO5A
chains in the Genus database with same CATH topology
3UU3A 2Y54A 3U8MA 5L4EA 4QH5A 1UW6A 3RQWA 3SH1A 3U8KA 2WNCA 3WIPA 5JMEA 2XNUA 5L47A 3WTKA 3UQ7A 4NZBA 4UM3P 5CFBA 4IREA 4QACA 2ZJVA 3TLTA 5HCMA 4Z90A 4UM3S 2BYQA 2UZ6A 3WTOA 3C79A 2XZ6A 2XYSA 2XQ6A 3LSVA 5KE4A 1UX2A 2Y57A 2BG9A 2BG9B 2YOEA 3TLSA 3WTHA 3P50A 4LMKA 4TWDA 3WTJA 2WN9A 4TWFA 4UY2A 4HQPA 3JAFA 3UUBA 4HFBA 4WV9A 5HEJA 4QAAA 4XHEA 4HFEA 2QC1B 4IL4A 3PMZA 2X00D 4ZK4A 5AFMA 4FRRA 1UV6A 5J5GA 3UU8A 3TLVA 3EHZA 4LMLA 4TWHA 4IL9A 4ILCA 3EI0A 2BJ0A 5IUXA 3SQ6A 3SIOA 5KZUA 2Y7YA 5J0ZA 5HEHA 4ZK1A 4HFCA 4BQTA 2XQ3A 4Z91A 2XYTA 5HEOA 4ZRUA 3C84A 4BFQA 5AFLA 5BP0A 2XQ7A 2PH9A 2WNLA 2YMEA 3WTMA 5LG3A 4QABA 4NPPA 4PIRA 4ALXA 5AFHA 4ZJTA 4QH1A 4F8HA 3WTNA 4UM1A 4ILAA 5J5HA 2XQAA 2BR7A 3PEOA 3UU5A 2W8GA 2ZJUA 3RHWA 4LMJA 4ZJSA 4ZZCA 2BYNA 5HEUA 4QH4A 2XQ5A 5FJVA 5HCJA 3U8LA 4DBMA 3P4WA 4HFDA 3TLWA 2XQ8A 5AINA 2XQ9A 2YKSA 5J5FA 4AFTA 4ZZBA 2BYRA 2Y56A 2BG9C 3JAEA 2BYSA 5HEGA 5AFMB 5AFKA 4XK9A 5L4HA 2XZ5A 4HFHA 3UU4A 3UU6A 3IGQA 2Y58A 5SYOA 2VL0A 4A98A 4A97A 2BR8A 3ZKRA 4HFIA 3RQUA 3SQ9A 2XNTA 3JADA 3U8JA 3RIAA 5AFNA 2XQ4A 4COFA 2C9TA 3T4MA 3WTLA 2YMDA 5BW2A 4TNWA 3RIFA 1I9BA 5BRXA 4AFGA 2BYPA 5J5IA 4UXUA 2XNVA 5AFJA 3ZDGA 2X00A 3ZDHA 3EAMA 4TNVA 3WTIA 3UQ4A 4AFHA 3TLUA 4B5DA 2WZYA 5TVCA 2W8FA 4X5TA 5LXBA 3U8NA 4ZR6A 4ILBA 3GUAA 4UM3A 2YN6A 3RI5A 2BG9E 4D01A 2PGZA 2WNJA 4EZ1A 5CO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU3 A;  2Y54 A;  3U8M A;  5L4E A;  4QH5 A;  1UW6 A;  3RQW A;  3SH1 A;  3U8K A;  2WNC A;  3WIP A;  5JME A;  2XNU A;  5L47 A;  3WTK A;  3UQ7 A;  4NZB A;  4UM3 P;  5CFB A;  4IRE A;  4QAC A;  2ZJV A;  3TLT A;  5HCM A;  4Z90 A;  4UM3 S;  2BYQ A;  2UZ6 A;  3WTO A;  3C79 A;  2XZ6 A;  2XYS A;  2XQ6 A;  3LSV A;  5KE4 A;  1UX2 A;  2Y57 A;  2BG9 A;  2BG9 B;  2YOE A;  3TLS A;  3WTH A;  3P50 A;  4LMK A;  4TWD A;  3WTJ A;  2WN9 A;  4TWF A;  4UY2 A;  4HQP A;  3JAF A;  3UUB A;  4HFB A;  4WV9 A;  5HEJ A;  4QAA A;  4XHE A;  4HFE A;  2QC1 B;  4IL4 A;  3PMZ A;  2X00 D;  4ZK4 A;  5AFM A;  4FRR A;  1UV6 A;  5J5G A;  3UU8 A;  3TLV A;  3EHZ A;  4LML A;  4TWH A;  4IL9 A;  4ILC A;  3EI0 A;  2BJ0 A;  5IUX A;  3SQ6 A;  3SIO A;  5KZU A;  2Y7Y A;  5J0Z A;  5HEH A;  4ZK1 A;  4HFC A;  4BQT A;  2XQ3 A;  4Z91 A;  2XYT A;  5HEO A;  4ZRU A;  3C84 A;  4BFQ A;  5AFL A;  5BP0 A;  2XQ7 A;  2PH9 A;  2WNL A;  2YME A;  3WTM A;  5LG3 A;  4QAB A;  4NPP A;  4PIR A;  4ALX A;  5AFH A;  4ZJT A;  4QH1 A;  4F8H A;  3WTN A;  4UM1 A;  4ILA A;  5J5H A;  2XQA A;  2BR7 A;  3PEO A;  3UU5 A;  2W8G A;  2ZJU A;  3RHW A;  4LMJ A;  4ZJS A;  4ZZC A;  2BYN A;  5HEU A;  4QH4 A;  2XQ5 A;  5FJV A;  5HCJ A;  3U8L A;  4DBM A;  3P4W A;  4HFD A;  3TLW A;  2XQ8 A;  5AIN A;  2XQ9 A;  2YKS A;  5J5F A;  4AFT A;  4ZZB A;  2BYR A;  2Y56 A;  2BG9 C;  3JAE A;  2BYS A;  5HEG A;  5AFM B;  5AFK A;  4XK9 A;  5L4H A;  2XZ5 A;  4HFH A;  3UU4 A;  3UU6 A;  3IGQ A;  2Y58 A;  5SYO A;  2VL0 A;  4A98 A;  4A97 A;  2BR8 A;  3ZKR A;  4HFI A;  3RQU A;  3SQ9 A;  2XNT A;  3JAD A;  3U8J A;  3RIA A;  5AFN A;  2XQ4 A;  4COF A;  2C9T A;  3T4M A;  3WTL A;  2YMD A;  5BW2 A;  4TNW A;  3RIF A;  1I9B A;  5BRX A;  4AFG A;  2BYP A;  5J5I A;  4UXU A;  2XNV A;  5AFJ A;  3ZDG A;  2X00 A;  3ZDH A;  3EAM A;  4TNV A;  3WTI A;  3UQ4 A;  4AFH A;  3TLU A;  4B5D A;  2WZY A;  5TVC A;  2W8F A;  4X5T A;  5LXB A;  3U8N A;  4ZR6 A;  4ILB A;  3GUA A;  4UM3 A;  2YN6 A;  3RI5 A;  2BG9 E;  4D01 A;  2PGZ A;  2WNJ A;  4EZ1 A;  5CO5 A; 
#chains in the Genus database with same CATH topology
 3UU3 A;  2Y54 A;  3U8M A;  5L4E A;  4QH5 A;  1UW6 A;  3RQW A;  3SH1 A;  3U8K A;  2WNC A;  3WIP A;  5JME A;  2XNU A;  5L47 A;  3WTK A;  3UQ7 A;  4NZB A;  4UM3 P;  5CFB A;  4IRE A;  4QAC A;  2ZJV A;  3TLT A;  5HCM A;  4Z90 A;  4UM3 S;  2BYQ A;  2UZ6 A;  3WTO A;  3C79 A;  2XZ6 A;  2XYS A;  2XQ6 A;  3LSV A;  5KE4 A;  1UX2 A;  2Y57 A;  2BG9 A;  2BG9 B;  2YOE A;  3TLS A;  3WTH A;  3P50 A;  4LMK A;  4TWD A;  3WTJ A;  2WN9 A;  4TWF A;  4UY2 A;  4HQP A;  3JAF A;  3UUB A;  4HFB A;  4WV9 A;  5HEJ A;  4QAA A;  4XHE A;  4HFE A;  2QC1 B;  4IL4 A;  3PMZ A;  2X00 D;  4ZK4 A;  5AFM A;  4FRR A;  1UV6 A;  5J5G A;  3UU8 A;  3TLV A;  3EHZ A;  4LML A;  4TWH A;  4IL9 A;  4ILC A;  3EI0 A;  2BJ0 A;  5IUX A;  3SQ6 A;  3SIO A;  5KZU A;  2Y7Y A;  5J0Z A;  5HEH A;  4ZK1 A;  4HFC A;  4BQT A;  2XQ3 A;  4Z91 A;  2XYT A;  5HEO A;  4ZRU A;  3C84 A;  4BFQ A;  5AFL A;  5BP0 A;  2XQ7 A;  2PH9 A;  2WNL A;  2YME A;  3WTM A;  5LG3 A;  4QAB A;  4NPP A;  4PIR A;  4ALX A;  5AFH A;  4ZJT A;  4QH1 A;  4F8H A;  3WTN A;  4UM1 A;  4ILA A;  5J5H A;  2XQA A;  2BR7 A;  3PEO A;  3UU5 A;  2W8G A;  2ZJU A;  3RHW A;  4LMJ A;  4ZJS A;  4ZZC A;  2BYN A;  5HEU A;  4QH4 A;  2XQ5 A;  5FJV A;  5HCJ A;  3U8L A;  4DBM A;  3P4W A;  4HFD A;  3TLW A;  2XQ8 A;  5AIN A;  2XQ9 A;  2YKS A;  5J5F A;  4AFT A;  4ZZB A;  2BYR A;  2Y56 A;  2BG9 C;  3JAE A;  2BYS A;  5HEG A;  5AFM B;  5AFK A;  4XK9 A;  5L4H A;  2XZ5 A;  4HFH A;  3UU4 A;  3UU6 A;  3IGQ A;  2Y58 A;  5SYO A;  2VL0 A;  4A98 A;  4A97 A;  2BR8 A;  3ZKR A;  4HFI A;  3RQU A;  3SQ9 A;  2XNT A;  3JAD A;  3U8J A;  3RIA A;  5AFN A;  2XQ4 A;  4COF A;  2C9T A;  3T4M A;  3WTL A;  2YMD A;  5BW2 A;  4TNW A;  3RIF A;  1I9B A;  5BRX A;  4AFG A;  2BYP A;  5J5I A;  4UXU A;  2XNV A;  5AFJ A;  3ZDG A;  2X00 A;  3ZDH A;  3EAM A;  4TNV A;  3WTI A;  3UQ4 A;  4AFH A;  3TLU A;  4B5D A;  2WZY A;  5TVC A;  2W8F A;  4X5T A;  5LXB A;  3U8N A;  4ZR6 A;  4ILB A;  3GUA A;  4UM3 A;  2YN6 A;  3RI5 A;  2BG9 E;  4D01 A;  2PGZ A;  2WNJ A;  4EZ1 A;  5CO5 A; 
#chains in the Genus database with same CATH homology
 3UU3 A;  2Y54 A;  3U8M A;  5L4E A;  4QH5 A;  1UW6 A;  3RQW A;  3SH1 A;  3U8K A;  2WNC A;  3WIP A;  5JME A;  2XNU A;  5L47 A;  3WTK A;  3UQ7 A;  4NZB A;  4UM3 P;  5CFB A;  4IRE A;  4QAC A;  2ZJV A;  3TLT A;  5HCM A;  4Z90 A;  4UM3 S;  2BYQ A;  2UZ6 A;  3WTO A;  3C79 A;  2XZ6 A;  2XYS A;  2XQ6 A;  3LSV A;  5KE4 A;  1UX2 A;  2Y57 A;  2BG9 A;  2BG9 B;  2YOE A;  3TLS A;  3WTH A;  3P50 A;  4LMK A;  4TWD A;  3WTJ A;  2WN9 A;  4TWF A;  4UY2 A;  4HQP A;  3JAF A;  3UUB A;  4HFB A;  4WV9 A;  5HEJ A;  4QAA A;  4XHE A;  4HFE A;  2QC1 B;  4IL4 A;  3PMZ A;  2X00 D;  4ZK4 A;  5AFM A;  4FRR A;  1UV6 A;  5J5G A;  3UU8 A;  3TLV A;  3EHZ A;  4LML A;  4TWH A;  4IL9 A;  4ILC A;  3EI0 A;  2BJ0 A;  5IUX A;  3SQ6 A;  3SIO A;  5KZU A;  2Y7Y A;  5J0Z A;  5HEH A;  4ZK1 A;  4HFC A;  4BQT A;  2XQ3 A;  4Z91 A;  2XYT A;  5HEO A;  4ZRU A;  3C84 A;  4BFQ A;  5AFL A;  5BP0 A;  2XQ7 A;  2PH9 A;  2WNL A;  2YME A;  3WTM A;  5LG3 A;  4QAB A;  4NPP A;  4PIR A;  4ALX A;  5AFH A;  4ZJT A;  4QH1 A;  4F8H A;  3WTN A;  4UM1 A;  4ILA A;  5J5H A;  2XQA A;  2BR7 A;  3PEO A;  3UU5 A;  2W8G A;  2ZJU A;  3RHW A;  4LMJ A;  4ZJS A;  4ZZC A;  2BYN A;  5HEU A;  4QH4 A;  2XQ5 A;  5FJV A;  5HCJ A;  3U8L A;  4DBM A;  3P4W A;  4HFD A;  3TLW A;  2XQ8 A;  5AIN A;  2XQ9 A;  2YKS A;  5J5F A;  4AFT A;  4ZZB A;  2BYR A;  2Y56 A;  2BG9 C;  3JAE A;  2BYS A;  5HEG A;  5AFM B;  5AFK A;  4XK9 A;  5L4H A;  2XZ5 A;  4HFH A;  3UU4 A;  3UU6 A;  3IGQ A;  2Y58 A;  5SYO A;  2VL0 A;  4A98 A;  4A97 A;  2BR8 A;  3ZKR A;  4HFI A;  3RQU A;  3SQ9 A;  2XNT A;  3JAD A;  3U8J A;  3RIA A;  5AFN A;  2XQ4 A;  4COF A;  2C9T A;  3T4M A;  3WTL A;  2YMD A;  5BW2 A;  4TNW A;  3RIF A;  1I9B A;  5BRX A;  4AFG A;  2BYP A;  5J5I A;  4UXU A;  2XNV A;  5AFJ A;  3ZDG A;  2X00 A;  3ZDH A;  3EAM A;  4TNV A;  3WTI A;  3UQ4 A;  4AFH A;  3TLU A;  4B5D A;  2WZY A;  5TVC A;  2W8F A;  4X5T A;  5LXB A;  3U8N A;  4ZR6 A;  4ILB A;  3GUA A;  4UM3 A;  2YN6 A;  3RI5 A;  2BG9 E;  4D01 A;  2PGZ A;  2WNJ A;  4EZ1 A;  5CO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...