2Y58A

Fragment growing induces conformational changes in acetylcholine- binding protein: a structural and thermodynamic analysis - (compound 6)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Fragment Growing Induces Conformational Changes in Acetylcholine-Binding Protein: A Structural and Thermodynamic Analysis.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2y58A00
5HCJA 3RHWA 3PMZA 2BYQA 4QH4A 4UY2A 4A98A 4UM3P 3ZDHA 2WNJA 4XK9A 3GUAA 3TLTA 5HCMA 2ZJUA 4ZRUA 3RIAA 4AFGA 3UUBA 2Y58A 4A97A 3WTOA 4XHEA 4TNVA 3SIOA 2XZ6A 2WNCA 4B5DA 5KE4A 5HEUA 2XYSA 2UZ6A 3UU4A 2X00D 2WN9A 2YKSA 2X00A 2BYPA 4NZBA 3JAEA 4HFBA 5AFKA 3TLSA 2XQ5A 2Y7YA 5AFMA 3WTLA 2XQ7A 3UU3A 2XQ4A 4HFDA 4QAAA 3WTMA 4HFIA 4AFHA 2YN6A 5KZUA 4AFTA 3T4MA 2BJ0A 3UU5A 4UM1A 4ILAA 5IUXA 3C79A 2XNTA 4ZK4A 4WV9A 1UX2A 3RQWA 4LMJA 4TNWA 4ILBA 3EHZA 3UU8A 2PH9A 2XQAA 4ZK1A 4UM3A 5L4EA 4EZ1A 2XNUA 3IGQA 5HEGA 3P4WA 5AFJA 3U8NA 4HFCA 3U8KA 3UU6A 5AFMB 2Y56A 2PGZA 3U8LA 2VL0A 3WTNA 4HQPA 2YOEA 4TWFA 2XZ5A 4HFHA 5JMEA 2YMDA 5J5FA 4PIRA 5SYOA 4Z90A 5TVCA 3U8MA 3EI0A 4F8HA 4ILCA 5BP0A 4IL4A 4D01A 2BG9E 3RI5A 5CFBA 2C9TA 5HEJA 5HEOA 4TWDA 4HFEA 3LSVA 4FRRA 4UM3S 3WTJA 2BR8A 3UQ7A 4QACA 5LG3A 3JADA 4IREA 3PEOA 5AFLA 3WTKA 4ZR6A 5J5IA 4IL9A 4ZZCA 2XQ3A 2BYNA 2XQ6A 3SH1A 3C84A 3RIFA 3SQ6A 2XQ9A 2Y57A 3TLVA 4DBMA 4UXUA 2BG9A 4X5TA 3SQ9A 5LXBA 2WNLA 4BFQA 5L4HA 5AFNA 5BRXA 3UQ4A 4QH5A 5L47A 4TWHA 3U8JA 3RQUA 1UV6A 2WZYA 2BYSA 4BQTA 3TLWA 4QABA 4ZJTA 3JAFA 2QC1B 3EAMA 4Z91A 3TLUA 5J0ZA 4LMKA 5HEHA 2BG9C 3WTHA 2BYRA 1I9BA 3WIPA 2Y54A 5BW2A 4ZZBA 4QH1A 4ALXA 3WTIA 5FJVA 5CO5A 4COFA 5AFHA 2YMEA 3ZDGA 1UW6A 2BG9B 5J5GA 4ZJSA 2XQ8A 5AINA 3ZKRA 2XNVA 2BR7A 2W8FA 2W8GA 2ZJVA 3P50A 4LMLA 5J5HA 4NPPA 2XYTA
chains in the Genus database with same CATH superfamily
5HCJA 3RHWA 3PMZA 2BYQA 4QH4A 4UY2A 4A98A 4UM3P 3ZDHA 2WNJA 4XK9A 3GUAA 3TLTA 5HCMA 2ZJUA 4ZRUA 3RIAA 4AFGA 3UUBA 2Y58A 4A97A 3WTOA 4XHEA 4TNVA 3SIOA 2XZ6A 2WNCA 4B5DA 5KE4A 5HEUA 2XYSA 2UZ6A 3UU4A 2X00D 2WN9A 2YKSA 2X00A 2BYPA 4NZBA 3JAEA 4HFBA 5AFKA 3TLSA 2XQ5A 2Y7YA 5AFMA 3WTLA 2XQ7A 3UU3A 2XQ4A 4HFDA 4QAAA 3WTMA 4HFIA 4AFHA 2YN6A 5KZUA 4AFTA 3T4MA 2BJ0A 3UU5A 4UM1A 4ILAA 5IUXA 3C79A 2XNTA 4ZK4A 4WV9A 1UX2A 3RQWA 4LMJA 4TNWA 4ILBA 3EHZA 3UU8A 2PH9A 2XQAA 4ZK1A 4UM3A 5L4EA 4EZ1A 2XNUA 3IGQA 5HEGA 3P4WA 5AFJA 3U8NA 4HFCA 3U8KA 3UU6A 5AFMB 2Y56A 2PGZA 3U8LA 2VL0A 3WTNA 4HQPA 2YOEA 4TWFA 2XZ5A 4HFHA 5JMEA 2YMDA 5J5FA 4PIRA 5SYOA 4Z90A 5TVCA 3U8MA 3EI0A 4F8HA 4ILCA 5BP0A 4IL4A 4D01A 2BG9E 3RI5A 5CFBA 2C9TA 5HEJA 5HEOA 4TWDA 4HFEA 3LSVA 4FRRA 4UM3S 3WTJA 2BR8A 3UQ7A 4QACA 5LG3A 3JADA 4IREA 3PEOA 5AFLA 3WTKA 4ZR6A 5J5IA 4IL9A 4ZZCA 2XQ3A 2BYNA 2XQ6A 3SH1A 3C84A 3RIFA 3SQ6A 2XQ9A 2Y57A 3TLVA 4DBMA 4UXUA 2BG9A 4X5TA 3SQ9A 5LXBA 2WNLA 4BFQA 5L4HA 5AFNA 5BRXA 3UQ4A 4QH5A 5L47A 4TWHA 3U8JA 3RQUA 1UV6A 2WZYA 2BYSA 4BQTA 3TLWA 4QABA 4ZJTA 3JAFA 2QC1B 3EAMA 4Z91A 3TLUA 5J0ZA 4LMKA 5HEHA 2BG9C 3WTHA 2BYRA 1I9BA 3WIPA 2Y54A 5BW2A 4ZZBA 4QH1A 4ALXA 3WTIA 5FJVA 5CO5A 4COFA 5AFHA 2YMEA 3ZDGA 1UW6A 2BG9B 5J5GA 4ZJSA 2XQ8A 5AINA 3ZKRA 2XNVA 2BR7A 2W8FA 2W8GA 2ZJVA 3P50A 4LMLA 5J5HA 4NPPA 2XYTA
chains in the Genus database with same CATH topology
5HCJA 3RHWA 3PMZA 2BYQA 4QH4A 4UY2A 4A98A 4UM3P 3ZDHA 2WNJA 4XK9A 3GUAA 3TLTA 5HCMA 2ZJUA 4ZRUA 3RIAA 4AFGA 3UUBA 2Y58A 4A97A 3WTOA 4XHEA 4TNVA 3SIOA 2XZ6A 2WNCA 4B5DA 5KE4A 5HEUA 2XYSA 2UZ6A 3UU4A 2X00D 2WN9A 2YKSA 2X00A 2BYPA 4NZBA 3JAEA 4HFBA 5AFKA 3TLSA 2XQ5A 2Y7YA 5AFMA 3WTLA 2XQ7A 3UU3A 2XQ4A 4HFDA 4QAAA 3WTMA 4HFIA 4AFHA 2YN6A 5KZUA 4AFTA 3T4MA 2BJ0A 3UU5A 4UM1A 4ILAA 5IUXA 3C79A 2XNTA 4ZK4A 4WV9A 1UX2A 3RQWA 4LMJA 4TNWA 4ILBA 3EHZA 3UU8A 2PH9A 2XQAA 4ZK1A 4UM3A 5L4EA 4EZ1A 2XNUA 3IGQA 5HEGA 3P4WA 5AFJA 3U8NA 4HFCA 3U8KA 3UU6A 5AFMB 2Y56A 2PGZA 3U8LA 2VL0A 3WTNA 4HQPA 2YOEA 4TWFA 2XZ5A 4HFHA 5JMEA 2YMDA 5J5FA 4PIRA 5SYOA 4Z90A 5TVCA 3U8MA 3EI0A 4F8HA 4ILCA 5BP0A 4IL4A 4D01A 2BG9E 3RI5A 5CFBA 2C9TA 5HEJA 5HEOA 4TWDA 4HFEA 3LSVA 4FRRA 4UM3S 3WTJA 2BR8A 3UQ7A 4QACA 5LG3A 3JADA 4IREA 3PEOA 5AFLA 3WTKA 4ZR6A 5J5IA 4IL9A 4ZZCA 2XQ3A 2BYNA 2XQ6A 3SH1A 3C84A 3RIFA 3SQ6A 2XQ9A 2Y57A 3TLVA 4DBMA 4UXUA 2BG9A 4X5TA 3SQ9A 5LXBA 2WNLA 4BFQA 5L4HA 5AFNA 5BRXA 3UQ4A 4QH5A 5L47A 4TWHA 3U8JA 3RQUA 1UV6A 2WZYA 2BYSA 4BQTA 3TLWA 4QABA 4ZJTA 3JAFA 2QC1B 3EAMA 4Z91A 3TLUA 5J0ZA 4LMKA 5HEHA 2BG9C 3WTHA 2BYRA 1I9BA 3WIPA 2Y54A 5BW2A 4ZZBA 4QH1A 4ALXA 3WTIA 5FJVA 5CO5A 4COFA 5AFHA 2YMEA 3ZDGA 1UW6A 2BG9B 5J5GA 4ZJSA 2XQ8A 5AINA 3ZKRA 2XNVA 2BR7A 2W8FA 2W8GA 2ZJVA 3P50A 4LMLA 5J5HA 4NPPA 2XYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HCJ A;  3RHW A;  3PMZ A;  2BYQ A;  4QH4 A;  4UY2 A;  4A98 A;  4UM3 P;  3ZDH A;  2WNJ A;  4XK9 A;  3GUA A;  3TLT A;  5HCM A;  2ZJU A;  4ZRU A;  3RIA A;  4AFG A;  3UUB A;  2Y58 A;  4A97 A;  3WTO A;  4XHE A;  4TNV A;  3SIO A;  2XZ6 A;  2WNC A;  4B5D A;  5KE4 A;  5HEU A;  2XYS A;  2UZ6 A;  3UU4 A;  2X00 D;  2WN9 A;  2YKS A;  2X00 A;  2BYP A;  4NZB A;  3JAE A;  4HFB A;  5AFK A;  3TLS A;  2XQ5 A;  2Y7Y A;  5AFM A;  3WTL A;  2XQ7 A;  3UU3 A;  2XQ4 A;  4HFD A;  4QAA A;  3WTM A;  4HFI A;  4AFH A;  2YN6 A;  5KZU A;  4AFT A;  3T4M A;  2BJ0 A;  3UU5 A;  4UM1 A;  4ILA A;  5IUX A;  3C79 A;  2XNT A;  4ZK4 A;  4WV9 A;  1UX2 A;  3RQW A;  4LMJ A;  4TNW A;  4ILB A;  3EHZ A;  3UU8 A;  2PH9 A;  2XQA A;  4ZK1 A;  4UM3 A;  5L4E A;  4EZ1 A;  2XNU A;  3IGQ A;  5HEG A;  3P4W A;  5AFJ A;  3U8N A;  4HFC A;  3U8K A;  3UU6 A;  5AFM B;  2Y56 A;  2PGZ A;  3U8L A;  2VL0 A;  3WTN A;  4HQP A;  2YOE A;  4TWF A;  2XZ5 A;  4HFH A;  5JME A;  2YMD A;  5J5F A;  4PIR A;  5SYO A;  4Z90 A;  5TVC A;  3U8M A;  3EI0 A;  4F8H A;  4ILC A;  5BP0 A;  4IL4 A;  4D01 A;  2BG9 E;  3RI5 A;  5CFB A;  2C9T A;  5HEJ A;  5HEO A;  4TWD A;  4HFE A;  3LSV A;  4FRR A;  4UM3 S;  3WTJ A;  2BR8 A;  3UQ7 A;  4QAC A;  5LG3 A;  3JAD A;  4IRE A;  3PEO A;  5AFL A;  3WTK A;  4ZR6 A;  5J5I A;  4IL9 A;  4ZZC A;  2XQ3 A;  2BYN A;  2XQ6 A;  3SH1 A;  3C84 A;  3RIF A;  3SQ6 A;  2XQ9 A;  2Y57 A;  3TLV A;  4DBM A;  4UXU A;  2BG9 A;  4X5T A;  3SQ9 A;  5LXB A;  2WNL A;  4BFQ A;  5L4H A;  5AFN A;  5BRX A;  3UQ4 A;  4QH5 A;  5L47 A;  4TWH A;  3U8J A;  3RQU A;  1UV6 A;  2WZY A;  2BYS A;  4BQT A;  3TLW A;  4QAB A;  4ZJT A;  3JAF A;  2QC1 B;  3EAM A;  4Z91 A;  3TLU A;  5J0Z A;  4LMK A;  5HEH A;  2BG9 C;  3WTH A;  2BYR A;  1I9B A;  3WIP A;  2Y54 A;  5BW2 A;  4ZZB A;  4QH1 A;  4ALX A;  3WTI A;  5FJV A;  5CO5 A;  4COF A;  5AFH A;  2YME A;  3ZDG A;  1UW6 A;  2BG9 B;  5J5G A;  4ZJS A;  2XQ8 A;  5AIN A;  3ZKR A;  2XNV A;  2BR7 A;  2W8F A;  2W8G A;  2ZJV A;  3P50 A;  4LML A;  5J5H A;  4NPP A;  2XYT A; 
#chains in the Genus database with same CATH topology
 5HCJ A;  3RHW A;  3PMZ A;  2BYQ A;  4QH4 A;  4UY2 A;  4A98 A;  4UM3 P;  3ZDH A;  2WNJ A;  4XK9 A;  3GUA A;  3TLT A;  5HCM A;  2ZJU A;  4ZRU A;  3RIA A;  4AFG A;  3UUB A;  2Y58 A;  4A97 A;  3WTO A;  4XHE A;  4TNV A;  3SIO A;  2XZ6 A;  2WNC A;  4B5D A;  5KE4 A;  5HEU A;  2XYS A;  2UZ6 A;  3UU4 A;  2X00 D;  2WN9 A;  2YKS A;  2X00 A;  2BYP A;  4NZB A;  3JAE A;  4HFB A;  5AFK A;  3TLS A;  2XQ5 A;  2Y7Y A;  5AFM A;  3WTL A;  2XQ7 A;  3UU3 A;  2XQ4 A;  4HFD A;  4QAA A;  3WTM A;  4HFI A;  4AFH A;  2YN6 A;  5KZU A;  4AFT A;  3T4M A;  2BJ0 A;  3UU5 A;  4UM1 A;  4ILA A;  5IUX A;  3C79 A;  2XNT A;  4ZK4 A;  4WV9 A;  1UX2 A;  3RQW A;  4LMJ A;  4TNW A;  4ILB A;  3EHZ A;  3UU8 A;  2PH9 A;  2XQA A;  4ZK1 A;  4UM3 A;  5L4E A;  4EZ1 A;  2XNU A;  3IGQ A;  5HEG A;  3P4W A;  5AFJ A;  3U8N A;  4HFC A;  3U8K A;  3UU6 A;  5AFM B;  2Y56 A;  2PGZ A;  3U8L A;  2VL0 A;  3WTN A;  4HQP A;  2YOE A;  4TWF A;  2XZ5 A;  4HFH A;  5JME A;  2YMD A;  5J5F A;  4PIR A;  5SYO A;  4Z90 A;  5TVC A;  3U8M A;  3EI0 A;  4F8H A;  4ILC A;  5BP0 A;  4IL4 A;  4D01 A;  2BG9 E;  3RI5 A;  5CFB A;  2C9T A;  5HEJ A;  5HEO A;  4TWD A;  4HFE A;  3LSV A;  4FRR A;  4UM3 S;  3WTJ A;  2BR8 A;  3UQ7 A;  4QAC A;  5LG3 A;  3JAD A;  4IRE A;  3PEO A;  5AFL A;  3WTK A;  4ZR6 A;  5J5I A;  4IL9 A;  4ZZC A;  2XQ3 A;  2BYN A;  2XQ6 A;  3SH1 A;  3C84 A;  3RIF A;  3SQ6 A;  2XQ9 A;  2Y57 A;  3TLV A;  4DBM A;  4UXU A;  2BG9 A;  4X5T A;  3SQ9 A;  5LXB A;  2WNL A;  4BFQ A;  5L4H A;  5AFN A;  5BRX A;  3UQ4 A;  4QH5 A;  5L47 A;  4TWH A;  3U8J A;  3RQU A;  1UV6 A;  2WZY A;  2BYS A;  4BQT A;  3TLW A;  4QAB A;  4ZJT A;  3JAF A;  2QC1 B;  3EAM A;  4Z91 A;  3TLU A;  5J0Z A;  4LMK A;  5HEH A;  2BG9 C;  3WTH A;  2BYR A;  1I9B A;  3WIP A;  2Y54 A;  5BW2 A;  4ZZB A;  4QH1 A;  4ALX A;  3WTI A;  5FJV A;  5CO5 A;  4COF A;  5AFH A;  2YME A;  3ZDG A;  1UW6 A;  2BG9 B;  5J5G A;  4ZJS A;  2XQ8 A;  5AIN A;  3ZKR A;  2XNV A;  2BR7 A;  2W8F A;  2W8G A;  2ZJV A;  3P50 A;  4LML A;  5J5H A;  4NPP A;  2XYT A; 
#chains in the Genus database with same CATH homology
 5HCJ A;  3RHW A;  3PMZ A;  2BYQ A;  4QH4 A;  4UY2 A;  4A98 A;  4UM3 P;  3ZDH A;  2WNJ A;  4XK9 A;  3GUA A;  3TLT A;  5HCM A;  2ZJU A;  4ZRU A;  3RIA A;  4AFG A;  3UUB A;  2Y58 A;  4A97 A;  3WTO A;  4XHE A;  4TNV A;  3SIO A;  2XZ6 A;  2WNC A;  4B5D A;  5KE4 A;  5HEU A;  2XYS A;  2UZ6 A;  3UU4 A;  2X00 D;  2WN9 A;  2YKS A;  2X00 A;  2BYP A;  4NZB A;  3JAE A;  4HFB A;  5AFK A;  3TLS A;  2XQ5 A;  2Y7Y A;  5AFM A;  3WTL A;  2XQ7 A;  3UU3 A;  2XQ4 A;  4HFD A;  4QAA A;  3WTM A;  4HFI A;  4AFH A;  2YN6 A;  5KZU A;  4AFT A;  3T4M A;  2BJ0 A;  3UU5 A;  4UM1 A;  4ILA A;  5IUX A;  3C79 A;  2XNT A;  4ZK4 A;  4WV9 A;  1UX2 A;  3RQW A;  4LMJ A;  4TNW A;  4ILB A;  3EHZ A;  3UU8 A;  2PH9 A;  2XQA A;  4ZK1 A;  4UM3 A;  5L4E A;  4EZ1 A;  2XNU A;  3IGQ A;  5HEG A;  3P4W A;  5AFJ A;  3U8N A;  4HFC A;  3U8K A;  3UU6 A;  5AFM B;  2Y56 A;  2PGZ A;  3U8L A;  2VL0 A;  3WTN A;  4HQP A;  2YOE A;  4TWF A;  2XZ5 A;  4HFH A;  5JME A;  2YMD A;  5J5F A;  4PIR A;  5SYO A;  4Z90 A;  5TVC A;  3U8M A;  3EI0 A;  4F8H A;  4ILC A;  5BP0 A;  4IL4 A;  4D01 A;  2BG9 E;  3RI5 A;  5CFB A;  2C9T A;  5HEJ A;  5HEO A;  4TWD A;  4HFE A;  3LSV A;  4FRR A;  4UM3 S;  3WTJ A;  2BR8 A;  3UQ7 A;  4QAC A;  5LG3 A;  3JAD A;  4IRE A;  3PEO A;  5AFL A;  3WTK A;  4ZR6 A;  5J5I A;  4IL9 A;  4ZZC A;  2XQ3 A;  2BYN A;  2XQ6 A;  3SH1 A;  3C84 A;  3RIF A;  3SQ6 A;  2XQ9 A;  2Y57 A;  3TLV A;  4DBM A;  4UXU A;  2BG9 A;  4X5T A;  3SQ9 A;  5LXB A;  2WNL A;  4BFQ A;  5L4H A;  5AFN A;  5BRX A;  3UQ4 A;  4QH5 A;  5L47 A;  4TWH A;  3U8J A;  3RQU A;  1UV6 A;  2WZY A;  2BYS A;  4BQT A;  3TLW A;  4QAB A;  4ZJT A;  3JAF A;  2QC1 B;  3EAM A;  4Z91 A;  3TLU A;  5J0Z A;  4LMK A;  5HEH A;  2BG9 C;  3WTH A;  2BYR A;  1I9B A;  3WIP A;  2Y54 A;  5BW2 A;  4ZZB A;  4QH1 A;  4ALX A;  3WTI A;  5FJV A;  5CO5 A;  4COF A;  5AFH A;  2YME A;  3ZDG A;  1UW6 A;  2BG9 B;  5J5G A;  4ZJS A;  2XQ8 A;  5AIN A;  3ZKR A;  2XNV A;  2BR7 A;  2W8F A;  2W8G A;  2ZJV A;  3P50 A;  4LML A;  5J5H A;  4NPP A;  2XYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...