2XZ5A

Mmts-modified y53c mutant of aplysia achbp in complex with acetylcholine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
207
structure length
206
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Crystal Structures of a Cysteine-Modified Mutant in Loop D of Acetylcholine Binding Protein
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 48
structure length 206
sequence length 207
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xz5A00
3WTNA 2BR8A 2W8FA 3UU8A 2WNJA 3EI0A 3SIOA 5HEOA 2BJ0A 2WZYA 3U8NA 5J5FA 4ZJSA 1UX2A 3RIAA 3WTKA 4ILAA 4ZRUA 5TVCA 4UM3P 4AFTA 5AFLA 5BW2A 2ZJUA 4QABA 2WN9A 5AFMA 3WTIA 4COFA 4A98A 4DBMA 3UQ4A 2X00D 4ZK1A 5HEUA 2BYPA 2WNLA 4XHEA 2XQAA 4XK9A 2BYSA 3U8JA 4LMKA 2XQ7A 3WIPA 4UM3S 4FRRA 4PIRA 5L47A 2VL0A 5SYOA 3U8LA 3JAEA 1UW6A 2PH9A 3UU4A 2YMDA 5BRXA 5J5IA 2XQ5A 4IL9A 2XQ3A 2XNVA 4HFBA 4TWDA 3RIFA 3P4WA 2Y56A 5HEHA 3PEOA 4NZBA 3RHWA 4QH1A 5HCMA 2YN6A 3GUAA 4LMJA 5LXBA 3C79A 1I9BA 4D01A 3U8KA 4HFDA 5JMEA 3JADA 4UXUA 4AFGA 4LMLA 3UUBA 2BYQA 2X00A 2C9TA 2XQ4A 2YKSA 4QH4A 2YOEA 4Z90A 2XNUA 5HEGA 4TNVA 4AFHA 5AFNA 2BG9B 4UM1A 4TWFA 2BG9E 3WTMA 4QACA 4TNWA 2UZ6A 4IL4A 5J5GA 2XZ5A 3ZDHA 2WNCA 3ZKRA 3UU3A 4ALXA 2Y57A 2XQ8A 2XYSA 3UU6A 3WTOA 4ZZBA 5L4HA 4Z91A 3SQ6A 4A97A 4X5TA 2XQ6A 2Y58A 4ZJTA 4UM3A 3WTLA 3WTHA 2BYRA 5BP0A 2BG9C 5IUXA 2XZ6A 2W8GA 3RQWA 4UY2A 3TLWA 4BQTA 5AFMB 3IGQA 2XNTA 4EZ1A 3RI5A 3JAFA 3P50A 3LSVA 5AFJA 4B5DA 4HQPA 3U8MA 4TWHA 5J0ZA 3RQUA 5L4EA 5J5HA 5HCJA 2Y54A 3C84A 3T4MA 3TLVA 2XQ9A 4ILCA 5AFKA 3SH1A 2BR7A 4ZZCA 2Y7YA 3EAMA 4QH5A 3UU5A 4QAAA 4HFHA 5CO5A 5HEJA 2XYTA 5AINA 4WV9A 5AFHA 4ZR6A 5LG3A 2BYNA 2YMEA 3TLUA 3TLTA 5CFBA 4BFQA 5KE4A 1UV6A 2QC1B 3PMZA 4HFEA 5KZUA 4NPPA 4HFIA 4ZK4A 3SQ9A 3WTJA 4IREA 3EHZA 2PGZA 4ILBA 3ZDGA 3UQ7A 5FJVA 4F8HA 2BG9A 4HFCA 3TLSA 2ZJVA
chains in the Genus database with same CATH superfamily
3WTNA 2BR8A 2W8FA 3UU8A 2WNJA 3EI0A 3SIOA 5HEOA 2BJ0A 2WZYA 3U8NA 5J5FA 4ZJSA 1UX2A 3RIAA 3WTKA 4ILAA 4ZRUA 5TVCA 4UM3P 4AFTA 5AFLA 5BW2A 2ZJUA 4QABA 2WN9A 5AFMA 3WTIA 4COFA 4A98A 4DBMA 3UQ4A 2X00D 4ZK1A 5HEUA 2BYPA 2WNLA 4XHEA 2XQAA 4XK9A 2BYSA 3U8JA 4LMKA 2XQ7A 3WIPA 4UM3S 4FRRA 4PIRA 5L47A 2VL0A 5SYOA 3U8LA 3JAEA 1UW6A 2PH9A 3UU4A 2YMDA 5BRXA 5J5IA 2XQ5A 4IL9A 2XQ3A 2XNVA 4HFBA 4TWDA 3RIFA 3P4WA 2Y56A 5HEHA 3PEOA 4NZBA 3RHWA 4QH1A 5HCMA 2YN6A 3GUAA 4LMJA 5LXBA 3C79A 1I9BA 4D01A 3U8KA 4HFDA 5JMEA 3JADA 4UXUA 4AFGA 4LMLA 3UUBA 2BYQA 2X00A 2C9TA 2XQ4A 2YKSA 4QH4A 2YOEA 4Z90A 2XNUA 5HEGA 4TNVA 4AFHA 5AFNA 2BG9B 4UM1A 4TWFA 2BG9E 3WTMA 4QACA 4TNWA 2UZ6A 4IL4A 5J5GA 2XZ5A 3ZDHA 2WNCA 3ZKRA 3UU3A 4ALXA 2Y57A 2XQ8A 2XYSA 3UU6A 3WTOA 4ZZBA 5L4HA 4Z91A 3SQ6A 4A97A 4X5TA 2XQ6A 2Y58A 4ZJTA 4UM3A 3WTLA 3WTHA 2BYRA 5BP0A 2BG9C 5IUXA 2XZ6A 2W8GA 3RQWA 4UY2A 3TLWA 4BQTA 5AFMB 3IGQA 2XNTA 4EZ1A 3RI5A 3JAFA 3P50A 3LSVA 5AFJA 4B5DA 4HQPA 3U8MA 4TWHA 5J0ZA 3RQUA 5L4EA 5J5HA 5HCJA 2Y54A 3C84A 3T4MA 3TLVA 2XQ9A 4ILCA 5AFKA 3SH1A 2BR7A 4ZZCA 2Y7YA 3EAMA 4QH5A 3UU5A 4QAAA 4HFHA 5CO5A 5HEJA 2XYTA 5AINA 4WV9A 5AFHA 4ZR6A 5LG3A 2BYNA 2YMEA 3TLUA 3TLTA 5CFBA 4BFQA 5KE4A 1UV6A 2QC1B 3PMZA 4HFEA 5KZUA 4NPPA 4HFIA 4ZK4A 3SQ9A 3WTJA 4IREA 3EHZA 2PGZA 4ILBA 3ZDGA 3UQ7A 5FJVA 4F8HA 2BG9A 4HFCA 3TLSA 2ZJVA
chains in the Genus database with same CATH topology
3WTNA 2BR8A 2W8FA 3UU8A 2WNJA 3EI0A 3SIOA 5HEOA 2BJ0A 2WZYA 3U8NA 5J5FA 4ZJSA 1UX2A 3RIAA 3WTKA 4ILAA 4ZRUA 5TVCA 4UM3P 4AFTA 5AFLA 5BW2A 2ZJUA 4QABA 2WN9A 5AFMA 3WTIA 4COFA 4A98A 4DBMA 3UQ4A 2X00D 4ZK1A 5HEUA 2BYPA 2WNLA 4XHEA 2XQAA 4XK9A 2BYSA 3U8JA 4LMKA 2XQ7A 3WIPA 4UM3S 4FRRA 4PIRA 5L47A 2VL0A 5SYOA 3U8LA 3JAEA 1UW6A 2PH9A 3UU4A 2YMDA 5BRXA 5J5IA 2XQ5A 4IL9A 2XQ3A 2XNVA 4HFBA 4TWDA 3RIFA 3P4WA 2Y56A 5HEHA 3PEOA 4NZBA 3RHWA 4QH1A 5HCMA 2YN6A 3GUAA 4LMJA 5LXBA 3C79A 1I9BA 4D01A 3U8KA 4HFDA 5JMEA 3JADA 4UXUA 4AFGA 4LMLA 3UUBA 2BYQA 2X00A 2C9TA 2XQ4A 2YKSA 4QH4A 2YOEA 4Z90A 2XNUA 5HEGA 4TNVA 4AFHA 5AFNA 2BG9B 4UM1A 4TWFA 2BG9E 3WTMA 4QACA 4TNWA 2UZ6A 4IL4A 5J5GA 2XZ5A 3ZDHA 2WNCA 3ZKRA 3UU3A 4ALXA 2Y57A 2XQ8A 2XYSA 3UU6A 3WTOA 4ZZBA 5L4HA 4Z91A 3SQ6A 4A97A 4X5TA 2XQ6A 2Y58A 4ZJTA 4UM3A 3WTLA 3WTHA 2BYRA 5BP0A 2BG9C 5IUXA 2XZ6A 2W8GA 3RQWA 4UY2A 3TLWA 4BQTA 5AFMB 3IGQA 2XNTA 4EZ1A 3RI5A 3JAFA 3P50A 3LSVA 5AFJA 4B5DA 4HQPA 3U8MA 4TWHA 5J0ZA 3RQUA 5L4EA 5J5HA 5HCJA 2Y54A 3C84A 3T4MA 3TLVA 2XQ9A 4ILCA 5AFKA 3SH1A 2BR7A 4ZZCA 2Y7YA 3EAMA 4QH5A 3UU5A 4QAAA 4HFHA 5CO5A 5HEJA 2XYTA 5AINA 4WV9A 5AFHA 4ZR6A 5LG3A 2BYNA 2YMEA 3TLUA 3TLTA 5CFBA 4BFQA 5KE4A 1UV6A 2QC1B 3PMZA 4HFEA 5KZUA 4NPPA 4HFIA 4ZK4A 3SQ9A 3WTJA 4IREA 3EHZA 2PGZA 4ILBA 3ZDGA 3UQ7A 5FJVA 4F8HA 2BG9A 4HFCA 3TLSA 2ZJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTN A;  2BR8 A;  2W8F A;  3UU8 A;  2WNJ A;  3EI0 A;  3SIO A;  5HEO A;  2BJ0 A;  2WZY A;  3U8N A;  5J5F A;  4ZJS A;  1UX2 A;  3RIA A;  3WTK A;  4ILA A;  4ZRU A;  5TVC A;  4UM3 P;  4AFT A;  5AFL A;  5BW2 A;  2ZJU A;  4QAB A;  2WN9 A;  5AFM A;  3WTI A;  4COF A;  4A98 A;  4DBM A;  3UQ4 A;  2X00 D;  4ZK1 A;  5HEU A;  2BYP A;  2WNL A;  4XHE A;  2XQA A;  4XK9 A;  2BYS A;  3U8J A;  4LMK A;  2XQ7 A;  3WIP A;  4UM3 S;  4FRR A;  4PIR A;  5L47 A;  2VL0 A;  5SYO A;  3U8L A;  3JAE A;  1UW6 A;  2PH9 A;  3UU4 A;  2YMD A;  5BRX A;  5J5I A;  2XQ5 A;  4IL9 A;  2XQ3 A;  2XNV A;  4HFB A;  4TWD A;  3RIF A;  3P4W A;  2Y56 A;  5HEH A;  3PEO A;  4NZB A;  3RHW A;  4QH1 A;  5HCM A;  2YN6 A;  3GUA A;  4LMJ A;  5LXB A;  3C79 A;  1I9B A;  4D01 A;  3U8K A;  4HFD A;  5JME A;  3JAD A;  4UXU A;  4AFG A;  4LML A;  3UUB A;  2BYQ A;  2X00 A;  2C9T A;  2XQ4 A;  2YKS A;  4QH4 A;  2YOE A;  4Z90 A;  2XNU A;  5HEG A;  4TNV A;  4AFH A;  5AFN A;  2BG9 B;  4UM1 A;  4TWF A;  2BG9 E;  3WTM A;  4QAC A;  4TNW A;  2UZ6 A;  4IL4 A;  5J5G A;  2XZ5 A;  3ZDH A;  2WNC A;  3ZKR A;  3UU3 A;  4ALX A;  2Y57 A;  2XQ8 A;  2XYS A;  3UU6 A;  3WTO A;  4ZZB A;  5L4H A;  4Z91 A;  3SQ6 A;  4A97 A;  4X5T A;  2XQ6 A;  2Y58 A;  4ZJT A;  4UM3 A;  3WTL A;  3WTH A;  2BYR A;  5BP0 A;  2BG9 C;  5IUX A;  2XZ6 A;  2W8G A;  3RQW A;  4UY2 A;  3TLW A;  4BQT A;  5AFM B;  3IGQ A;  2XNT A;  4EZ1 A;  3RI5 A;  3JAF A;  3P50 A;  3LSV A;  5AFJ A;  4B5D A;  4HQP A;  3U8M A;  4TWH A;  5J0Z A;  3RQU A;  5L4E A;  5J5H A;  5HCJ A;  2Y54 A;  3C84 A;  3T4M A;  3TLV A;  2XQ9 A;  4ILC A;  5AFK A;  3SH1 A;  2BR7 A;  4ZZC A;  2Y7Y A;  3EAM A;  4QH5 A;  3UU5 A;  4QAA A;  4HFH A;  5CO5 A;  5HEJ A;  2XYT A;  5AIN A;  4WV9 A;  5AFH A;  4ZR6 A;  5LG3 A;  2BYN A;  2YME A;  3TLU A;  3TLT A;  5CFB A;  4BFQ A;  5KE4 A;  1UV6 A;  2QC1 B;  3PMZ A;  4HFE A;  5KZU A;  4NPP A;  4HFI A;  4ZK4 A;  3SQ9 A;  3WTJ A;  4IRE A;  3EHZ A;  2PGZ A;  4ILB A;  3ZDG A;  3UQ7 A;  5FJV A;  4F8H A;  2BG9 A;  4HFC A;  3TLS A;  2ZJV A; 
#chains in the Genus database with same CATH topology
 3WTN A;  2BR8 A;  2W8F A;  3UU8 A;  2WNJ A;  3EI0 A;  3SIO A;  5HEO A;  2BJ0 A;  2WZY A;  3U8N A;  5J5F A;  4ZJS A;  1UX2 A;  3RIA A;  3WTK A;  4ILA A;  4ZRU A;  5TVC A;  4UM3 P;  4AFT A;  5AFL A;  5BW2 A;  2ZJU A;  4QAB A;  2WN9 A;  5AFM A;  3WTI A;  4COF A;  4A98 A;  4DBM A;  3UQ4 A;  2X00 D;  4ZK1 A;  5HEU A;  2BYP A;  2WNL A;  4XHE A;  2XQA A;  4XK9 A;  2BYS A;  3U8J A;  4LMK A;  2XQ7 A;  3WIP A;  4UM3 S;  4FRR A;  4PIR A;  5L47 A;  2VL0 A;  5SYO A;  3U8L A;  3JAE A;  1UW6 A;  2PH9 A;  3UU4 A;  2YMD A;  5BRX A;  5J5I A;  2XQ5 A;  4IL9 A;  2XQ3 A;  2XNV A;  4HFB A;  4TWD A;  3RIF A;  3P4W A;  2Y56 A;  5HEH A;  3PEO A;  4NZB A;  3RHW A;  4QH1 A;  5HCM A;  2YN6 A;  3GUA A;  4LMJ A;  5LXB A;  3C79 A;  1I9B A;  4D01 A;  3U8K A;  4HFD A;  5JME A;  3JAD A;  4UXU A;  4AFG A;  4LML A;  3UUB A;  2BYQ A;  2X00 A;  2C9T A;  2XQ4 A;  2YKS A;  4QH4 A;  2YOE A;  4Z90 A;  2XNU A;  5HEG A;  4TNV A;  4AFH A;  5AFN A;  2BG9 B;  4UM1 A;  4TWF A;  2BG9 E;  3WTM A;  4QAC A;  4TNW A;  2UZ6 A;  4IL4 A;  5J5G A;  2XZ5 A;  3ZDH A;  2WNC A;  3ZKR A;  3UU3 A;  4ALX A;  2Y57 A;  2XQ8 A;  2XYS A;  3UU6 A;  3WTO A;  4ZZB A;  5L4H A;  4Z91 A;  3SQ6 A;  4A97 A;  4X5T A;  2XQ6 A;  2Y58 A;  4ZJT A;  4UM3 A;  3WTL A;  3WTH A;  2BYR A;  5BP0 A;  2BG9 C;  5IUX A;  2XZ6 A;  2W8G A;  3RQW A;  4UY2 A;  3TLW A;  4BQT A;  5AFM B;  3IGQ A;  2XNT A;  4EZ1 A;  3RI5 A;  3JAF A;  3P50 A;  3LSV A;  5AFJ A;  4B5D A;  4HQP A;  3U8M A;  4TWH A;  5J0Z A;  3RQU A;  5L4E A;  5J5H A;  5HCJ A;  2Y54 A;  3C84 A;  3T4M A;  3TLV A;  2XQ9 A;  4ILC A;  5AFK A;  3SH1 A;  2BR7 A;  4ZZC A;  2Y7Y A;  3EAM A;  4QH5 A;  3UU5 A;  4QAA A;  4HFH A;  5CO5 A;  5HEJ A;  2XYT A;  5AIN A;  4WV9 A;  5AFH A;  4ZR6 A;  5LG3 A;  2BYN A;  2YME A;  3TLU A;  3TLT A;  5CFB A;  4BFQ A;  5KE4 A;  1UV6 A;  2QC1 B;  3PMZ A;  4HFE A;  5KZU A;  4NPP A;  4HFI A;  4ZK4 A;  3SQ9 A;  3WTJ A;  4IRE A;  3EHZ A;  2PGZ A;  4ILB A;  3ZDG A;  3UQ7 A;  5FJV A;  4F8H A;  2BG9 A;  4HFC A;  3TLS A;  2ZJV A; 
#chains in the Genus database with same CATH homology
 3WTN A;  2BR8 A;  2W8F A;  3UU8 A;  2WNJ A;  3EI0 A;  3SIO A;  5HEO A;  2BJ0 A;  2WZY A;  3U8N A;  5J5F A;  4ZJS A;  1UX2 A;  3RIA A;  3WTK A;  4ILA A;  4ZRU A;  5TVC A;  4UM3 P;  4AFT A;  5AFL A;  5BW2 A;  2ZJU A;  4QAB A;  2WN9 A;  5AFM A;  3WTI A;  4COF A;  4A98 A;  4DBM A;  3UQ4 A;  2X00 D;  4ZK1 A;  5HEU A;  2BYP A;  2WNL A;  4XHE A;  2XQA A;  4XK9 A;  2BYS A;  3U8J A;  4LMK A;  2XQ7 A;  3WIP A;  4UM3 S;  4FRR A;  4PIR A;  5L47 A;  2VL0 A;  5SYO A;  3U8L A;  3JAE A;  1UW6 A;  2PH9 A;  3UU4 A;  2YMD A;  5BRX A;  5J5I A;  2XQ5 A;  4IL9 A;  2XQ3 A;  2XNV A;  4HFB A;  4TWD A;  3RIF A;  3P4W A;  2Y56 A;  5HEH A;  3PEO A;  4NZB A;  3RHW A;  4QH1 A;  5HCM A;  2YN6 A;  3GUA A;  4LMJ A;  5LXB A;  3C79 A;  1I9B A;  4D01 A;  3U8K A;  4HFD A;  5JME A;  3JAD A;  4UXU A;  4AFG A;  4LML A;  3UUB A;  2BYQ A;  2X00 A;  2C9T A;  2XQ4 A;  2YKS A;  4QH4 A;  2YOE A;  4Z90 A;  2XNU A;  5HEG A;  4TNV A;  4AFH A;  5AFN A;  2BG9 B;  4UM1 A;  4TWF A;  2BG9 E;  3WTM A;  4QAC A;  4TNW A;  2UZ6 A;  4IL4 A;  5J5G A;  2XZ5 A;  3ZDH A;  2WNC A;  3ZKR A;  3UU3 A;  4ALX A;  2Y57 A;  2XQ8 A;  2XYS A;  3UU6 A;  3WTO A;  4ZZB A;  5L4H A;  4Z91 A;  3SQ6 A;  4A97 A;  4X5T A;  2XQ6 A;  2Y58 A;  4ZJT A;  4UM3 A;  3WTL A;  3WTH A;  2BYR A;  5BP0 A;  2BG9 C;  5IUX A;  2XZ6 A;  2W8G A;  3RQW A;  4UY2 A;  3TLW A;  4BQT A;  5AFM B;  3IGQ A;  2XNT A;  4EZ1 A;  3RI5 A;  3JAF A;  3P50 A;  3LSV A;  5AFJ A;  4B5D A;  4HQP A;  3U8M A;  4TWH A;  5J0Z A;  3RQU A;  5L4E A;  5J5H A;  5HCJ A;  2Y54 A;  3C84 A;  3T4M A;  3TLV A;  2XQ9 A;  4ILC A;  5AFK A;  3SH1 A;  2BR7 A;  4ZZC A;  2Y7Y A;  3EAM A;  4QH5 A;  3UU5 A;  4QAA A;  4HFH A;  5CO5 A;  5HEJ A;  2XYT A;  5AIN A;  4WV9 A;  5AFH A;  4ZR6 A;  5LG3 A;  2BYN A;  2YME A;  3TLU A;  3TLT A;  5CFB A;  4BFQ A;  5KE4 A;  1UV6 A;  2QC1 B;  3PMZ A;  4HFE A;  5KZU A;  4NPP A;  4HFI A;  4ZK4 A;  3SQ9 A;  3WTJ A;  4IRE A;  3EHZ A;  2PGZ A;  4ILB A;  3ZDG A;  3UQ7 A;  5FJV A;  4F8H A;  2BG9 A;  4HFC A;  3TLS A;  2ZJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...