3TLSA

The glic pentameric ligand-gated ion channel e19'p mutant in a locally-closed conformation (lc2 subtype)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVPTNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 91
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlsA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlsA01
3SQ9A 2XQ3A 4UXUA 3TLUA 3U8LA 2XYTA 5HCJA 2UZ6A 2VL0A 5LG3A 3WTKA 4TNWA 5KE4A 1OEDC 1OEDA 4UM1A 2X00D 4BFQA 2BG9C 2BG9A 4PIRA 4DBMA 2MAWA 4NPPA 3UU8A 3UU6A 1UW6A 2YN6A 5CFBA 3WTLA 3IGQA 2Y56A 5AFMB 2Y58A 2YKSA 2BR7A 3SIOA 3ZDHA 4QACA 4AFGA 3LSVA 2ZJVA 4UM3P 4XHEA 5J5IA 2BYNA 3RQWA 3PMZA 2XQ5A 3UQ4A 3P50A 4X5TA 5HEGA 2XQ9A 3UU3A 2M6IA 4ILAA 3JAEA 5AFNA 5AINA 2XQ8A 5HEHA 4WV9A 2BYQA 3WTNA 3WTJA 2BR8A 4IL4A 3TLWA 4Z90A 3RQUA 3EHZA 3WTHA 3P4WA 4TWDA 4A97A 2WZYA 4B5DA 5J5GA 1I9BA 3WTMA 4HFHA 3UU4A 2WNLA 4ZJSA 3ZDGA 2BG9B 4ZZBA 5AFKA 4LMLA 3U8NA 4IL9A 5TVCA 3TLTA 2Y57A 4EZ1A 2W8GA 2Y54A 2M6BA 3C79A 4QAAA 3SQ6A 4HFBA 5IUXA 5L4EA 5KZUA 4NZBA 5L47A 2XNUA 5BP0A 4HFEA 3RIFA 5CO5A 3PEOA 4LMKA 4IREA 4ALXA 3U8JA 3JAFA 3U8MA 2XYSA 4F8HA 4AFTA 3RIAA 2ZJUA 2XQ6A 4XK9A 2KSRA 4HFCA 5J5FA 4ILCA 5BW2A 2PGZA 5AFMA 4HQPA 3EAMA 4D01A 4LMJA 2BG9E 4HFDA 5AFJA 4ZK4A 2WN9A 2YMEA 5JMEA 2X00A 2YMDA 3JADA 2C9TA 1OEDB 3RI5A 2XZ5A 5AFHA 2XQ4A 4HFIA 3EI0A 4ZJTA 2QC1B 4TNVA 3TLSA 5HEJA 4AFHA 5SYOA 3SH1A 5HCMA 2LKHA 2XQAA 5J5HA 2LKGA 4Z91A 1UV6A 2XNVA 4TWHA 2LM2A 4BQTA 3U8KA 2XNTA 3RHWA 2LLYA 2BYSA 5L4HA 5HEOA 2BYRA 3WTOA 3WTIA 3ZKRA 2YOEA 4COFA 5J0ZA 3C84A 5BRXA 4TWFA 5AFLA 1UX2A 2XQ7A 4FRRA 1OEDE 2PH9A 3TLVA 5FJVA 3UUBA 5LXBA 4UY2A 4QH4A 3UU5A 2BJ0A 4QABA 2WNJA 5HEUA 4A98A 2WNCA 4ZK1A 4UM3A 4ZR6A 4UM3S 2Y7YA 4ILBA 4ZRUA 3GUAA 3T4MA 3WIPA 2BYPA 4QH1A 4QH5A 2W8FA 4ZZCA 2XZ6A 3UQ7A
chains in the Genus database with same CATH superfamily
3ZMTB 2X9XA 3HR0A 3CKDA 3ONJA 3T1YT 2BVMA 4G2AA 4LFAT 3IGQA 2X0HA 2Y58A 3ZJ2A 3AE4A 2MYSA 1S94A 3QNUA 3ZEFB 2C5KT 5JTGA 3U3IA 4C91A 3N9NA 4ZEYA 3K3QC 1I9BA 4ADZA 5L3DB 4IDQA 4NUUA 1N36T 5E0OA 2UXBT 2VB6A 2V6YB 3C4ZA 4UXNB 4DUYT 1KNRA 1U4QA 3LJCA 4CN4A 4PK6A 2NTYA 1I6ZA 2BKNA 5FVKA 3P4SA 3LG7A 2V7LA 2YMEA 5JR9B 2HPLA 1JNRA 3DP7A 3SH1A 3K1SA 3VRBA 4TWHA 4PNIA 2H7OA 2KMFA 5AFLA 4PK4A 4PJNA 5LNKA 2RPAA 5AQPB 2N1GA 4IE5A 1SUMB 3UU5A 3EUHA 3AAEB 1KK7A 2BS3A 3WIPA 2E8IA 4L0RA 3FBLA 2H3RA 4X62T 4YSYA 2X00D 1Y01A 2BG9C 2DI4A 3NWIA 2WMOA 4I55E 4U7YA 4QACA 5AQUB 2RP4A 3PMZA 5HXSA 2HHHT 3OTOT 1WCRA 2XPKA 2IC9A 4PJLA 2XQ8A 2X68A 1QSDA 2JQKA 1EZ3A 3WTNA 2LHNA 2XAJB 3L3PA 5KMGP 4E7SA 1R8IA 2UUAT 4ZS3A 4KX6A 3ZLIA 2LSJA 2WBLA 2K9AA 3ZPOA 2XYSA 4YXDA 5LP6E 3PU3A 2CCQA 4AKRB 3SRZA 3C4WA 1WRDA 1MNDA 1J5WA 4HN9A 2PTFA 4JEUB 3RYFE 3VR9A 2LLYA 3RC3A 2CBJA 2D0UA 2WQYA 3RX6A 5L3FB 1XMQT 5BRXA 4O2AE 3AE7A 2E9XC 3UUMA 5J1GA 2UUBT 2IHR1 3RLFF 1B7TA 3PUXF 4NUVA 4HWCA 4P0BA 3TKLB 3GN5B 2Q9QA 3JC6C 4EOZB 4QH1A 4DR6T 3CX6B 3PJAJ 4IIJE 3TLUA 3ETUA 5JDGA 3GA8A 4AKHA 4IE4A 2DHRA 3AE3A 2CHNA 3EVYA 4EV6A 1XMOT 4HWDA 3RYIE 2KLQA 1T72A 2WM9A 1UCUA 4JEHB 2L8KA 2WZIA 2WNLA 4YTPA 2DWGA 4OHFA 3PUYF 1E7PA 3ZT7A 3WAKA 1MMNA 2W00A 4L5GA 3J7Yq 2YINA 4AKGA 5AQSB 2CXDA 3L8RA 4AFTA 4F8HA 5LB7B 1US7B 1UX5A 4YJ2E 5H6RB 5BW2A 2LEHA 4D01A 3N9OA 2D0TA 3EI0A 3B13A 4WZXA 1UGOA 2LT3A 2EHOD 3RPUA 5ABHA 1UV6A 3I0OA 3QOFA 2XNTA 4COFA 4LF7T 2EHOB 2V6YA 3RKGA 5LG4A 2IAKA 2ZM8A 4UF0B 4DR3T 2LRLA 2PH9A 2WU2A 2RA1A 3I1AA 4HWIB 3RKOA 2J47A 1ZP0A 3GUAA 3LK42 4MLKA 3K3OA 4KI0F 2IUBA 3GMIA 3P7IA 2FJBA 4P09A 3ANWB 3JCFA 4GKJT 2X0YA 5FXZA 5AQOB 4GYSA 4TNWA 5GONE 3ZYMA 5EK4A 3NKZA 4UV9B 3AE5A 2J62A 4KBMB 2BYNA 3RIUC 4X5TA 4N78D 2G0UA 4DV6T 5KX5E 3OJAA 4YT0A 3Q9DA 2CLYB 4DV3T 2KNDA 5FY1A 3WTHA 2D5UA 3KINB 4IE7A 4P1NA 2BG9B 1KNZA 5F3JA 3IBPA 4H63V 5IUXA 2VK9A 3QB5K 4DR4T 1IBMT 2JMKA 2BKPA 3EDVA 2FBWA 2K48A 4JI7T 3RGLA 1HX1B 4EYYR 2FJDA 2IC6A 4HFDA 4LFBT 1HFAA 2X00A 3AE8A 3W15B 2LJLA 3OVUA 4I50E 4JI0T 2YDRA 3UFGA 2V7KA 5J2UE 2MTQA 4A56A 3UULA 3A8YC 5HEUA 4DV7T 4UM3S 2WY2A 4TV9E 2KZ7B 4ZRUA 4B3TT 3AE1A 2Y48B 4UVCB 5HWYA 4LF8T 2E9XD 3P8CD 3RRWA 2XJ7A 3IA3A 5KE4A 1OEDC 4DBMA 1V9DA 3G06A 3UU6A 5F5WA 2XHEB 3JC6D 3ZDHA 4AFGA 1YQ4A 3IEEA 2IMLA 2J1DG 4JI2T 2V7MA 1W0BA 4LF4T 4IDPA 3CWZB 2JIWA 2NW9A 4WW0A 4UR9A 3AEDA 3EHZA 3PTRB 3PV0F 2XAQB 1YW0A 3GN5A 3P4PA 5TVCA 2JJ9A 3SQ6A 2XUEA 4B3MT 4ASKA 5CO5A 5L3EB 1HTJF 3PUAA 2CHOA 4YJ3E 1MIYA 3AA1B 5C2TA 2OV9A 2QVAA 4EGWA 2P9BA 5ABGA 4ZI3C 1N34T 1NENA 1HS7A 3TLSA 2VQFT 2NW8A 3F31A 4JBWF 1YQ3A 2XQAA 5HWXA 3AE9A 2CEAA 4U31A 3U8KA 3RHWA 3NRXA 5AQMB 3WTOA 3WTIA 4JI3T 4TWFA 4B3RT 3NRYA 3CK6A 2DL1A 4FRRA 4IDNA 3LK2B 2KINB 3D0TA 3TLVA 4JLEA 2ZM2A 2R6GF 3FXDB 4EB6E 4DV1T 2ODVA 2V7JA 4LF6T 3HKBE 3CIRA 4ILUA 2A72A 1WYBA 2VQET 2MOZA 4CXYA 3AEGA 4AISA 5LHHB 4AQFC 1IJ5A 4CZZB 3AAIA 4I4TE 5HXEA 3AEBA 3FXEB 2BR7A 2WS3A 4U74A 2EHOA 2M6IA 1SA0E 4UF0A 2A3DA 4YY3T 2V6XA 5LGUB 3PUGA 2BDEA 2W8GA 4UEMA 2H7VC 4HFBA 3ANWA 5L4EA 4DV5T 5ETWA 3GWHA 2VKDA 4IREA 4ALXA 2WP9A 4O4LE 4OYJA 3HKEE 1ZEEA 3FZLB 3IHRA 2BG9E 4ZK4A 3MACA 3PURA 3FZMB 2XQ4A 3CMLA 4YHHT 1SHZC 5SYOA 3Q5WA 4ZHQE 2XASB 1MMGA 2BBJA 2X9WA 2BYRA 1Z8UA 4QXBB 2Z6EA 1XNQT 3U78A 3VRAA 5L3CB 2VWAA 4PJJA 3N2OA 3UUBA 3M3ZB 4O2BE 2WNCA 5LA6E 1D1AA 4QWNB 2YDQA 5LXTE 2LSGA 4QX8B 4KUMB 2VL0A 4UV8B 4PIRA 2VKHA 3E08A 2WWVA 2NWBA 1NEKA 1D1BA 2V5DA 3ETVA 3AB3B 4AI6A 1UX4A 2XQ9A 5IHYA 4GYRA 2M67A 2A9UA 2VKJA 4DVDA 2GK9A 2F4VT 3HI2A 5AQNB 3TLWA 4Z90A 3PUVF 4CXWA 2BS2A 3QB5A 4HFHA 5JVDE 3UU4A 4EZ4A 3PUQA 3HKCE 1D0YA 4GOUA 2IW5B 3VKHA 3UTKA 4A5XA 3ZT5A 1QLBA 1BR1A 1WFDA 2LOPA 5J2TE 1E2AA 4LFCT 3H3AA 2V1DB 4HFIA 2Y8DA 3AAAB 2CXLA 4MBQA 2B76A 5JDMA 1CUNA 2XZEA 4U33A 1VOMA 4NIQA 3FB2A 4YTNA 2E5LT 3PE0A 3ZKRA 1Z0PA 1T7SA 3K8PC 1M62A 4EIWA 4ZI3D 2XAFB 3Q5EA 3H37A 2I59A 5LXBA 4UELA 2V5CA 3VKGA 1KFYA 4O8SA 3CQCB 3CQGB 2K3WA 4QXHB 2DNXA 5FL0A 5JDFA 1FJGT 4EEBA 3WI3A 2Y56A 2YKSA 4PFPA 2LSIA 5FXXA 5HEGA 4YHJA 3HA4A 3JAEA 4ILAA 3ZN0B 2BR8A 4U2ZA 2LRKA 3OYXA 1LVFA 3S4UA 2XM1A 1ZHCA 3O1IA 3AEAA 2NR4A 4NXMT 2ZJUA 2HN2A 2UUCT 2WZHA 2X67A 3NBXX 4LMJA 5KXJA 2C9TA 5LHIB 3QUJA 5J5HA 4PJMA 1IJ6A 2CWOA 4JI6T 2FUPA 3X1DA 1UUSA 3MXZA 2K24A 3FZKB 2BJ0A 5JRCB 4H9OC 2Q9QC 5LMUT 4QH5A 4ZZCA 3P4RA 4JV5T 2UXCT 5AQVB 5IWAT 2XYTA 5FY0A 3WTKA 1ZOYA 1J1JA 5A1LA 3ZC0A 4E7ZA 3VHLA 2YK0A 4Q25A 5FY7A 1IZNB 5CA1E 2UXDT 5LBMA 4HKAA 4UM3P 4YSZA 1YXRA 2ZM0A 4PW8A 1ZV4X 5AFNA 1VCSA 3ZCIA 3LFMA 3KV6A 2WZYA 3BQKA 5JR9A 4H9RC 3N9MA 4U3CA 2JQHA 3B5MA 2WDQA 1UK5A 5L47A 2XY8B 1HX8A 4YLHA 2JQQA 4HE8A 3AA0B 4I43B 4XK9A 2HN1A 4HFCA 3PU8A 3MZKB 5AFJA 3RI5A 2XZ5A 4DIDB 2CM0A 1LRZA 3OPCA 5HEJA 4LF9T 1XDOA 2V26A 2HH7A 3R84B 5JDNA 2PG8A 5LJMA 4DMWA 3ZMSB 2D9DA 2LM2A 4ERRA 3CPZA 2XTLA 4IDZA 2YOEA 2BVLA 2IIUA 4MHCA 1I94T 4HTEA 2ZM6T 4WNKA 5FXWA 2WDVA 4QABA 2W66A 2HPJA 3N9PA 3AXJB 4Z8XA 5HYAA 2B1EA 4DUZT 1MMDA 3R6NA 3VU7H 2XQ3A 4K0KT 4UM1A 1MNEA 4EAHA 5FVLA 2E2AA 3F57A 4X20E 2H89A 2LSYA 1NWMX 2CMRA 3FZHB 4B3ST 3RQWA 3ZYKA 2XQ5A 3LK3B 2N2NA 2JRKA 5JDLA 1BR2A 1OXZA 5LHGB 5C3JA 5IYZE 4B6XA 4WV9A 2BYQA 2ES0A 4IL4A 3RQUA 4B5DA 4A97A 1O3XA 4H63H 3RRCA 2VVSA 3AA7B 5FMNA 5ABEA 1XDPA 2E9XB 5AQTB 2DLRA 3C98B 2XNUA 2QGSA 3PEOA 3L39A 3U8JA 2LHRA 4AXPA 2I6HA 3EDUA 5J5FA 3T1HT 5FNVE 4ANJA 2KWHA 1E1HB 5H6QB 5CGMA 2WDRA 1HG5A 3LDQB 4QKNA 2LKHA 2FJEA 1D0ZA 4UVAB 3ZT6A 5JDQA 2KWIB 1J5ET 5J0ZA 3RH3A 4CI3B 1WYCA 3BK9A 1FIOA 2ACZA 1X79A 3ZC1A 4H9PC 2WCAA 3KV5A 2Y6XA 1FMWA 4PFOA 4AIUA 3PUWF 5HXCA 5L2LA 5HCJA 5LGNB 1NAFA 1ZKEA 1DU2A 2QA7A 3SFEA 4DV0T 2Q9QD 2XAGB 5BMVE 2X9HA 5AQJB 4O4IE 3T8OA 2CE7A 2Q9QB 5M4YA 3WTJA 4TWDA 3A5XA 5ADXL 2H88A 1G8XA 2PBIA 1FMVA 3AE6A 3AE2A 3C4XA 2ZLYA 3TLTA 2Y57A 5DJQC 3C79A 4EZ1A 4ISSA 1W0AA 2QRXA 4HFEA 2OA5A 2UXXB 1WR0A 2MBGA 3HKDE 4ILCA 2XAHB 2NP9A 4ZI7E 3KVAA 4G63A 4IDOA 5CA0E 2WU5A 2YMDA 4HFVA 4GK5E 3I9YA 3Q5DA 2AE9A 2LKGA 5LMNT 1LKXA 1CHUA 4DR1T 1MIVA 5L4HA 2VURA 3C84A 4HWFA 4DV4T 1D0XA 5FKYA 4U2YA 3KVBA 4QHOA 4H9NC 4V1Av 4DR2T 2FJAA 4X1IE 3UQ7A 3Q5XA 3ZMUB 5F8PA 3SQ9A 3DTOA 2W62A 2CBIA 3PJAA 2YU1A 2IDOB 3CVRA 5AQRB 2BG9A 4NPPA 2W67A 3WTLA 4X64T 3N5LA 3SIOA 1FEWA 3N2GE 3O4XE 2A2FX 5AQGB 4IHJE 5CJ5A 3UU3A 2EHOC 3I9WA 2YU2A 3HL6A 2K5BB 4OX9T 1D1CA 2KXPB 5J5GA 4AQGA 2CWYA 5AQFB 3AXJA 2LE8A 5FXVA 4CQIA 4JI4T 3U8NA 4IGUA 3SWHA 2Y54A 1U5PA 4J2CA 4CN1A 2C5IT 4LF5T 4DV2T 3RC8A 1G73A 2XM2A 3ZSTA 2WN9A 4DBQA 3JADA 1OEDB 5BR8T 2KT9A 3VR8A 4KMCA 4DO0A 2QC1B 3FBZA 2CLYC 2VASA 4JI8T 2X9YA 4KHZF 4U7IA 4CXXA 4BQTA 2BYSA 3EABA 3WAJA 2E9XA 4UIGA 4ZXLA 3ZJ1A 5FJVA 4F6RC 3OBVE 2C0SA 2WNJA 3RYCE 4DBRA 5AQIB 3KBTA 4P0AA 3T4MA 2BYPA 2W8FA 5JREA 2XQYA 2W4XA 4UXUA 4O4JE 1VCTA 5LG3A 1KF6A 4WBNE 3KBUA 2YN6A 5CFBA 5AQLB 5LGTB 2X0LB 3ONLC 3NVOA 2WMNA 3N9LA 2ZJVA 4EZHA 4X1YE 4YSXA 5L3BB 5AQHB 3P50A 3UT5E 5LJNA 2WAUA 1W09A 2J4GA 2UXNB 3J9X1 3ABVA 5KDMC 1WR6A 3Q2MA 1MIWA 4BA9A 4AKLA 2LM9A 1HCIA 2NW7A 5KZUA 4PK5A 3PUSA 4JYAT 1HG2A 4LMKA 4EEDA 4TV8E 3LBXB 2YDSA 3O9XA 1HNZT 3MKDA 1IBLT 4M1PA 1IAPA 5JMEA 4KHPT 3ZYLA 4TNVA 5HCMA 4Z91A 1IBKT 4U72A 1HR0T 1BR4A 3QC9A 5HEOA 3V5SA 1UX2A 2XQ7A 3FZFB 5EK3A 3UUXB 2X51A 4A98A 3KDSE 2E5VA 3ONXA 1T8BA 2ODUA 1AJ3A 2ACXA 3C50A 3SFDA 3AVSA 3UU8A 4PAGA 5ABFB 4NXNT 3DJBA 5AFMB 3OYZA 5LBQB 3AECA 2ZMAA 5J5IA 3RIUA 3UQ4A 3ZN1B 4XZCA 5FP3A 3F2EA 4MALA 4DMVA 4DNDA 4OK0A 4BJNA 2I0MA 4TUYE 3ZDGA 4ZJSA 1BR0A 5AFKA 4BJMA 3N2KE 3E0ZA 2W2UA 2N9DA 4QAAA 4TN7B 5JH7E 4JI1T 1XWMA 3L09A 4WBOA 3RIFA 2W63A 1OWAA 4JUYA 1GQEA 3C51A 3JAFA 3U8MA 3M65A 3KFWX 3KV4A 3N9QA 4XBFB 4GIWA 1MMAA 4HQPA 3EAMA 5LYJE 4ZI2C 4XAXB 4WYVA 4CI1B 1HNWT 2WB5A 4AKIA 4AFHA 2YEVC 2X66A 1YD8G 2W61A 4UVBB 1H7CA 1VRBA 4X66T 2WSSV 3CQXC 3RYHE 3CX8B 1N32T 5DQWA 5FL1A 2CRBA 1HNXT 1OEDE 4X65T 5HXRA 4TX5A 1S35A 2V7IA 4FI5A 2SPCA 3NZQA 4ZR6A 4CI2B 2W0GA 3A7MA 3O1JA 4ILBA 5EZYE 3NZPA 3SS1A 3H3MA 3ZMZB 3K3NA 4QXCB 1OEDA 2L3LA 4EXTA 5CB4E 4BFQA 2PJQA 2MAWA 4IE6A 3AVRA 4O4HE 2JPFA 4MFRA 1YKHB 4YTMA 2LSKA 4DR7T 3P4QA 2L9QA 2BKOA 3ZMVB 2BZBA 4HWHA 2VKOA 5LOVE 5HEHA 4YFSA 1KEYA 2NTXA 4ISTA 5JR9C 3KV9A 3WTMA 4AQYT 5AQQB 4ZZBA 2UU9T 4LMLA 1M7KA 2VL8A 3ZSSA 1JNZA 3I0QA 4NZBA 5BP0A 1XNRT 3RIAA 2PFVA 2KSRA 3CX7B 4HEAA 5EK2A 1X9BA 3ESLA 5LCYA 5AFHA 3SOLA 3AEEA 3MA9A 5L3GB 2WWUA 3BQLA 3AEFA 2XNVA 5DABA 2JMHA 1KNPA 2BS4A 2LOSA 3FHNA 4IE0A 5TAOA 1SE7A 1XZYA 4UY2A 4QH4A 4ZK1A 4I0UA 4X1KE 3LBXA 4ZOLE 5JQGE 2XZ6A 1WLXA 1Y64B 1L0VA 4GK0E 3V5UA 3U8LA 2UZ6A 3UUNA 4AQFA 5C8YE 4DR5T 2BBHA 3E22E 4C90A 1UW6A 5HAXA 3BQIA 3LSVA 4XHEA 3B57A 2MPKA 1T98A 5AQKB 4QX7B 5AINA 2CXFA 3OKQA 1W9RA 2XSAA 3P4WA 3ZCJA 5DQVA 3MJXA 4FJOA 2D2SA 5JDHA 5HXHA 3PDYA 2CPTA 4IL9A 4OFZA 2M6BA 2NOXA 4OYKA 4H9QC 4L9IA 2QYWA 5FYMA 4KP3C 5ABFA 2XSBA 2XQ6A 2C5JA 2CA5A 4ZS2A 2PGZA 5AFMA 4TZ4C 3IF8B 1QUUA 4HGAA 4GKKT 2AXDS 1N33T 5JRCA 4ZJTA 3QK6A 3C64A 2DCFA 2V8SV 1LVKA 4EYUA 1YKEB 4ZI2D 3UFEA 2DWKA 3PUZF 4JI5T 3RF1A 4CN6A 2JQ9A 4K0UA 4BAYB 4IT4A 2VVNA 5AFUL 1HF8A 1UURA 3AA6B 4UM3A 4H9SE 2Y7YA 3MK7C 3O1HA 2OLTA
chains in the Genus database with same CATH topology
3SQ9A 2XQ3A 4UXUA 3TLUA 3U8LA 2XYTA 5HCJA 2UZ6A 2VL0A 5LG3A 3WTKA 4TNWA 5KE4A 1OEDC 1OEDA 4UM1A 2X00D 4BFQA 2BG9C 2BG9A 4PIRA 4DBMA 2MAWA 4NPPA 3UU8A 3UU6A 1UW6A 2YN6A 5CFBA 3WTLA 3IGQA 2Y56A 5AFMB 2Y58A 2YKSA 2BR7A 3SIOA 3ZDHA 4QACA 4AFGA 3LSVA 2ZJVA 4UM3P 4XHEA 5J5IA 2BYNA 3RQWA 3PMZA 2XQ5A 3UQ4A 3P50A 4X5TA 5HEGA 2XQ9A 3UU3A 2M6IA 4ILAA 3JAEA 5AFNA 5AINA 2XQ8A 5HEHA 4WV9A 2BYQA 3WTNA 3WTJA 2BR8A 4IL4A 3TLWA 4Z90A 3RQUA 3EHZA 3WTHA 3P4WA 4TWDA 4A97A 2WZYA 4B5DA 5J5GA 1I9BA 3WTMA 4HFHA 3UU4A 2WNLA 4ZJSA 3ZDGA 2BG9B 4ZZBA 5AFKA 4LMLA 3U8NA 4IL9A 5TVCA 3TLTA 2Y57A 4EZ1A 2W8GA 2Y54A 2M6BA 3C79A 4QAAA 3SQ6A 4HFBA 5IUXA 5L4EA 5KZUA 4NZBA 5L47A 2XNUA 5BP0A 4HFEA 3RIFA 5CO5A 3PEOA 4LMKA 4IREA 4ALXA 3U8JA 3JAFA 3U8MA 2XYSA 4F8HA 4AFTA 3RIAA 2ZJUA 2XQ6A 4XK9A 2KSRA 4HFCA 5J5FA 4ILCA 5BW2A 2PGZA 5AFMA 4HQPA 3EAMA 4D01A 4LMJA 2BG9E 4HFDA 5AFJA 4ZK4A 2WN9A 2YMEA 5JMEA 2X00A 2YMDA 3JADA 2C9TA 1OEDB 3RI5A 2XZ5A 5AFHA 2XQ4A 4HFIA 3EI0A 4ZJTA 2QC1B 4TNVA 3TLSA 5HEJA 4AFHA 5SYOA 3SH1A 5HCMA 2LKHA 2XQAA 5J5HA 2LKGA 4Z91A 1UV6A 2XNVA 4TWHA 2LM2A 4BQTA 3U8KA 2XNTA 3RHWA 2LLYA 2BYSA 5L4HA 5HEOA 2BYRA 3WTOA 3WTIA 3ZKRA 2YOEA 4COFA 5J0ZA 3C84A 5BRXA 4TWFA 5AFLA 1UX2A 2XQ7A 4FRRA 1OEDE 2PH9A 3TLVA 5FJVA 3UUBA 5LXBA 4UY2A 4QH4A 3UU5A 2BJ0A 4QABA 2WNJA 5HEUA 4A98A 2WNCA 4ZK1A 4UM3A 4ZR6A 4UM3S 2Y7YA 4ILBA 4ZRUA 3GUAA 3T4MA 3WIPA 2BYPA 4QH1A 4QH5A 2W8FA 4ZZCA 2XZ6A 3UQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQ9 A;  2XQ3 A;  4UXU A;  3TLU A;  3U8L A;  2XYT A;  5HCJ A;  2UZ6 A;  2VL0 A;  5LG3 A;  3WTK A;  4TNW A;  5KE4 A;  1OED C;  1OED A;  4UM1 A;  2X00 D;  4BFQ A;  2BG9 C;  2BG9 A;  4PIR A;  4DBM A;  2MAW A;  4NPP A;  3UU8 A;  3UU6 A;  1UW6 A;  2YN6 A;  5CFB A;  3WTL A;  3IGQ A;  2Y56 A;  5AFM B;  2Y58 A;  2YKS A;  2BR7 A;  3SIO A;  3ZDH A;  4QAC A;  4AFG A;  3LSV A;  2ZJV A;  4UM3 P;  4XHE A;  5J5I A;  2BYN A;  3RQW A;  3PMZ A;  2XQ5 A;  3UQ4 A;  3P50 A;  4X5T A;  5HEG A;  2XQ9 A;  3UU3 A;  2M6I A;  4ILA A;  3JAE A;  5AFN A;  5AIN A;  2XQ8 A;  5HEH A;  4WV9 A;  2BYQ A;  3WTN A;  3WTJ A;  2BR8 A;  4IL4 A;  3TLW A;  4Z90 A;  3RQU A;  3EHZ A;  3WTH A;  3P4W A;  4TWD A;  4A97 A;  2WZY A;  4B5D A;  5J5G A;  1I9B A;  3WTM A;  4HFH A;  3UU4 A;  2WNL A;  4ZJS A;  3ZDG A;  2BG9 B;  4ZZB A;  5AFK A;  4LML A;  3U8N A;  4IL9 A;  5TVC A;  3TLT A;  2Y57 A;  4EZ1 A;  2W8G A;  2Y54 A;  2M6B A;  3C79 A;  4QAA A;  3SQ6 A;  4HFB A;  5IUX A;  5L4E A;  5KZU A;  4NZB A;  5L47 A;  2XNU A;  5BP0 A;  4HFE A;  3RIF A;  5CO5 A;  3PEO A;  4LMK A;  4IRE A;  4ALX A;  3U8J A;  3JAF A;  3U8M A;  2XYS A;  4F8H A;  4AFT A;  3RIA A;  2ZJU A;  2XQ6 A;  4XK9 A;  2KSR A;  4HFC A;  5J5F A;  4ILC A;  5BW2 A;  2PGZ A;  5AFM A;  4HQP A;  3EAM A;  4D01 A;  4LMJ A;  2BG9 E;  4HFD A;  5AFJ A;  4ZK4 A;  2WN9 A;  2YME A;  5JME A;  2X00 A;  2YMD A;  3JAD A;  2C9T A;  1OED B;  3RI5 A;  2XZ5 A;  5AFH A;  2XQ4 A;  4HFI A;  3EI0 A;  4ZJT A;  2QC1 B;  4TNV A;  3TLS A;  5HEJ A;  4AFH A;  5SYO A;  3SH1 A;  5HCM A;  2LKH A;  2XQA A;  5J5H A;  2LKG A;  4Z91 A;  1UV6 A;  2XNV A;  4TWH A;  2LM2 A;  4BQT A;  3U8K A;  2XNT A;  3RHW A;  2LLY A;  2BYS A;  5L4H A;  5HEO A;  2BYR A;  3WTO A;  3WTI A;  3ZKR A;  2YOE A;  4COF A;  5J0Z A;  3C84 A;  5BRX A;  4TWF A;  5AFL A;  1UX2 A;  2XQ7 A;  4FRR A;  1OED E;  2PH9 A;  3TLV A;  5FJV A;  3UUB A;  5LXB A;  4UY2 A;  4QH4 A;  3UU5 A;  2BJ0 A;  4QAB A;  2WNJ A;  5HEU A;  4A98 A;  2WNC A;  4ZK1 A;  4UM3 A;  4ZR6 A;  4UM3 S;  2Y7Y A;  4ILB A;  4ZRU A;  3GUA A;  3T4M A;  3WIP A;  2BYP A;  4QH1 A;  4QH5 A;  2W8F A;  4ZZC A;  2XZ6 A;  3UQ7 A; 
#chains in the Genus database with same CATH topology
 3ZMT B;  2X9X A;  3HR0 A;  3CKD A;  3ONJ A;  3T1Y T;  2BVM A;  4G2A A;  4LFA T;  3IGQ A;  2X0H A;  2Y58 A;  3ZJ2 A;  3AE4 A;  2MYS A;  1S94 A;  3QNU A;  3ZEF B;  2C5K T;  5JTG A;  3U3I A;  4C91 A;  3N9N A;  4ZEY A;  3K3Q C;  1I9B A;  4ADZ A;  5L3D B;  4IDQ A;  4NUU A;  1N36 T;  5E0O A;  2UXB T;  2VB6 A;  2V6Y B;  3C4Z A;  4UXN B;  4DUY T;  1KNR A;  1U4Q A;  3LJC A;  4CN4 A;  4PK6 A;  2NTY A;  1I6Z A;  2BKN A;  5FVK A;  3P4S A;  3LG7 A;  2V7L A;  2YME A;  5JR9 B;  2HPL A;  1JNR A;  3DP7 A;  3SH1 A;  3K1S A;  3VRB A;  4TWH A;  4PNI A;  2H7O A;  2KMF A;  5AFL A;  4PK4 A;  4PJN A;  5LNK A;  2RPA A;  5AQP B;  2N1G A;  4IE5 A;  1SUM B;  3UU5 A;  3EUH A;  3AAE B;  1KK7 A;  2BS3 A;  3WIP A;  2E8I A;  4L0R A;  3FBL A;  2H3R A;  4X62 T;  4YSY A;  2X00 D;  1Y01 A;  2BG9 C;  2DI4 A;  3NWI A;  2WMO A;  4I55 E;  4U7Y A;  4QAC A;  5AQU B;  2RP4 A;  3PMZ A;  5HXS A;  2HHH T;  3OTO T;  1WCR A;  2XPK A;  2IC9 A;  4PJL A;  2XQ8 A;  2X68 A;  1QSD A;  2JQK A;  1EZ3 A;  3WTN A;  2LHN A;  2XAJ B;  3L3P A;  5KMG P;  4E7S A;  1R8I A;  2UUA T;  4ZS3 A;  4KX6 A;  3ZLI A;  2LSJ A;  2WBL A;  2K9A A;  3ZPO A;  2XYS A;  4YXD A;  5LP6 E;  3PU3 A;  2CCQ A;  4AKR B;  3SRZ A;  3C4W A;  1WRD A;  1MND A;  1J5W A;  4HN9 A;  2PTF A;  4JEU B;  3RYF E;  3VR9 A;  2LLY A;  3RC3 A;  2CBJ A;  2D0U A;  2WQY A;  3RX6 A;  5L3F B;  1XMQ T;  5BRX A;  4O2A E;  3AE7 A;  2E9X C;  3UUM A;  5J1G A;  2UUB T;  2IHR 1;  3RLF F;  1B7T A;  3PUX F;  4NUV A;  4HWC A;  4P0B A;  3TKL B;  3GN5 B;  2Q9Q A;  3JC6 C;  4EOZ B;  4QH1 A;  4DR6 T;  3CX6 B;  3PJA J;  4IIJ E;  3TLU A;  3ETU A;  5JDG A;  3GA8 A;  4AKH A;  4IE4 A;  2DHR A;  3AE3 A;  2CHN A;  3EVY A;  4EV6 A;  1XMO T;  4HWD A;  3RYI E;  2KLQ A;  1T72 A;  2WM9 A;  1UCU A;  4JEH B;  2L8K A;  2WZI A;  2WNL A;  4YTP A;  2DWG A;  4OHF A;  3PUY F;  1E7P A;  3ZT7 A;  3WAK A;  1MMN A;  2W00 A;  4L5G A;  3J7Y q;  2YIN A;  4AKG A;  5AQS B;  2CXD A;  3L8R A;  4AFT A;  4F8H A;  5LB7 B;  1US7 B;  1UX5 A;  4YJ2 E;  5H6R B;  5BW2 A;  2LEH A;  4D01 A;  3N9O A;  2D0T A;  3EI0 A;  3B13 A;  4WZX A;  1UGO A;  2LT3 A;  2EHO D;  3RPU A;  5ABH A;  1UV6 A;  3I0O A;  3QOF A;  2XNT A;  4COF A;  4LF7 T;  2EHO B;  2V6Y A;  3RKG A;  5LG4 A;  2IAK A;  2ZM8 A;  4UF0 B;  4DR3 T;  2LRL A;  2PH9 A;  2WU2 A;  2RA1 A;  3I1A A;  4HWI B;  3RKO A;  2J47 A;  1ZP0 A;  3GUA A;  3LK4 2;  4MLK A;  3K3O A;  4KI0 F;  2IUB A;  3GMI A;  3P7I A;  2FJB A;  4P09 A;  3ANW B;  3JCF A;  4GKJ T;  2X0Y A;  5FXZ A;  5AQO B;  4GYS A;  4TNW A;  5GON E;  3ZYM A;  5EK4 A;  3NKZ A;  4UV9 B;  3AE5 A;  2J62 A;  4KBM B;  2BYN A;  3RIU C;  4X5T A;  4N78 D;  2G0U A;  4DV6 T;  5KX5 E;  3OJA A;  4YT0 A;  3Q9D A;  2CLY B;  4DV3 T;  2KND A;  5FY1 A;  3WTH A;  2D5U A;  3KIN B;  4IE7 A;  4P1N A;  2BG9 B;  1KNZ A;  5F3J A;  3IBP A;  4H63 V;  5IUX A;  2VK9 A;  3QB5 K;  4DR4 T;  1IBM T;  2JMK A;  2BKP A;  3EDV A;  2FBW A;  2K48 A;  4JI7 T;  3RGL A;  1HX1 B;  4EYY R;  2FJD A;  2IC6 A;  4HFD A;  4LFB T;  1HFA A;  2X00 A;  3AE8 A;  3W15 B;  2LJL A;  3OVU A;  4I50 E;  4JI0 T;  2YDR A;  3UFG A;  2V7K A;  5J2U E;  2MTQ A;  4A56 A;  3UUL A;  3A8Y C;  5HEU A;  4DV7 T;  4UM3 S;  2WY2 A;  4TV9 E;  2KZ7 B;  4ZRU A;  4B3T T;  3AE1 A;  2Y48 B;  4UVC B;  5HWY A;  4LF8 T;  2E9X D;  3P8C D;  3RRW A;  2XJ7 A;  3IA3 A;  5KE4 A;  1OED C;  4DBM A;  1V9D A;  3G06 A;  3UU6 A;  5F5W A;  2XHE B;  3JC6 D;  3ZDH A;  4AFG A;  1YQ4 A;  3IEE A;  2IML A;  2J1D G;  4JI2 T;  2V7M A;  1W0B A;  4LF4 T;  4IDP A;  3CWZ B;  2JIW A;  2NW9 A;  4WW0 A;  4UR9 A;  3AED A;  3EHZ A;  3PTR B;  3PV0 F;  2XAQ B;  1YW0 A;  3GN5 A;  3P4P A;  5TVC A;  2JJ9 A;  3SQ6 A;  2XUE A;  4B3M T;  4ASK A;  5CO5 A;  5L3E B;  1HTJ F;  3PUA A;  2CHO A;  4YJ3 E;  1MIY A;  3AA1 B;  5C2T A;  2OV9 A;  2QVA A;  4EGW A;  2P9B A;  5ABG A;  4ZI3 C;  1N34 T;  1NEN A;  1HS7 A;  3TLS A;  2VQF T;  2NW8 A;  3F31 A;  4JBW F;  1YQ3 A;  2XQA A;  5HWX A;  3AE9 A;  2CEA A;  4U31 A;  3U8K A;  3RHW A;  3NRX A;  5AQM B;  3WTO A;  3WTI A;  4JI3 T;  4TWF A;  4B3R T;  3NRY A;  3CK6 A;  2DL1 A;  4FRR A;  4IDN A;  3LK2 B;  2KIN B;  3D0T A;  3TLV A;  4JLE A;  2ZM2 A;  2R6G F;  3FXD B;  4EB6 E;  4DV1 T;  2ODV A;  2V7J A;  4LF6 T;  3HKB E;  3CIR A;  4ILU A;  2A72 A;  1WYB A;  2VQE T;  2MOZ A;  4CXY A;  3AEG A;  4AIS A;  5LHH B;  4AQF C;  1IJ5 A;  4CZZ B;  3AAI A;  4I4T E;  5HXE A;  3AEB A;  3FXE B;  2BR7 A;  2WS3 A;  4U74 A;  2EHO A;  2M6I A;  1SA0 E;  4UF0 A;  2A3D A;  4YY3 T;  2V6X A;  5LGU B;  3PUG A;  2BDE A;  2W8G A;  4UEM A;  2H7V C;  4HFB A;  3ANW A;  5L4E A;  4DV5 T;  5ETW A;  3GWH A;  2VKD A;  4IRE A;  4ALX A;  2WP9 A;  4O4L E;  4OYJ A;  3HKE E;  1ZEE A;  3FZL B;  3IHR A;  2BG9 E;  4ZK4 A;  3MAC A;  3PUR A;  3FZM B;  2XQ4 A;  3CML A;  4YHH T;  1SHZ C;  5SYO A;  3Q5W A;  4ZHQ E;  2XAS B;  1MMG A;  2BBJ A;  2X9W A;  2BYR A;  1Z8U A;  4QXB B;  2Z6E A;  1XNQ T;  3U78 A;  3VRA A;  5L3C B;  2VWA A;  4PJJ A;  3N2O A;  3UUB A;  3M3Z B;  4O2B E;  2WNC A;  5LA6 E;  1D1A A;  4QWN B;  2YDQ A;  5LXT E;  2LSG A;  4QX8 B;  4KUM B;  2VL0 A;  4UV8 B;  4PIR A;  2VKH A;  3E08 A;  2WWV A;  2NWB A;  1NEK A;  1D1B A;  2V5D A;  3ETV A;  3AB3 B;  4AI6 A;  1UX4 A;  2XQ9 A;  5IHY A;  4GYR A;  2M67 A;  2A9U A;  2VKJ A;  4DVD A;  2GK9 A;  2F4V T;  3HI2 A;  5AQN B;  3TLW A;  4Z90 A;  3PUV F;  4CXW A;  2BS2 A;  3QB5 A;  4HFH A;  5JVD E;  3UU4 A;  4EZ4 A;  3PUQ A;  3HKC E;  1D0Y A;  4GOU A;  2IW5 B;  3VKH A;  3UTK A;  4A5X A;  3ZT5 A;  1QLB A;  1BR1 A;  1WFD A;  2LOP A;  5J2T E;  1E2A A;  4LFC T;  3H3A A;  2V1D B;  4HFI A;  2Y8D A;  3AAA B;  2CXL A;  4MBQ A;  2B76 A;  5JDM A;  1CUN A;  2XZE A;  4U33 A;  1VOM A;  4NIQ A;  3FB2 A;  4YTN A;  2E5L T;  3PE0 A;  3ZKR A;  1Z0P A;  1T7S A;  3K8P C;  1M62 A;  4EIW A;  4ZI3 D;  2XAF B;  3Q5E A;  3H37 A;  2I59 A;  5LXB A;  4UEL A;  2V5C A;  3VKG A;  1KFY A;  4O8S A;  3CQC B;  3CQG B;  2K3W A;  4QXH B;  2DNX A;  5FL0 A;  5JDF A;  1FJG T;  4EEB A;  3WI3 A;  2Y56 A;  2YKS A;  4PFP A;  2LSI A;  5FXX A;  5HEG A;  4YHJ A;  3HA4 A;  3JAE A;  4ILA A;  3ZN0 B;  2BR8 A;  4U2Z A;  2LRK A;  3OYX A;  1LVF A;  3S4U A;  2XM1 A;  1ZHC A;  3O1I A;  3AEA A;  2NR4 A;  4NXM T;  2ZJU A;  2HN2 A;  2UUC T;  2WZH A;  2X67 A;  3NBX X;  4LMJ A;  5KXJ A;  2C9T A;  5LHI B;  3QUJ A;  5J5H A;  4PJM A;  1IJ6 A;  2CWO A;  4JI6 T;  2FUP A;  3X1D A;  1UUS A;  3MXZ A;  2K24 A;  3FZK B;  2BJ0 A;  5JRC B;  4H9O C;  2Q9Q C;  5LMU T;  4QH5 A;  4ZZC A;  3P4R A;  4JV5 T;  2UXC T;  5AQV B;  5IWA T;  2XYT A;  5FY0 A;  3WTK A;  1ZOY A;  1J1J A;  5A1L A;  3ZC0 A;  4E7Z A;  3VHL A;  2YK0 A;  4Q25 A;  5FY7 A;  1IZN B;  5CA1 E;  2UXD T;  5LBM A;  4HKA A;  4UM3 P;  4YSZ A;  1YXR A;  2ZM0 A;  4PW8 A;  1ZV4 X;  5AFN A;  1VCS A;  3ZCI A;  3LFM A;  3KV6 A;  2WZY A;  3BQK A;  5JR9 A;  4H9R C;  3N9M A;  4U3C A;  2JQH A;  3B5M A;  2WDQ A;  1UK5 A;  5L47 A;  2XY8 B;  1HX8 A;  4YLH A;  2JQQ A;  4HE8 A;  3AA0 B;  4I43 B;  4XK9 A;  2HN1 A;  4HFC A;  3PU8 A;  3MZK B;  5AFJ A;  3RI5 A;  2XZ5 A;  4DID B;  2CM0 A;  1LRZ A;  3OPC A;  5HEJ A;  4LF9 T;  1XDO A;  2V26 A;  2HH7 A;  3R84 B;  5JDN A;  2PG8 A;  5LJM A;  4DMW A;  3ZMS B;  2D9D A;  2LM2 A;  4ERR A;  3CPZ A;  2XTL A;  4IDZ A;  2YOE A;  2BVL A;  2IIU A;  4MHC A;  1I94 T;  4HTE A;  2ZM6 T;  4WNK A;  5FXW A;  2WDV A;  4QAB A;  2W66 A;  2HPJ A;  3N9P A;  3AXJ B;  4Z8X A;  5HYA A;  2B1E A;  4DUZ T;  1MMD A;  3R6N A;  3VU7 H;  2XQ3 A;  4K0K T;  4UM1 A;  1MNE A;  4EAH A;  5FVL A;  2E2A A;  3F57 A;  4X20 E;  2H89 A;  2LSY A;  1NWM X;  2CMR A;  3FZH B;  4B3S T;  3RQW A;  3ZYK A;  2XQ5 A;  3LK3 B;  2N2N A;  2JRK A;  5JDL A;  1BR2 A;  1OXZ A;  5LHG B;  5C3J A;  5IYZ E;  4B6X A;  4WV9 A;  2BYQ A;  2ES0 A;  4IL4 A;  3RQU A;  4B5D A;  4A97 A;  1O3X A;  4H63 H;  3RRC A;  2VVS A;  3AA7 B;  5FMN A;  5ABE A;  1XDP A;  2E9X B;  5AQT B;  2DLR A;  3C98 B;  2XNU A;  2QGS A;  3PEO A;  3L39 A;  3U8J A;  2LHR A;  4AXP A;  2I6H A;  3EDU A;  5J5F A;  3T1H T;  5FNV E;  4ANJ A;  2KWH A;  1E1H B;  5H6Q B;  5CGM A;  2WDR A;  1HG5 A;  3LDQ B;  4QKN A;  2LKH A;  2FJE A;  1D0Z A;  4UVA B;  3ZT6 A;  5JDQ A;  2KWI B;  1J5E T;  5J0Z A;  3RH3 A;  4CI3 B;  1WYC A;  3BK9 A;  1FIO A;  2ACZ A;  1X79 A;  3ZC1 A;  4H9P C;  2WCA A;  3KV5 A;  2Y6X A;  1FMW A;  4PFO A;  4AIU A;  3PUW F;  5HXC A;  5L2L A;  5HCJ A;  5LGN B;  1NAF A;  1ZKE A;  1DU2 A;  2QA7 A;  3SFE A;  4DV0 T;  2Q9Q D;  2XAG B;  5BMV E;  2X9H A;  5AQJ B;  4O4I E;  3T8O A;  2CE7 A;  2Q9Q B;  5M4Y A;  3WTJ A;  4TWD A;  3A5X A;  5ADX L;  2H88 A;  1G8X A;  2PBI A;  1FMV A;  3AE6 A;  3AE2 A;  3C4X A;  2ZLY A;  3TLT A;  2Y57 A;  5DJQ C;  3C79 A;  4EZ1 A;  4ISS A;  1W0A A;  2QRX A;  4HFE A;  2OA5 A;  2UXX B;  1WR0 A;  2MBG A;  3HKD E;  4ILC A;  2XAH B;  2NP9 A;  4ZI7 E;  3KVA A;  4G63 A;  4IDO A;  5CA0 E;  2WU5 A;  2YMD A;  4HFV A;  4GK5 E;  3I9Y A;  3Q5D A;  2AE9 A;  2LKG A;  5LMN T;  1LKX A;  1CHU A;  4DR1 T;  1MIV A;  5L4H A;  2VUR A;  3C84 A;  4HWF A;  4DV4 T;  1D0X A;  5FKY A;  4U2Y A;  3KVB A;  4QHO A;  4H9N C;  4V1A v;  4DR2 T;  2FJA A;  4X1I E;  3UQ7 A;  3Q5X A;  3ZMU B;  5F8P A;  3SQ9 A;  3DTO A;  2W62 A;  2CBI A;  3PJA A;  2YU1 A;  2IDO B;  3CVR A;  5AQR B;  2BG9 A;  4NPP A;  2W67 A;  3WTL A;  4X64 T;  3N5L A;  3SIO A;  1FEW A;  3N2G E;  3O4X E;  2A2F X;  5AQG B;  4IHJ E;  5CJ5 A;  3UU3 A;  2EHO C;  3I9W A;  2YU2 A;  3HL6 A;  2K5B B;  4OX9 T;  1D1C A;  2KXP B;  5J5G A;  4AQG A;  2CWY A;  5AQF B;  3AXJ A;  2LE8 A;  5FXV A;  4CQI A;  4JI4 T;  3U8N A;  4IGU A;  3SWH A;  2Y54 A;  1U5P A;  4J2C A;  4CN1 A;  2C5I T;  4LF5 T;  4DV2 T;  3RC8 A;  1G73 A;  2XM2 A;  3ZST A;  2WN9 A;  4DBQ A;  3JAD A;  1OED B;  5BR8 T;  2KT9 A;  3VR8 A;  4KMC A;  4DO0 A;  2QC1 B;  3FBZ A;  2CLY C;  2VAS A;  4JI8 T;  2X9Y A;  4KHZ F;  4U7I A;  4CXX A;  4BQT A;  2BYS A;  3EAB A;  3WAJ A;  2E9X A;  4UIG A;  4ZXL A;  3ZJ1 A;  5FJV A;  4F6R C;  3OBV E;  2C0S A;  2WNJ A;  3RYC E;  4DBR A;  5AQI B;  3KBT A;  4P0A A;  3T4M A;  2BYP A;  2W8F A;  5JRE A;  2XQY A;  2W4X A;  4UXU A;  4O4J E;  1VCT A;  5LG3 A;  1KF6 A;  4WBN E;  3KBU A;  2YN6 A;  5CFB A;  5AQL B;  5LGT B;  2X0L B;  3ONL C;  3NVO A;  2WMN A;  3N9L A;  2ZJV A;  4EZH A;  4X1Y E;  4YSX A;  5L3B B;  5AQH B;  3P50 A;  3UT5 E;  5LJN A;  2WAU A;  1W09 A;  2J4G A;  2UXN B;  3J9X 1;  3ABV A;  5KDM C;  1WR6 A;  3Q2M A;  1MIW A;  4BA9 A;  4AKL A;  2LM9 A;  1HCI A;  2NW7 A;  5KZU A;  4PK5 A;  3PUS A;  4JYA T;  1HG2 A;  4LMK A;  4EED A;  4TV8 E;  3LBX B;  2YDS A;  3O9X A;  1HNZ T;  3MKD A;  1IBL T;  4M1P A;  1IAP A;  5JME A;  4KHP T;  3ZYL A;  4TNV A;  5HCM A;  4Z91 A;  1IBK T;  4U72 A;  1HR0 T;  1BR4 A;  3QC9 A;  5HEO A;  3V5S A;  1UX2 A;  2XQ7 A;  3FZF B;  5EK3 A;  3UUX B;  2X51 A;  4A98 A;  3KDS E;  2E5V A;  3ONX A;  1T8B A;  2ODU A;  1AJ3 A;  2ACX A;  3C50 A;  3SFD A;  3AVS A;  3UU8 A;  4PAG A;  5ABF B;  4NXN T;  3DJB A;  5AFM B;  3OYZ A;  5LBQ B;  3AEC A;  2ZMA A;  5J5I A;  3RIU A;  3UQ4 A;  3ZN1 B;  4XZC A;  5FP3 A;  3F2E A;  4MAL A;  4DMV A;  4DND A;  4OK0 A;  4BJN A;  2I0M A;  4TUY E;  3ZDG A;  4ZJS A;  1BR0 A;  5AFK A;  4BJM A;  3N2K E;  3E0Z A;  2W2U A;  2N9D A;  4QAA A;  4TN7 B;  5JH7 E;  4JI1 T;  1XWM A;  3L09 A;  4WBO A;  3RIF A;  2W63 A;  1OWA A;  4JUY A;  1GQE A;  3C51 A;  3JAF A;  3U8M A;  3M65 A;  3KFW X;  3KV4 A;  3N9Q A;  4XBF B;  4GIW A;  1MMA A;  4HQP A;  3EAM A;  5LYJ E;  4ZI2 C;  4XAX B;  4WYV A;  4CI1 B;  1HNW T;  2WB5 A;  4AKI A;  4AFH A;  2YEV C;  2X66 A;  1YD8 G;  2W61 A;  4UVB B;  1H7C A;  1VRB A;  4X66 T;  2WSS V;  3CQX C;  3RYH E;  3CX8 B;  1N32 T;  5DQW A;  5FL1 A;  2CRB A;  1HNX T;  1OED E;  4X65 T;  5HXR A;  4TX5 A;  1S35 A;  2V7I A;  4FI5 A;  2SPC A;  3NZQ A;  4ZR6 A;  4CI2 B;  2W0G A;  3A7M A;  3O1J A;  4ILB A;  5EZY E;  3NZP A;  3SS1 A;  3H3M A;  3ZMZ B;  3K3N A;  4QXC B;  1OED A;  2L3L A;  4EXT A;  5CB4 E;  4BFQ A;  2PJQ A;  2MAW A;  4IE6 A;  3AVR A;  4O4H E;  2JPF A;  4MFR A;  1YKH B;  4YTM A;  2LSK A;  4DR7 T;  3P4Q A;  2L9Q A;  2BKO A;  3ZMV B;  2BZB A;  4HWH A;  2VKO A;  5LOV E;  5HEH A;  4YFS A;  1KEY A;  2NTX A;  4IST A;  5JR9 C;  3KV9 A;  3WTM A;  4AQY T;  5AQQ B;  4ZZB A;  2UU9 T;  4LML A;  1M7K A;  2VL8 A;  3ZSS A;  1JNZ A;  3I0Q A;  4NZB A;  5BP0 A;  1XNR T;  3RIA A;  2PFV A;  2KSR A;  3CX7 B;  4HEA A;  5EK2 A;  1X9B A;  3ESL A;  5LCY A;  5AFH A;  3SOL A;  3AEE A;  3MA9 A;  5L3G B;  2WWU A;  3BQL A;  3AEF A;  2XNV A;  5DAB A;  2JMH A;  1KNP A;  2BS4 A;  2LOS A;  3FHN A;  4IE0 A;  5TAO A;  1SE7 A;  1XZY A;  4UY2 A;  4QH4 A;  4ZK1 A;  4I0U A;  4X1K E;  3LBX A;  4ZOL E;  5JQG E;  2XZ6 A;  1WLX A;  1Y64 B;  1L0V A;  4GK0 E;  3V5U A;  3U8L A;  2UZ6 A;  3UUN A;  4AQF A;  5C8Y E;  4DR5 T;  2BBH A;  3E22 E;  4C90 A;  1UW6 A;  5HAX A;  3BQI A;  3LSV A;  4XHE A;  3B57 A;  2MPK A;  1T98 A;  5AQK B;  4QX7 B;  5AIN A;  2CXF A;  3OKQ A;  1W9R A;  2XSA A;  3P4W A;  3ZCJ A;  5DQV A;  3MJX A;  4FJO A;  2D2S A;  5JDH A;  5HXH A;  3PDY A;  2CPT A;  4IL9 A;  4OFZ A;  2M6B A;  2NOX A;  4OYK A;  4H9Q C;  4L9I A;  2QYW A;  5FYM A;  4KP3 C;  5ABF A;  2XSB A;  2XQ6 A;  2C5J A;  2CA5 A;  4ZS2 A;  2PGZ A;  5AFM A;  4TZ4 C;  3IF8 B;  1QUU A;  4HGA A;  4GKK T;  2AXD S;  1N33 T;  5JRC A;  4ZJT A;  3QK6 A;  3C64 A;  2DCF A;  2V8S V;  1LVK A;  4EYU A;  1YKE B;  4ZI2 D;  3UFE A;  2DWK A;  3PUZ F;  4JI5 T;  3RF1 A;  4CN6 A;  2JQ9 A;  4K0U A;  4BAY B;  4IT4 A;  2VVN A;  5AFU L;  1HF8 A;  1UUR A;  3AA6 B;  4UM3 A;  4H9S E;  2Y7Y A;  3MK7 C;  3O1H A;  2OLT A; 
#chains in the Genus database with same CATH homology
 3SQ9 A;  2XQ3 A;  4UXU A;  3TLU A;  3U8L A;  2XYT A;  5HCJ A;  2UZ6 A;  2VL0 A;  5LG3 A;  3WTK A;  4TNW A;  5KE4 A;  1OED C;  1OED A;  4UM1 A;  2X00 D;  4BFQ A;  2BG9 C;  2BG9 A;  4PIR A;  4DBM A;  2MAW A;  4NPP A;  3UU8 A;  3UU6 A;  1UW6 A;  2YN6 A;  5CFB A;  3WTL A;  3IGQ A;  2Y56 A;  5AFM B;  2Y58 A;  2YKS A;  2BR7 A;  3SIO A;  3ZDH A;  4QAC A;  4AFG A;  3LSV A;  2ZJV A;  4UM3 P;  4XHE A;  5J5I A;  2BYN A;  3RQW A;  3PMZ A;  2XQ5 A;  3UQ4 A;  3P50 A;  4X5T A;  5HEG A;  2XQ9 A;  3UU3 A;  2M6I A;  4ILA A;  3JAE A;  5AFN A;  5AIN A;  2XQ8 A;  5HEH A;  4WV9 A;  2BYQ A;  3WTN A;  3WTJ A;  2BR8 A;  4IL4 A;  3TLW A;  4Z90 A;  3RQU A;  3EHZ A;  3WTH A;  3P4W A;  4TWD A;  4A97 A;  2WZY A;  4B5D A;  5J5G A;  1I9B A;  3WTM A;  4HFH A;  3UU4 A;  2WNL A;  4ZJS A;  3ZDG A;  2BG9 B;  4ZZB A;  5AFK A;  4LML A;  3U8N A;  4IL9 A;  5TVC A;  3TLT A;  2Y57 A;  4EZ1 A;  2W8G A;  2Y54 A;  2M6B A;  3C79 A;  4QAA A;  3SQ6 A;  4HFB A;  5IUX A;  5L4E A;  5KZU A;  4NZB A;  5L47 A;  2XNU A;  5BP0 A;  4HFE A;  3RIF A;  5CO5 A;  3PEO A;  4LMK A;  4IRE A;  4ALX A;  3U8J A;  3JAF A;  3U8M A;  2XYS A;  4F8H A;  4AFT A;  3RIA A;  2ZJU A;  2XQ6 A;  4XK9 A;  2KSR A;  4HFC A;  5J5F A;  4ILC A;  5BW2 A;  2PGZ A;  5AFM A;  4HQP A;  3EAM A;  4D01 A;  4LMJ A;  2BG9 E;  4HFD A;  5AFJ A;  4ZK4 A;  2WN9 A;  2YME A;  5JME A;  2X00 A;  2YMD A;  3JAD A;  2C9T A;  1OED B;  3RI5 A;  2XZ5 A;  5AFH A;  2XQ4 A;  4HFI A;  3EI0 A;  4ZJT A;  2QC1 B;  4TNV A;  3TLS A;  5HEJ A;  4AFH A;  5SYO A;  3SH1 A;  5HCM A;  2LKH A;  2XQA A;  5J5H A;  2LKG A;  4Z91 A;  1UV6 A;  2XNV A;  4TWH A;  2LM2 A;  4BQT A;  3U8K A;  2XNT A;  3RHW A;  2LLY A;  2BYS A;  5L4H A;  5HEO A;  2BYR A;  3WTO A;  3WTI A;  3ZKR A;  2YOE A;  4COF A;  5J0Z A;  3C84 A;  5BRX A;  4TWF A;  5AFL A;  1UX2 A;  2XQ7 A;  4FRR A;  1OED E;  2PH9 A;  3TLV A;  5FJV A;  3UUB A;  5LXB A;  4UY2 A;  4QH4 A;  3UU5 A;  2BJ0 A;  4QAB A;  2WNJ A;  5HEU A;  4A98 A;  2WNC A;  4ZK1 A;  4UM3 A;  4ZR6 A;  4UM3 S;  2Y7Y A;  4ILB A;  4ZRU A;  3GUA A;  3T4M A;  3WIP A;  2BYP A;  4QH1 A;  4QH5 A;  2W8F A;  4ZZC A;  2XZ6 A;  3UQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...