3TLSA

The glic pentameric ligand-gated ion channel e19'p mutant in a locally-closed conformation (lc2 subtype)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVPTNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 91
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlsA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlsA01
4UM3A 3P4WA 2BYNA 2Y57A 4XK9A 2BR7A 3SQ9A 4X5TA 3LSVA 5L47A 2X00D 5AFHA 2WNLA 5AFNA 2WNCA 4ZK1A 4F8HA 4HFDA 2YMDA 3WTKA 2YN6A 3UUBA 4AFTA 2BR8A 5LG3A 5KZUA 4EZ1A 2XQ4A 4QH5A 3UU3A 3PEOA 3JAEA 5AINA 4HFBA 4TWHA 2BG9A 3RIAA 3U8JA 4QACA 4Z90A 1OEDB 4TWFA 3RI5A 5CO5A 5J5GA 4ZZBA 2WZYA 2Y54A 2YKSA 4D01A 4TWDA 3RIFA 3P50A 4DBMA 5JMEA 4FRRA 2LKHA 5HEGA 4IL4A 3GUAA 2XQ9A 2LLYA 2PGZA 2Y7YA 2BYQA 2BYSA 3WTOA 3ZDGA 2BYRA 3ZDHA 5KE4A 4UM3S 1OEDE 4Z91A 3WTHA 3UU4A 5SYOA 2XQ3A 4HFEA 1OEDC 4HFCA 5AFMA 2XQ5A 4ILBA 4ALXA 5BRXA 3SH1A 3EAMA 4NPPA 5BP0A 2XNTA 2C9TA 5HEOA 2BG9B 4COFA 3WTIA 2XZ6A 3WTNA 5IUXA 3ZKRA 3JAFA 5HEHA 3WTLA 5BW2A 3UQ4A 1UV6A 2M6BA 3JADA 5HCMA 2BYPA 2Y56A 5FJVA 4UY2A 3U8KA 4AFHA 4A97A 5AFJA 2BG9E 2PH9A 3WTMA 4LMJA 2WNJA 3U8MA 2VL0A 1UW6A 3UU6A 3U8LA 4IL9A 2BG9C 4HFHA 5TVCA 4BFQA 3RHWA 4NZBA 5AFMB 2XQ8A 3RQWA 3UU8A 4IREA 3EHZA 3IGQA 4UM1A 2UZ6A 4ZJSA 4HQPA 4UXUA 5J0ZA 4ZK4A 2YOEA 2XYSA 4QH4A 5HEUA 4LMKA 2W8GA 5HCJA 4QH1A 2LM2A 3SQ6A 4LMLA 3U8NA 4TNWA 2YMEA 3T4MA 3TLSA 5HEJA 4AFGA 2BJ0A 5CFBA 4ILCA 5LXBA 4B5DA 4A98A 3WTJA 5L4EA 3C84A 3C79A 4QABA 5AFLA 3RQUA 5L4HA 3PMZA 2W8FA 4XHEA 2XQ7A 2XQAA 3WIPA 5J5IA 2XQ6A 3UU5A 2XNVA 2XNUA 2XZ5A 2Y58A 4BQTA 4HFIA 3EI0A 2MAWA 1UX2A 2LKGA 4ILAA 3UQ7A 4PIRA 4ZRUA 2X00A 3SIOA 2KSRA 3TLUA 3TLVA 4QAAA 5J5FA 3TLTA 4ZR6A 4ZZCA 4ZJTA 4UM3P 2ZJUA 2M6IA 1OEDA 4TNVA 2WN9A 2ZJVA 5AFKA 5J5HA 2XYTA 2QC1B 1I9BA 4WV9A 3TLWA
chains in the Genus database with same CATH superfamily
2WNCA 3O4XE 3LK3B 4HEAA 1UGOA 2A72A 2KWIB 3T8OA 3MA9A 4GYRA 4Z90A 2NWBA 1Y01A 2QRXA 2LKHA 4DV0T 2W61A 3N2KE 3FZHB 1UK5A 2OV9A 2XQ3A 3IEEA 4QXHB 4K0KT 2C5KT 3L8RA 3AEEA 4COFA 2YDRA 3AAIA 2IUBA 1US7B 2NR4A 3JADA 4U33A 2PH9A 3P4PA 3K3NA 4CN4A 3SFEA 4ZXLA 4JI6T 3AXJA 3HA4A 3QK6A 3JC6C 3K3QC 4IREA 2BDEA 5HWXA 2WZIA 5L3FB 3AEAA 3CQCB 4PW8A 2KZ7B 2YMEA 2ODVA 4AFGA 5AQMB 2CBIA 4UEMA 5AQRB 4GOUA 4IE5A 3RQUA 4K0UA 1D0ZA 2PBIA 4CQIA 3AE6A 2QA7A 2ZM0A 4ERRA 3K1SA 4ZS3A 1WYBA 3AE9A 5AQTB 2DHRA 2CE7A 4H63H 5AQQB 4QXBB 3OTOT 2EHOA 2FJBA 3CWZB 1SUMB 4P0BA 5FXVA 1CUNA 3RYCE 5ABFA 3N9MA 4YXDA 2JMHA 3R6NA 5EK3A 5DABA 2UUCT 2BG9A 4MBQA 1OEDB 3TKLB 2WZYA 2CRBA 3AE2A 2KT9A 2H3RA 2CBJA 2J1DG 3RKOA 3MK7C 4X65T 3OVUA 5H6RB 2ODUA 4DO0A 2V7IA 5LMNT 4DR6T 5HXHA 2MYSA 3AEFA 3U78A 3I0OA 3RC8A 1HX8A 3D0TA 2WDVA 5FL0A 4GK0E 2VQET 3OJAA 1FEWA 5JVDE 1X9BA 4HFVA 2YK0A 2XHEB 5LP6E 3ZSSA 2XAJB 2B76A 3ABVA 4PAGA 2K24A 4YTNA 3NRYA 1MMAA 3RLFF 2FUPA 4B6XA 4XZCA 3UUXB 4PK6A 3WTJA 4H9OC 4QABA 3KVAA 3CX7B 1MNDA 3C98B 4JI7T 4U7YA 5CA1E 1JNZA 4BAYB 5E0OA 2X66A 2XM1A 4ZZCA 2K9AA 2BBJA 2Q9QD 3Q5WA 1I6ZA 2A2FX 5LJNA 4L5GA 2BR7A 4AI6A 5F3JA 2V8SV 2LSIA 4IE0A 3UUBA 2PJQA 3LK42 4B3TT 4DV6T 2CXDA 2CM0A 4O2BE 4MHCA 2J47A 3BQIA 3K8PC 2I0MA 3OYXA 2V7JA 3I1AA 2ACXA 3VR8A 5KE4A 2Q9QB 3C50A 3MACA 3PUQA 2ZM6T 5LHGB 1KNZA 2WMOA 4PK5A 3ZMUB 4ANJA 2KXPB 4ILBA 2CCQA 3JAFA 1O3XA 4TUYE 1UX5A 4WBOA 2RA1A 5KXJA 1HS7A 4KBMB 3ZLIA 3HR0A 3FHNA 2FJAA 5IWAT 1IZNB 2WS3A 5AFMB 2CHOA 2XQ8A 3RQWA 2CPTA 1D1BA 4ZJSA 5AQUB 2BZBA 4AQGA 4DR3T 3OPCA 1XDPA 4IDNA 3UUMA 2JPFA 3RC3A 4CZZB 4DMVA 4LFCT 4DVDA 4WYVA 5LXTE 2ZMAA 1MMNA 4HFIA 1UX2A 3UQ7A 4PIRA 5J2UE 3P8CD 4E7ZA 2V6YB 1VRBA 2YDQA 4TNVA 5JDMA 3SQ9A 3V5SA 3AE8A 4QH5A 2LM9A 4TWHA 3CK6A 2LSGA 4IE4A 4B3MT 2XAQB 3N2OA 2QVAA 1EZ3A 4IE7A 2YKSA 3ZEFB 3CKDA 5LBQB 1ZKEA 3P50A 3ZMVB 1XMOT 3F2EA 4IL4A 4U3CA 4U74A 4HWIB 5LG4A 5JDNA 1SA0E 1V9DA 2AE9A 1IAPA 2W4XA 4BJMA 2WBLA 3T1YT 2XNTA 3WTIA 3PTRB 4KUMB 3U3IA 3UUNA 2IIUA 5BW2A 3PUSA 3UQ4A 2Y56A 2XTLA 5ABHA 4ILUA 3ZN1B 2DCFA 4WNKA 5HXCA 4GK5E 1WCRA 4NUVA 2XPKA 3RRCA 2AXDS 3PUWF 4ADZA 4LF4T 5FVKA 2N9DA 1IJ6A 4AKLA 5FMNA 3C4WA 2XYSA 5L3BB 3KVBA 2EHOC 3ONLC 2V1DB 4B5DA 1LVFA 4X20E 5C3JA 4ZEYA 1UCUA 3ZT7A 4XHEA 3CIRA 2XQ7A 1WFDA 5L3DB 2XZ5A 3WAJA 4YTMA 1D1CA 3SS1A 1HF8A 3A7MA 2IDOB 2VASA 2CLYC 2NW8A 2Y57A 2PG8A 1W0AA 5AFHA 2IMLA 3CQXC 2IC9A 1KNPA 4O4IE 3E0ZA 3F31A 5FY1A 4HN9A 3RI5A 5CO5A 2XQYA 1YW0A 3H37A 3QNUA 3OKQA 4I55E 3E22E 1OEDE 5LMUT 1J5ET 4B3ST 5SYOA 1G8XA 3PURA 4H9QC 4ZI2C 1NWMX 2RPAA 2QGSA 4IHJE 3EAMA 2XASB 5JRCA 2XZ6A 5JDLA 1D0XA 2LSKA 3F57A 4DV1T 3V5UA 4YSXA 3WTMA 4JUYA 1T72A 2W62A 4AIUA 2WSSV 4HWDA 1X79A 2MOZA 4TV8E 4AQYT 4P0AA 1UUSA 4HQPA 2WCAA 3ZT5A 4LFBT 1WLXA 2BS3A 3SQ6A 1FIOA 3AB3B 4JEHB 2DWGA 2ES0A 2CHNA 4DV2T 2BJ0A 4AQFC 5LXBA 3CPZA 4YT0A 3I9YA 4DR4T 3AVSA 4JI3T 3AEGA 3H3MA 5CJ5A 4ZHQE 4JI0T 2ZLYA 3PV0F 3VKHA 3EUHA 4HWCA 2ZJUA 3IHRA 2BS4A 4OK0A 3LBXA 4H63V 1N36T 5EZYE 1S94A 3LSVA 2Y8DA 4U7IA 3ZC1A 4H9SE 2FJDA 1WR6A 4JI4T 1LKXA 2E9XD 2X67A 5AQNB 1UX4A 3ZDGA 1YQ4A 3AE1A 2BYRA 2F4VT 3PUZF 3WTHA 4QX7B 3FB2A 2JMKA 4HFCA 1AJ3A 5FXXA 4WW0A 3VHLA 2IC6A 5JDFA 1W9RA 1WRDA 3VRBA 4QXCB 3RIUC 1U5PA 3ZC0A 2IAKA 4UF0A 2E9XB 3ZSTA 1H7CA 5TVCA 2MBGA 4HKAA 3RHWA 3AAAB 4NZBA 2K3WA 3PU8A 2JRKA 4KX6A 5AQGB 4P1NA 2KMFA 5JQGE 4KI0F 2P9BA 5HEJA 2OLTA 4FI5A 4ILCA 3AXJB 3KV9A 3VU7H 5FY0A 5L4HA 4ISSA 4IDPA 1B7TA 4OYKA 2MPKA 2E2AA 1BR0A 4I4TE 5DJQC 1J1JA 2QC1B 4WV9A 1HG5A 3KDSE 2X00D 5AFNA 5FP3A 3E08A 1N34T 1ZEEA 5LJMA 4UV8B 5JTGA 5LG3A 3CQGB 3UU3A 1Z0PA 3PJAJ 5JR9C 2I59A 4TWFA 2Y54A 3RIFA 5LB7B 4LF5T 2BS2A 2EHOB 2YDSA 3WTOA 2Y48B 5AFUL 3FZFB 5JREA 4XAXB 3PJAA 1BR2A 4QHOA 4J2CA 5ABFB 2VKOA 3ESLA 2HN2A 2L3LA 2PFVA 5BP0A 2C9TA 2BG9B 2LEHA 2H89A 1KEYA 3WTLA 2BYPA 3AECA 2BVLA 3CX8B 3FZMB 3CMLA 4YTPA 1E7PA 3WAKA 2SPCA 3UU6A 2WU5A 1UW6A 3CVRA 2XJ7A 4C91A 1VCSA 4UM1A 5HEUA 2I6HA 4IDOA 4ZI7E 2BBHA 3H3AA 3C84A 3UFEA 2KWHA 5CA0E 1HNZT 1QUUA 3SIOA 2C5JA 1KNRA 3TLVA 4OHFA 4DMWA 3TLTA 1HNXT 3AA1B 4U2ZA 5AFKA 4E7SA 1NAFA 3N5LA 2W63A 5L3GB 4ZK1A 3PDYA 3RX6A 3QB5A 3AEBA 2YU1A 4G2AA 5LBMA 1OXZA 3NVOA 5BMVE 5FNVE 4JI1T 4GKKT 4IDQA 2X9WA 3KBTA 2K48A 3ZPOA 3B5MA 4P09A 4TV9E 2HH7A 4OYJA 4AQFA 3KFWX 2LOSA 3WTNA 2Y6XA 4AISA 4BA9A 4O8SA 5LOVE 4GYSA 4KHZF 4PNIA 1CHUA 1NENA 1HR0T 2HN1A 2JQQA 1ZV4X 2WDRA 5DQVA 3LFMA 5LHIB 5DQWA 1XDOA 4H9RC 5FXWA 2LM2A 5AQJB 4ZS2A 2A3DA 5ABGA 4HE8A 4CXWA 5HXRA 3RKGA 2XY8B 1T7SA 2CEAA 2Q9QA 3LG7A 2IHR1 2JQHA 4H9PC 4OFZA 3ANWA 1M62A 2Z6EA 2ZM8A 2HPJA 3ZCIA 2WM9A 2X9XA 4ZJTA 3HI2A 4UM3P 4ISTA 4HGAA 3EABA 3P4WA 2YU2A 1NEKA 2VKHA 4TN7B 2FJEA 4F8HA 3ZYLA 3RIUA 3JC6D 2DL1A 5HYAA 2NW9A 3NWIA 4DR1T 5AINA 3CX6B 4IGUA 4DNDA 3M3ZB 4IT4A 3G06A 2XQ9A 3PUYF 2UU9T 4EYYR 5JDHA 2CMRA 3UU4A 2L8KA 1MMGA 2QYWA 4HFEA 2KLQA 4WBNE 2XQ5A 3RH3A 1M7KA 3FBLA 4Q25A 3HKBE 5LGUB 1OWAA 2FBWA 4CN6A 5FJVA 3P4RA 3KV4A 2VVNA 2IW5B 4KP3C 4EXTA 4BFQA 3HKEE 2LE8A 4MALA 4AKHA 3J7Yq 4ZK4A 4X64T 4QH4A 4HTEA 4LMLA 3RYIE 4YY3T 3MKDA 1MIYA 5JR9A 1IBKT 1Z8UA 1KFYA 3Q5DA 4X62T 4H9NC 5AQVB 3O1HA 3TLUA 5M4YA 1XNRT 3NZPA 5JH7E 2WN9A 3HKCE 3AA6B 4NXNT 3AVRA 4NXMT 3NRXA 2X0LB 3UFGA 4JBWF 4YJ2E 1N33T 4XK9A 4G63A 2C5IT 2J62A 1QLBA 4HFDA 2BR8A 5KZUA 3RRWA 2V5CA 3VR9A 4LF8T 4DIDB 3PUAA 4ZZBA 2JQ9A 3FZKB 5JMEA 3GUAA 3RYFE 4MFRA 4UM3S 5KX5E 5FKYA 5F8PA 2VURA 1OEDC 4ALXA 2X9YA 2JJ9A 1DU2A 3ZKRA 2M6BA 4ZI3D 2BG9E 1XMQT 3MZKB 3PE0A 5AQHB 2BKOA 3GN5A 3J9X1 4B3RT 3ZYMA 1SHZC 4ASKA 3AEDA 4X1IE 2RP4A 5JRCB 5AQPB 4UVBB 1D0YA 2CWOA 1IBMT 5L4EA 1KF6A 5LCYA 2DNXA 4YLHA 5FYMA 1UURA 3Q9DA 3KINB 3AA0B 5A1LA 5H6QB 2CA5A 1YQ3A 1JNRA 3ZYKA 2XM2A 2ZJVA 4CI3B 5J5HA 4CI2B 4HWFA 3ZCJA 1YXRA 2YN6A 4AFTA 2XAGB 3FZLB 3LDQB 4LF6T 2VL8A 3QC9A 2XQ4A 3EDVA 3PEOA 4GKJT 4O4LE 3HL6A 3NKZA 3RIAA 3U8JA 4QACA 2WZHA 5J5GA 3IF8B 4I43B 4TWDA 3LBXB 4DBMA 3Q5XA 2VKJA 4YFSA 5CB4E 2WQYA 2H7OA 1YKHB 4ZOLE 5AQKB 2LOPA 4IE6A 1MNEA 1VOMA 2Q9QC 4QX8B 3C4ZA 3U8KA 4A97A 4EEDA 3RF1A 3ZN0B 2LJLA 4PJMA 2CWYA 4JI2T 3UT5E 3SFDA 5AQFB 1YKEB 2H7VC 4PJLA 4CN1A 4DV4T 4UXUA 2YOEA 3UULA 3U8NA 2VB6A 1N32T 3T4MA 4PFOA 4UF0B 3TLSA 5FL1A 3RYHE 3ZT6A 3ZMSB 4EYUA 5EK4A 2XQAA 2W0GA 3OBVE 3FXEB 1HX1B 1XZYA 1VCTA 2KSRA 3RGLA 4QAAA 3LK2B 2M6IA 3DP7A 2XYTA 3AE4A 4LFAT 4PK4A 1U4QA 3I0QA 4UM3A 2E9XA 3MJXA 1WYCA 2LT3A 2WNLA 2A9UA 3FBZA 4EZ1A 2LSJA 2CXFA 3JAEA 1SE7A 2EHOD 3VRAA 1FMWA 2PGZA 2BYSA 3A5XA 2HHHT 1GQEA 3IBPA 4AXPA 5FVLA 5BRXA 4DR5T 1G73A 3QOFA 1T8BA 5HCMA 5L3EB 4UY2A 1ZP0A 4AFHA 5J2TE 3DTOA 2L9QA 3QB5K 5AQOB 1R8IA 4HFHA 2XUEA 5C2TA 2BKNA 1LVKA 3ETVA 3N9NA 3RPUA 4TZ4C 4JI5T 3GWHA 2UXNB 3PUGA 2H88A 2NP9A 3O1IA 3UTKA 2CLYB 3UU5A 2V5DA 4BQTA 3EI0A 4ZI2D 2MAWA 2X00A 4EZHA 4EZ4A 1QSDA 3ONJA 1OEDA 4O2AE 2UXCT 5J1GA 3X1DA 3WTKA 4DBQA 1MIWA 3O9XA 3JCFA 4DBRA 4IDZA 1W0BA 4D01A 3VKGA 4FRRA 2DLRA 3QUJA 3ZDHA 2V26A 5LGTB 3ZMTB 2K5BB 1D1AA 2D0UA 5HEOA 5IUXA 4U72A 3WI3A 5HEHA 1IBLT 2JQKA 4O4HE 5AFJA 4LMJA 4LF7T 2WY2A 4A56A 2WNJA 2D2SA 4IL9A 3ZJ1A 3PUVF 3O1JA 1IJ5A 3KBUA 3DJBA 5ADXL 3EHZA 4F6RC 4DV3T 2NW7A 4YHHT 2UUBT 4ZI3C 4UELA 1ZOYA 1E2AA 3Q2MA 4PJNA 4L0RA 3C79A 2CXLA 4DUYT 3EVYA 2R6GF 4AKGA 2GK9A 4QKNA 3C64A 4N78D 4JEUB 2XNUA 4CI1B 2Y58A 2NTXA 1S35A 1HNWT 2G0UA 2WWUA 5ABEA 2XSAA 4BJNA 2N2NA 3R84B 3KV5A 1FMVA 3TLWA 2WWVA 2E8IA 2WU2A 4EOZB 4AKRB 2N1GA 2BKPA 3ANWB 2B1EA 3SWHA 3I9WA 4DV7T 2LSYA 4M1PA 4NUUA 2OA5A 3GMIA 3L09A 5HEGA 5GONE 5HAXA 4JI8T 3C51A 3NBXX 2X51A 3LJCA 5AFMA 4JV5T 2VK9A 5LYJE 2ACZA 3SRZA 2C0SA 2PTFA 4IIJE 4WZXA 1HTJF 3BQKA 1YD8G 3NZQA 3AE3A 2VQFT 4NIQA 1LRZA 3IGQA 3B57A 4I0UA 2UZ6A 2W2UA 5J0ZA 3BK9A 4LMKA 2WMNA 5FXZA 5HCJA 5F5WA 5LA6E 2E9XC 1Y64B 4TNWA 4JYAT 2UUAT 2V6YA 5CFBA 4A98A 2E5LT 4QWNB 1W09A 1FJGT 3PMZA 2WB5A 3WIPA 2XQ6A 2XNVA 1J5WA 1T98A 5C8YE 5J5FA 4X1KE 5CGMA 4ZR6A 5EK2A 4EAHA 4DV5T 3K3OA 4YHJA 4UVCB 5FY7A 4YJ3E 2LHRA 3EDUA 5JR9B 2D5UA 2UXXB 2LHNA 2BVMA 2XAHB 4DR7T 3C4XA 4X5TA 5L47A 2YMDA 1KK7A 2V7LA 2UXBT 4HFBA 3N2GE 4CXXA 4LF9T 2V6XA 4O4JE 2D9DA 2LRKA 2LLYA 2BYQA 4EB6E 5AQIB 3ONXA 2V7KA 3T1HT 5L2LA 4Z8XA 3B13A 3AE7A 3SH1A 4KMCA 4YSYA 3PUXF 4TX5A 1UV6A 2E5VA 4I50E 1MMDA 5AQSB 5HXEA 5IYZE 1XNQT 2WDQA 3PU3A 2LRLA 1L0VA 3N9QA 1I94T 2BG9C 4X1YE 3L39A 4X66T 3P4SA 1MIVA 5BR8T 3ZMZB 2W66A 2W8GA 4QH1A 4EGWA 2VKDA 2KINB 2M67A 3FXDB 4PJJA 4YSZA 3A8YC 2XZEA 3KV6A 5LHHB 3AAEB 3GN5B 3HKDE 4C90A 4UR9A 5LGNB 2X9HA 3S4UA 3ETUA 2UXDT 2KNDA 4UXNB 2ZM2A 2DWKA 5ETWA 2W8FA 2J4GA 4GIWA 5J5IA 2X0HA 3M65A 3N9LA 4U2YA 5TAOA 4ZRUA 2DI4A 3GA8A 2JIWA 2D0TA 2HPLA 4L9IA 3BQLA 1HCIA 2XAFB 2W00A 3N9PA 4DR2T 2BYNA 5AQLB 5KDMC 4HWHA 5LNKA 4CXYA 4UV9B 1HG2A 2MTQA 3L3PA 3N9OA 3OYZA 2VVSA 4EIWA 2XSBA 2V7MA 4JLEA 4DUZT 2Y7YA 2X0YA 3AE5A 4U31A 4MLKA 4Z91A 3SOLA 2VWAA 4V1Av 2YEVC 5JDGA 4NPPA 3P7IA 5IHYA 1E1HB 4KHPT 3Q5EA 5HXSA 2WAUA 2W67A 4FJOA 3U8MA 1BR4A 2VL0A 3U8LA 1BR1A 3MXZA 3UU8A 4XBFB 2YINA 3ZJ2A 4EEBA 1ZHCA 5KMGP 1HFAA 2X68A 4UIGA 5HWYA 5AFLA 2NTYA 4UVAB 3P4QA 2NOXA 4AKIA 2WP9A 3W15B 5JDQA 2LKGA 1WR0A 4ILAA 5L3CB 3IA3A 4PFPA 4A5XA 1XWMA 4OX9T 4EV6A 3AA7B 1I9BA
chains in the Genus database with same CATH topology
4UM3A 3P4WA 2BYNA 2Y57A 4XK9A 2BR7A 3SQ9A 4X5TA 3LSVA 5L47A 2X00D 5AFHA 2WNLA 5AFNA 2WNCA 4ZK1A 4F8HA 4HFDA 2YMDA 3WTKA 2YN6A 3UUBA 4AFTA 2BR8A 5LG3A 5KZUA 4EZ1A 2XQ4A 4QH5A 3UU3A 3PEOA 3JAEA 5AINA 4HFBA 4TWHA 2BG9A 3RIAA 3U8JA 4QACA 4Z90A 1OEDB 4TWFA 3RI5A 5CO5A 5J5GA 4ZZBA 2WZYA 2Y54A 2YKSA 4D01A 4TWDA 3RIFA 3P50A 4DBMA 5JMEA 4FRRA 2LKHA 5HEGA 4IL4A 3GUAA 2XQ9A 2LLYA 2PGZA 2Y7YA 2BYQA 2BYSA 3WTOA 3ZDGA 2BYRA 3ZDHA 5KE4A 4UM3S 1OEDE 4Z91A 3WTHA 3UU4A 5SYOA 2XQ3A 4HFEA 1OEDC 4HFCA 5AFMA 2XQ5A 4ILBA 4ALXA 5BRXA 3SH1A 3EAMA 4NPPA 5BP0A 2XNTA 2C9TA 5HEOA 2BG9B 4COFA 3WTIA 2XZ6A 3WTNA 5IUXA 3ZKRA 3JAFA 5HEHA 3WTLA 5BW2A 3UQ4A 1UV6A 2M6BA 3JADA 5HCMA 2BYPA 2Y56A 5FJVA 4UY2A 3U8KA 4AFHA 4A97A 5AFJA 2BG9E 2PH9A 3WTMA 4LMJA 2WNJA 3U8MA 2VL0A 1UW6A 3UU6A 3U8LA 4IL9A 2BG9C 4HFHA 5TVCA 4BFQA 3RHWA 4NZBA 5AFMB 2XQ8A 3RQWA 3UU8A 4IREA 3EHZA 3IGQA 4UM1A 2UZ6A 4ZJSA 4HQPA 4UXUA 5J0ZA 4ZK4A 2YOEA 2XYSA 4QH4A 5HEUA 4LMKA 2W8GA 5HCJA 4QH1A 2LM2A 3SQ6A 4LMLA 3U8NA 4TNWA 2YMEA 3T4MA 3TLSA 5HEJA 4AFGA 2BJ0A 5CFBA 4ILCA 5LXBA 4B5DA 4A98A 3WTJA 5L4EA 3C84A 3C79A 4QABA 5AFLA 3RQUA 5L4HA 3PMZA 2W8FA 4XHEA 2XQ7A 2XQAA 3WIPA 5J5IA 2XQ6A 3UU5A 2XNVA 2XNUA 2XZ5A 2Y58A 4BQTA 4HFIA 3EI0A 2MAWA 1UX2A 2LKGA 4ILAA 3UQ7A 4PIRA 4ZRUA 2X00A 3SIOA 2KSRA 3TLUA 3TLVA 4QAAA 5J5FA 3TLTA 4ZR6A 4ZZCA 4ZJTA 4UM3P 2ZJUA 2M6IA 1OEDA 4TNVA 2WN9A 2ZJVA 5AFKA 5J5HA 2XYTA 2QC1B 1I9BA 4WV9A 3TLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM3 A;  3P4W A;  2BYN A;  2Y57 A;  4XK9 A;  2BR7 A;  3SQ9 A;  4X5T A;  3LSV A;  5L47 A;  2X00 D;  5AFH A;  2WNL A;  5AFN A;  2WNC A;  4ZK1 A;  4F8H A;  4HFD A;  2YMD A;  3WTK A;  2YN6 A;  3UUB A;  4AFT A;  2BR8 A;  5LG3 A;  5KZU A;  4EZ1 A;  2XQ4 A;  4QH5 A;  3UU3 A;  3PEO A;  3JAE A;  5AIN A;  4HFB A;  4TWH A;  2BG9 A;  3RIA A;  3U8J A;  4QAC A;  4Z90 A;  1OED B;  4TWF A;  3RI5 A;  5CO5 A;  5J5G A;  4ZZB A;  2WZY A;  2Y54 A;  2YKS A;  4D01 A;  4TWD A;  3RIF A;  3P50 A;  4DBM A;  5JME A;  4FRR A;  2LKH A;  5HEG A;  4IL4 A;  3GUA A;  2XQ9 A;  2LLY A;  2PGZ A;  2Y7Y A;  2BYQ A;  2BYS A;  3WTO A;  3ZDG A;  2BYR A;  3ZDH A;  5KE4 A;  4UM3 S;  1OED E;  4Z91 A;  3WTH A;  3UU4 A;  5SYO A;  2XQ3 A;  4HFE A;  1OED C;  4HFC A;  5AFM A;  2XQ5 A;  4ILB A;  4ALX A;  5BRX A;  3SH1 A;  3EAM A;  4NPP A;  5BP0 A;  2XNT A;  2C9T A;  5HEO A;  2BG9 B;  4COF A;  3WTI A;  2XZ6 A;  3WTN A;  5IUX A;  3ZKR A;  3JAF A;  5HEH A;  3WTL A;  5BW2 A;  3UQ4 A;  1UV6 A;  2M6B A;  3JAD A;  5HCM A;  2BYP A;  2Y56 A;  5FJV A;  4UY2 A;  3U8K A;  4AFH A;  4A97 A;  5AFJ A;  2BG9 E;  2PH9 A;  3WTM A;  4LMJ A;  2WNJ A;  3U8M A;  2VL0 A;  1UW6 A;  3UU6 A;  3U8L A;  4IL9 A;  2BG9 C;  4HFH A;  5TVC A;  4BFQ A;  3RHW A;  4NZB A;  5AFM B;  2XQ8 A;  3RQW A;  3UU8 A;  4IRE A;  3EHZ A;  3IGQ A;  4UM1 A;  2UZ6 A;  4ZJS A;  4HQP A;  4UXU A;  5J0Z A;  4ZK4 A;  2YOE A;  2XYS A;  4QH4 A;  5HEU A;  4LMK A;  2W8G A;  5HCJ A;  4QH1 A;  2LM2 A;  3SQ6 A;  4LML A;  3U8N A;  4TNW A;  2YME A;  3T4M A;  3TLS A;  5HEJ A;  4AFG A;  2BJ0 A;  5CFB A;  4ILC A;  5LXB A;  4B5D A;  4A98 A;  3WTJ A;  5L4E A;  3C84 A;  3C79 A;  4QAB A;  5AFL A;  3RQU A;  5L4H A;  3PMZ A;  2W8F A;  4XHE A;  2XQ7 A;  2XQA A;  3WIP A;  5J5I A;  2XQ6 A;  3UU5 A;  2XNV A;  2XNU A;  2XZ5 A;  2Y58 A;  4BQT A;  4HFI A;  3EI0 A;  2MAW A;  1UX2 A;  2LKG A;  4ILA A;  3UQ7 A;  4PIR A;  4ZRU A;  2X00 A;  3SIO A;  2KSR A;  3TLU A;  3TLV A;  4QAA A;  5J5F A;  3TLT A;  4ZR6 A;  4ZZC A;  4ZJT A;  4UM3 P;  2ZJU A;  2M6I A;  1OED A;  4TNV A;  2WN9 A;  2ZJV A;  5AFK A;  5J5H A;  2XYT A;  2QC1 B;  1I9B A;  4WV9 A;  3TLW A; 
#chains in the Genus database with same CATH topology
 2WNC A;  3O4X E;  3LK3 B;  4HEA A;  1UGO A;  2A72 A;  2KWI B;  3T8O A;  3MA9 A;  4GYR A;  4Z90 A;  2NWB A;  1Y01 A;  2QRX A;  2LKH A;  4DV0 T;  2W61 A;  3N2K E;  3FZH B;  1UK5 A;  2OV9 A;  2XQ3 A;  3IEE A;  4QXH B;  4K0K T;  2C5K T;  3L8R A;  3AEE A;  4COF A;  2YDR A;  3AAI A;  2IUB A;  1US7 B;  2NR4 A;  3JAD A;  4U33 A;  2PH9 A;  3P4P A;  3K3N A;  4CN4 A;  3SFE A;  4ZXL A;  4JI6 T;  3AXJ A;  3HA4 A;  3QK6 A;  3JC6 C;  3K3Q C;  4IRE A;  2BDE A;  5HWX A;  2WZI A;  5L3F B;  3AEA A;  3CQC B;  4PW8 A;  2KZ7 B;  2YME A;  2ODV A;  4AFG A;  5AQM B;  2CBI A;  4UEM A;  5AQR B;  4GOU A;  4IE5 A;  3RQU A;  4K0U A;  1D0Z A;  2PBI A;  4CQI A;  3AE6 A;  2QA7 A;  2ZM0 A;  4ERR A;  3K1S A;  4ZS3 A;  1WYB A;  3AE9 A;  5AQT B;  2DHR A;  2CE7 A;  4H63 H;  5AQQ B;  4QXB B;  3OTO T;  2EHO A;  2FJB A;  3CWZ B;  1SUM B;  4P0B A;  5FXV A;  1CUN A;  3RYC E;  5ABF A;  3N9M A;  4YXD A;  2JMH A;  3R6N A;  5EK3 A;  5DAB A;  2UUC T;  2BG9 A;  4MBQ A;  1OED B;  3TKL B;  2WZY A;  2CRB A;  3AE2 A;  2KT9 A;  2H3R A;  2CBJ A;  2J1D G;  3RKO A;  3MK7 C;  4X65 T;  3OVU A;  5H6R B;  2ODU A;  4DO0 A;  2V7I A;  5LMN T;  4DR6 T;  5HXH A;  2MYS A;  3AEF A;  3U78 A;  3I0O A;  3RC8 A;  1HX8 A;  3D0T A;  2WDV A;  5FL0 A;  4GK0 E;  2VQE T;  3OJA A;  1FEW A;  5JVD E;  1X9B A;  4HFV A;  2YK0 A;  2XHE B;  5LP6 E;  3ZSS A;  2XAJ B;  2B76 A;  3ABV A;  4PAG A;  2K24 A;  4YTN A;  3NRY A;  1MMA A;  3RLF F;  2FUP A;  4B6X A;  4XZC A;  3UUX B;  4PK6 A;  3WTJ A;  4H9O C;  4QAB A;  3KVA A;  3CX7 B;  1MND A;  3C98 B;  4JI7 T;  4U7Y A;  5CA1 E;  1JNZ A;  4BAY B;  5E0O A;  2X66 A;  2XM1 A;  4ZZC A;  2K9A A;  2BBJ A;  2Q9Q D;  3Q5W A;  1I6Z A;  2A2F X;  5LJN A;  4L5G A;  2BR7 A;  4AI6 A;  5F3J A;  2V8S V;  2LSI A;  4IE0 A;  3UUB A;  2PJQ A;  3LK4 2;  4B3T T;  4DV6 T;  2CXD A;  2CM0 A;  4O2B E;  4MHC A;  2J47 A;  3BQI A;  3K8P C;  2I0M A;  3OYX A;  2V7J A;  3I1A A;  2ACX A;  3VR8 A;  5KE4 A;  2Q9Q B;  3C50 A;  3MAC A;  3PUQ A;  2ZM6 T;  5LHG B;  1KNZ A;  2WMO A;  4PK5 A;  3ZMU B;  4ANJ A;  2KXP B;  4ILB A;  2CCQ A;  3JAF A;  1O3X A;  4TUY E;  1UX5 A;  4WBO A;  2RA1 A;  5KXJ A;  1HS7 A;  4KBM B;  3ZLI A;  3HR0 A;  3FHN A;  2FJA A;  5IWA T;  1IZN B;  2WS3 A;  5AFM B;  2CHO A;  2XQ8 A;  3RQW A;  2CPT A;  1D1B A;  4ZJS A;  5AQU B;  2BZB A;  4AQG A;  4DR3 T;  3OPC A;  1XDP A;  4IDN A;  3UUM A;  2JPF A;  3RC3 A;  4CZZ B;  4DMV A;  4LFC T;  4DVD A;  4WYV A;  5LXT E;  2ZMA A;  1MMN A;  4HFI A;  1UX2 A;  3UQ7 A;  4PIR A;  5J2U E;  3P8C D;  4E7Z A;  2V6Y B;  1VRB A;  2YDQ A;  4TNV A;  5JDM A;  3SQ9 A;  3V5S A;  3AE8 A;  4QH5 A;  2LM9 A;  4TWH A;  3CK6 A;  2LSG A;  4IE4 A;  4B3M T;  2XAQ B;  3N2O A;  2QVA A;  1EZ3 A;  4IE7 A;  2YKS A;  3ZEF B;  3CKD A;  5LBQ B;  1ZKE A;  3P50 A;  3ZMV B;  1XMO T;  3F2E A;  4IL4 A;  4U3C A;  4U74 A;  4HWI B;  5LG4 A;  5JDN A;  1SA0 E;  1V9D A;  2AE9 A;  1IAP A;  2W4X A;  4BJM A;  2WBL A;  3T1Y T;  2XNT A;  3WTI A;  3PTR B;  4KUM B;  3U3I A;  3UUN A;  2IIU A;  5BW2 A;  3PUS A;  3UQ4 A;  2Y56 A;  2XTL A;  5ABH A;  4ILU A;  3ZN1 B;  2DCF A;  4WNK A;  5HXC A;  4GK5 E;  1WCR A;  4NUV A;  2XPK A;  3RRC A;  2AXD S;  3PUW F;  4ADZ A;  4LF4 T;  5FVK A;  2N9D A;  1IJ6 A;  4AKL A;  5FMN A;  3C4W A;  2XYS A;  5L3B B;  3KVB A;  2EHO C;  3ONL C;  2V1D B;  4B5D A;  1LVF A;  4X20 E;  5C3J A;  4ZEY A;  1UCU A;  3ZT7 A;  4XHE A;  3CIR A;  2XQ7 A;  1WFD A;  5L3D B;  2XZ5 A;  3WAJ A;  4YTM A;  1D1C A;  3SS1 A;  1HF8 A;  3A7M A;  2IDO B;  2VAS A;  2CLY C;  2NW8 A;  2Y57 A;  2PG8 A;  1W0A A;  5AFH A;  2IML A;  3CQX C;  2IC9 A;  1KNP A;  4O4I E;  3E0Z A;  3F31 A;  5FY1 A;  4HN9 A;  3RI5 A;  5CO5 A;  2XQY A;  1YW0 A;  3H37 A;  3QNU A;  3OKQ A;  4I55 E;  3E22 E;  1OED E;  5LMU T;  1J5E T;  4B3S T;  5SYO A;  1G8X A;  3PUR A;  4H9Q C;  4ZI2 C;  1NWM X;  2RPA A;  2QGS A;  4IHJ E;  3EAM A;  2XAS B;  5JRC A;  2XZ6 A;  5JDL A;  1D0X A;  2LSK A;  3F57 A;  4DV1 T;  3V5U A;  4YSX A;  3WTM A;  4JUY A;  1T72 A;  2W62 A;  4AIU A;  2WSS V;  4HWD A;  1X79 A;  2MOZ A;  4TV8 E;  4AQY T;  4P0A A;  1UUS A;  4HQP A;  2WCA A;  3ZT5 A;  4LFB T;  1WLX A;  2BS3 A;  3SQ6 A;  1FIO A;  3AB3 B;  4JEH B;  2DWG A;  2ES0 A;  2CHN A;  4DV2 T;  2BJ0 A;  4AQF C;  5LXB A;  3CPZ A;  4YT0 A;  3I9Y A;  4DR4 T;  3AVS A;  4JI3 T;  3AEG A;  3H3M A;  5CJ5 A;  4ZHQ E;  4JI0 T;  2ZLY A;  3PV0 F;  3VKH A;  3EUH A;  4HWC A;  2ZJU A;  3IHR A;  2BS4 A;  4OK0 A;  3LBX A;  4H63 V;  1N36 T;  5EZY E;  1S94 A;  3LSV A;  2Y8D A;  4U7I A;  3ZC1 A;  4H9S E;  2FJD A;  1WR6 A;  4JI4 T;  1LKX A;  2E9X D;  2X67 A;  5AQN B;  1UX4 A;  3ZDG A;  1YQ4 A;  3AE1 A;  2BYR A;  2F4V T;  3PUZ F;  3WTH A;  4QX7 B;  3FB2 A;  2JMK A;  4HFC A;  1AJ3 A;  5FXX A;  4WW0 A;  3VHL A;  2IC6 A;  5JDF A;  1W9R A;  1WRD A;  3VRB A;  4QXC B;  3RIU C;  1U5P A;  3ZC0 A;  2IAK A;  4UF0 A;  2E9X B;  3ZST A;  1H7C A;  5TVC A;  2MBG A;  4HKA A;  3RHW A;  3AAA B;  4NZB A;  2K3W A;  3PU8 A;  2JRK A;  4KX6 A;  5AQG B;  4P1N A;  2KMF A;  5JQG E;  4KI0 F;  2P9B A;  5HEJ A;  2OLT A;  4FI5 A;  4ILC A;  3AXJ B;  3KV9 A;  3VU7 H;  5FY0 A;  5L4H A;  4ISS A;  4IDP A;  1B7T A;  4OYK A;  2MPK A;  2E2A A;  1BR0 A;  4I4T E;  5DJQ C;  1J1J A;  2QC1 B;  4WV9 A;  1HG5 A;  3KDS E;  2X00 D;  5AFN A;  5FP3 A;  3E08 A;  1N34 T;  1ZEE A;  5LJM A;  4UV8 B;  5JTG A;  5LG3 A;  3CQG B;  3UU3 A;  1Z0P A;  3PJA J;  5JR9 C;  2I59 A;  4TWF A;  2Y54 A;  3RIF A;  5LB7 B;  4LF5 T;  2BS2 A;  2EHO B;  2YDS A;  3WTO A;  2Y48 B;  5AFU L;  3FZF B;  5JRE A;  4XAX B;  3PJA A;  1BR2 A;  4QHO A;  4J2C A;  5ABF B;  2VKO A;  3ESL A;  2HN2 A;  2L3L A;  2PFV A;  5BP0 A;  2C9T A;  2BG9 B;  2LEH A;  2H89 A;  1KEY A;  3WTL A;  2BYP A;  3AEC A;  2BVL A;  3CX8 B;  3FZM B;  3CML A;  4YTP A;  1E7P A;  3WAK A;  2SPC A;  3UU6 A;  2WU5 A;  1UW6 A;  3CVR A;  2XJ7 A;  4C91 A;  1VCS A;  4UM1 A;  5HEU A;  2I6H A;  4IDO A;  4ZI7 E;  2BBH A;  3H3A A;  3C84 A;  3UFE A;  2KWH A;  5CA0 E;  1HNZ T;  1QUU A;  3SIO A;  2C5J A;  1KNR A;  3TLV A;  4OHF A;  4DMW A;  3TLT A;  1HNX T;  3AA1 B;  4U2Z A;  5AFK A;  4E7S A;  1NAF A;  3N5L A;  2W63 A;  5L3G B;  4ZK1 A;  3PDY A;  3RX6 A;  3QB5 A;  3AEB A;  2YU1 A;  4G2A A;  5LBM A;  1OXZ A;  3NVO A;  5BMV E;  5FNV E;  4JI1 T;  4GKK T;  4IDQ A;  2X9W A;  3KBT A;  2K48 A;  3ZPO A;  3B5M A;  4P09 A;  4TV9 E;  2HH7 A;  4OYJ A;  4AQF A;  3KFW X;  2LOS A;  3WTN A;  2Y6X A;  4AIS A;  4BA9 A;  4O8S A;  5LOV E;  4GYS A;  4KHZ F;  4PNI A;  1CHU A;  1NEN A;  1HR0 T;  2HN1 A;  2JQQ A;  1ZV4 X;  2WDR A;  5DQV A;  3LFM A;  5LHI B;  5DQW A;  1XDO A;  4H9R C;  5FXW A;  2LM2 A;  5AQJ B;  4ZS2 A;  2A3D A;  5ABG A;  4HE8 A;  4CXW A;  5HXR A;  3RKG A;  2XY8 B;  1T7S A;  2CEA A;  2Q9Q A;  3LG7 A;  2IHR 1;  2JQH A;  4H9P C;  4OFZ A;  3ANW A;  1M62 A;  2Z6E A;  2ZM8 A;  2HPJ A;  3ZCI A;  2WM9 A;  2X9X A;  4ZJT A;  3HI2 A;  4UM3 P;  4IST A;  4HGA A;  3EAB A;  3P4W A;  2YU2 A;  1NEK A;  2VKH A;  4TN7 B;  2FJE A;  4F8H A;  3ZYL A;  3RIU A;  3JC6 D;  2DL1 A;  5HYA A;  2NW9 A;  3NWI A;  4DR1 T;  5AIN A;  3CX6 B;  4IGU A;  4DND A;  3M3Z B;  4IT4 A;  3G06 A;  2XQ9 A;  3PUY F;  2UU9 T;  4EYY R;  5JDH A;  2CMR A;  3UU4 A;  2L8K A;  1MMG A;  2QYW A;  4HFE A;  2KLQ A;  4WBN E;  2XQ5 A;  3RH3 A;  1M7K A;  3FBL A;  4Q25 A;  3HKB E;  5LGU B;  1OWA A;  2FBW A;  4CN6 A;  5FJV A;  3P4R A;  3KV4 A;  2VVN A;  2IW5 B;  4KP3 C;  4EXT A;  4BFQ A;  3HKE E;  2LE8 A;  4MAL A;  4AKH A;  3J7Y q;  4ZK4 A;  4X64 T;  4QH4 A;  4HTE A;  4LML A;  3RYI E;  4YY3 T;  3MKD A;  1MIY A;  5JR9 A;  1IBK T;  1Z8U A;  1KFY A;  3Q5D A;  4X62 T;  4H9N C;  5AQV B;  3O1H A;  3TLU A;  5M4Y A;  1XNR T;  3NZP A;  5JH7 E;  2WN9 A;  3HKC E;  3AA6 B;  4NXN T;  3AVR A;  4NXM T;  3NRX A;  2X0L B;  3UFG A;  4JBW F;  4YJ2 E;  1N33 T;  4XK9 A;  4G63 A;  2C5I T;  2J62 A;  1QLB A;  4HFD A;  2BR8 A;  5KZU A;  3RRW A;  2V5C A;  3VR9 A;  4LF8 T;  4DID B;  3PUA A;  4ZZB A;  2JQ9 A;  3FZK B;  5JME A;  3GUA A;  3RYF E;  4MFR A;  4UM3 S;  5KX5 E;  5FKY A;  5F8P A;  2VUR A;  1OED C;  4ALX A;  2X9Y A;  2JJ9 A;  1DU2 A;  3ZKR A;  2M6B A;  4ZI3 D;  2BG9 E;  1XMQ T;  3MZK B;  3PE0 A;  5AQH B;  2BKO A;  3GN5 A;  3J9X 1;  4B3R T;  3ZYM A;  1SHZ C;  4ASK A;  3AED A;  4X1I E;  2RP4 A;  5JRC B;  5AQP B;  4UVB B;  1D0Y A;  2CWO A;  1IBM T;  5L4E A;  1KF6 A;  5LCY A;  2DNX A;  4YLH A;  5FYM A;  1UUR A;  3Q9D A;  3KIN B;  3AA0 B;  5A1L A;  5H6Q B;  2CA5 A;  1YQ3 A;  1JNR A;  3ZYK A;  2XM2 A;  2ZJV A;  4CI3 B;  5J5H A;  4CI2 B;  4HWF A;  3ZCJ A;  1YXR A;  2YN6 A;  4AFT A;  2XAG B;  3FZL B;  3LDQ B;  4LF6 T;  2VL8 A;  3QC9 A;  2XQ4 A;  3EDV A;  3PEO A;  4GKJ T;  4O4L E;  3HL6 A;  3NKZ A;  3RIA A;  3U8J A;  4QAC A;  2WZH A;  5J5G A;  3IF8 B;  4I43 B;  4TWD A;  3LBX B;  4DBM A;  3Q5X A;  2VKJ A;  4YFS A;  5CB4 E;  2WQY A;  2H7O A;  1YKH B;  4ZOL E;  5AQK B;  2LOP A;  4IE6 A;  1MNE A;  1VOM A;  2Q9Q C;  4QX8 B;  3C4Z A;  3U8K A;  4A97 A;  4EED A;  3RF1 A;  3ZN0 B;  2LJL A;  4PJM A;  2CWY A;  4JI2 T;  3UT5 E;  3SFD A;  5AQF B;  1YKE B;  2H7V C;  4PJL A;  4CN1 A;  4DV4 T;  4UXU A;  2YOE A;  3UUL A;  3U8N A;  2VB6 A;  1N32 T;  3T4M A;  4PFO A;  4UF0 B;  3TLS A;  5FL1 A;  3RYH E;  3ZT6 A;  3ZMS B;  4EYU A;  5EK4 A;  2XQA A;  2W0G A;  3OBV E;  3FXE B;  1HX1 B;  1XZY A;  1VCT A;  2KSR A;  3RGL A;  4QAA A;  3LK2 B;  2M6I A;  3DP7 A;  2XYT A;  3AE4 A;  4LFA T;  4PK4 A;  1U4Q A;  3I0Q A;  4UM3 A;  2E9X A;  3MJX A;  1WYC A;  2LT3 A;  2WNL A;  2A9U A;  3FBZ A;  4EZ1 A;  2LSJ A;  2CXF A;  3JAE A;  1SE7 A;  2EHO D;  3VRA A;  1FMW A;  2PGZ A;  2BYS A;  3A5X A;  2HHH T;  1GQE A;  3IBP A;  4AXP A;  5FVL A;  5BRX A;  4DR5 T;  1G73 A;  3QOF A;  1T8B A;  5HCM A;  5L3E B;  4UY2 A;  1ZP0 A;  4AFH A;  5J2T E;  3DTO A;  2L9Q A;  3QB5 K;  5AQO B;  1R8I A;  4HFH A;  2XUE A;  5C2T A;  2BKN A;  1LVK A;  3ETV A;  3N9N A;  3RPU A;  4TZ4 C;  4JI5 T;  3GWH A;  2UXN B;  3PUG A;  2H88 A;  2NP9 A;  3O1I A;  3UTK A;  2CLY B;  3UU5 A;  2V5D A;  4BQT A;  3EI0 A;  4ZI2 D;  2MAW A;  2X00 A;  4EZH A;  4EZ4 A;  1QSD A;  3ONJ A;  1OED A;  4O2A E;  2UXC T;  5J1G A;  3X1D A;  3WTK A;  4DBQ A;  1MIW A;  3O9X A;  3JCF A;  4DBR A;  4IDZ A;  1W0B A;  4D01 A;  3VKG A;  4FRR A;  2DLR A;  3QUJ A;  3ZDH A;  2V26 A;  5LGT B;  3ZMT B;  2K5B B;  1D1A A;  2D0U A;  5HEO A;  5IUX A;  4U72 A;  3WI3 A;  5HEH A;  1IBL T;  2JQK A;  4O4H E;  5AFJ A;  4LMJ A;  4LF7 T;  2WY2 A;  4A56 A;  2WNJ A;  2D2S A;  4IL9 A;  3ZJ1 A;  3PUV F;  3O1J A;  1IJ5 A;  3KBU A;  3DJB A;  5ADX L;  3EHZ A;  4F6R C;  4DV3 T;  2NW7 A;  4YHH T;  2UUB T;  4ZI3 C;  4UEL A;  1ZOY A;  1E2A A;  3Q2M A;  4PJN A;  4L0R A;  3C79 A;  2CXL A;  4DUY T;  3EVY A;  2R6G F;  4AKG A;  2GK9 A;  4QKN A;  3C64 A;  4N78 D;  4JEU B;  2XNU A;  4CI1 B;  2Y58 A;  2NTX A;  1S35 A;  1HNW T;  2G0U A;  2WWU A;  5ABE A;  2XSA A;  4BJN A;  2N2N A;  3R84 B;  3KV5 A;  1FMV A;  3TLW A;  2WWV A;  2E8I A;  2WU2 A;  4EOZ B;  4AKR B;  2N1G A;  2BKP A;  3ANW B;  2B1E A;  3SWH A;  3I9W A;  4DV7 T;  2LSY A;  4M1P A;  4NUU A;  2OA5 A;  3GMI A;  3L09 A;  5HEG A;  5GON E;  5HAX A;  4JI8 T;  3C51 A;  3NBX X;  2X51 A;  3LJC A;  5AFM A;  4JV5 T;  2VK9 A;  5LYJ E;  2ACZ A;  3SRZ A;  2C0S A;  2PTF A;  4IIJ E;  4WZX A;  1HTJ F;  3BQK A;  1YD8 G;  3NZQ A;  3AE3 A;  2VQF T;  4NIQ A;  1LRZ A;  3IGQ A;  3B57 A;  4I0U A;  2UZ6 A;  2W2U A;  5J0Z A;  3BK9 A;  4LMK A;  2WMN A;  5FXZ A;  5HCJ A;  5F5W A;  5LA6 E;  2E9X C;  1Y64 B;  4TNW A;  4JYA T;  2UUA T;  2V6Y A;  5CFB A;  4A98 A;  2E5L T;  4QWN B;  1W09 A;  1FJG T;  3PMZ A;  2WB5 A;  3WIP A;  2XQ6 A;  2XNV A;  1J5W A;  1T98 A;  5C8Y E;  5J5F A;  4X1K E;  5CGM A;  4ZR6 A;  5EK2 A;  4EAH A;  4DV5 T;  3K3O A;  4YHJ A;  4UVC B;  5FY7 A;  4YJ3 E;  2LHR A;  3EDU A;  5JR9 B;  2D5U A;  2UXX B;  2LHN A;  2BVM A;  2XAH B;  4DR7 T;  3C4X A;  4X5T A;  5L47 A;  2YMD A;  1KK7 A;  2V7L A;  2UXB T;  4HFB A;  3N2G E;  4CXX A;  4LF9 T;  2V6X A;  4O4J E;  2D9D A;  2LRK A;  2LLY A;  2BYQ A;  4EB6 E;  5AQI B;  3ONX A;  2V7K A;  3T1H T;  5L2L A;  4Z8X A;  3B13 A;  3AE7 A;  3SH1 A;  4KMC A;  4YSY A;  3PUX F;  4TX5 A;  1UV6 A;  2E5V A;  4I50 E;  1MMD A;  5AQS B;  5HXE A;  5IYZ E;  1XNQ T;  2WDQ A;  3PU3 A;  2LRL A;  1L0V A;  3N9Q A;  1I94 T;  2BG9 C;  4X1Y E;  3L39 A;  4X66 T;  3P4S A;  1MIV A;  5BR8 T;  3ZMZ B;  2W66 A;  2W8G A;  4QH1 A;  4EGW A;  2VKD A;  2KIN B;  2M67 A;  3FXD B;  4PJJ A;  4YSZ A;  3A8Y C;  2XZE A;  3KV6 A;  5LHH B;  3AAE B;  3GN5 B;  3HKD E;  4C90 A;  4UR9 A;  5LGN B;  2X9H A;  3S4U A;  3ETU A;  2UXD T;  2KND A;  4UXN B;  2ZM2 A;  2DWK A;  5ETW A;  2W8F A;  2J4G A;  4GIW A;  5J5I A;  2X0H A;  3M65 A;  3N9L A;  4U2Y A;  5TAO A;  4ZRU A;  2DI4 A;  3GA8 A;  2JIW A;  2D0T A;  2HPL A;  4L9I A;  3BQL A;  1HCI A;  2XAF B;  2W00 A;  3N9P A;  4DR2 T;  2BYN A;  5AQL B;  5KDM C;  4HWH A;  5LNK A;  4CXY A;  4UV9 B;  1HG2 A;  2MTQ A;  3L3P A;  3N9O A;  3OYZ A;  2VVS A;  4EIW A;  2XSB A;  2V7M A;  4JLE A;  4DUZ T;  2Y7Y A;  2X0Y A;  3AE5 A;  4U31 A;  4MLK A;  4Z91 A;  3SOL A;  2VWA A;  4V1A v;  2YEV C;  5JDG A;  4NPP A;  3P7I A;  5IHY A;  1E1H B;  4KHP T;  3Q5E A;  5HXS A;  2WAU A;  2W67 A;  4FJO A;  3U8M A;  1BR4 A;  2VL0 A;  3U8L A;  1BR1 A;  3MXZ A;  3UU8 A;  4XBF B;  2YIN A;  3ZJ2 A;  4EEB A;  1ZHC A;  5KMG P;  1HFA A;  2X68 A;  4UIG A;  5HWY A;  5AFL A;  2NTY A;  4UVA B;  3P4Q A;  2NOX A;  4AKI A;  2WP9 A;  3W15 B;  5JDQ A;  2LKG A;  1WR0 A;  4ILA A;  5L3C B;  3IA3 A;  4PFP A;  4A5X A;  1XWM A;  4OX9 T;  4EV6 A;  3AA7 B;  1I9B A; 
#chains in the Genus database with same CATH homology
 4UM3 A;  3P4W A;  2BYN A;  2Y57 A;  4XK9 A;  2BR7 A;  3SQ9 A;  4X5T A;  3LSV A;  5L47 A;  2X00 D;  5AFH A;  2WNL A;  5AFN A;  2WNC A;  4ZK1 A;  4F8H A;  4HFD A;  2YMD A;  3WTK A;  2YN6 A;  3UUB A;  4AFT A;  2BR8 A;  5LG3 A;  5KZU A;  4EZ1 A;  2XQ4 A;  4QH5 A;  3UU3 A;  3PEO A;  3JAE A;  5AIN A;  4HFB A;  4TWH A;  2BG9 A;  3RIA A;  3U8J A;  4QAC A;  4Z90 A;  1OED B;  4TWF A;  3RI5 A;  5CO5 A;  5J5G A;  4ZZB A;  2WZY A;  2Y54 A;  2YKS A;  4D01 A;  4TWD A;  3RIF A;  3P50 A;  4DBM A;  5JME A;  4FRR A;  2LKH A;  5HEG A;  4IL4 A;  3GUA A;  2XQ9 A;  2LLY A;  2PGZ A;  2Y7Y A;  2BYQ A;  2BYS A;  3WTO A;  3ZDG A;  2BYR A;  3ZDH A;  5KE4 A;  4UM3 S;  1OED E;  4Z91 A;  3WTH A;  3UU4 A;  5SYO A;  2XQ3 A;  4HFE A;  1OED C;  4HFC A;  5AFM A;  2XQ5 A;  4ILB A;  4ALX A;  5BRX A;  3SH1 A;  3EAM A;  4NPP A;  5BP0 A;  2XNT A;  2C9T A;  5HEO A;  2BG9 B;  4COF A;  3WTI A;  2XZ6 A;  3WTN A;  5IUX A;  3ZKR A;  3JAF A;  5HEH A;  3WTL A;  5BW2 A;  3UQ4 A;  1UV6 A;  2M6B A;  3JAD A;  5HCM A;  2BYP A;  2Y56 A;  5FJV A;  4UY2 A;  3U8K A;  4AFH A;  4A97 A;  5AFJ A;  2BG9 E;  2PH9 A;  3WTM A;  4LMJ A;  2WNJ A;  3U8M A;  2VL0 A;  1UW6 A;  3UU6 A;  3U8L A;  4IL9 A;  2BG9 C;  4HFH A;  5TVC A;  4BFQ A;  3RHW A;  4NZB A;  5AFM B;  2XQ8 A;  3RQW A;  3UU8 A;  4IRE A;  3EHZ A;  3IGQ A;  4UM1 A;  2UZ6 A;  4ZJS A;  4HQP A;  4UXU A;  5J0Z A;  4ZK4 A;  2YOE A;  2XYS A;  4QH4 A;  5HEU A;  4LMK A;  2W8G A;  5HCJ A;  4QH1 A;  2LM2 A;  3SQ6 A;  4LML A;  3U8N A;  4TNW A;  2YME A;  3T4M A;  3TLS A;  5HEJ A;  4AFG A;  2BJ0 A;  5CFB A;  4ILC A;  5LXB A;  4B5D A;  4A98 A;  3WTJ A;  5L4E A;  3C84 A;  3C79 A;  4QAB A;  5AFL A;  3RQU A;  5L4H A;  3PMZ A;  2W8F A;  4XHE A;  2XQ7 A;  2XQA A;  3WIP A;  5J5I A;  2XQ6 A;  3UU5 A;  2XNV A;  2XNU A;  2XZ5 A;  2Y58 A;  4BQT A;  4HFI A;  3EI0 A;  2MAW A;  1UX2 A;  2LKG A;  4ILA A;  3UQ7 A;  4PIR A;  4ZRU A;  2X00 A;  3SIO A;  2KSR A;  3TLU A;  3TLV A;  4QAA A;  5J5F A;  3TLT A;  4ZR6 A;  4ZZC A;  4ZJT A;  4UM3 P;  2ZJU A;  2M6I A;  1OED A;  4TNV A;  2WN9 A;  2ZJV A;  5AFK A;  5J5H A;  2XYT A;  2QC1 B;  1I9B A;  4WV9 A;  3TLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...