3TLSA

The glic pentameric ligand-gated ion channel e19'p mutant in a locally-closed conformation (lc2 subtype)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVPTNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
molecule tags Membrane protein, transport protein
source organism Gloeobacter violaceus
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
total genus 91
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlsA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlsA01
3UQ4A 3ZDHA 4UM3A 3WIPA 4ZK4A 5L47A 2BG9E 3WTJA 5AINA 2W8GA 3WTIA 2KSRA 5L4EA 4AFHA 4TWHA 3RHWA 4XHEA 1I9BA 2XNTA 2BG9C 3UU8A 3WTHA 3C79A 5KZUA 2XQ5A 3UU6A 2XZ6A 4BFQA 2X00A 3U8LA 3SIOA 2XQAA 4EZ1A 4TNWA 3RQUA 4B5DA 3P50A 4HQPA 4A97A 5J0ZA 2YOEA 5JMEA 3UU4A 2XQ8A 4WV9A 4UM3S 3U8KA 2XYSA 5BP0A 4QH4A 4QH5A 2BYQA 4D01A 4Z91A 3PMZA 3LSVA 4ZK1A 3ZDGA 4UY2A 2XNUA 3GUAA 2PGZA 4ILCA 5CO5A 2LM2A 1UW6A 4ZR6A 2BR8A 5HCJA 2WZYA 4ILBA 2MAWA 2ZJVA 2LLYA 2XQ6A 2BR7A 3TLSA 3EI0A 1OEDA 5J5GA 4ZZCA 3JAFA 3T4MA 5J5FA 4ZJSA 4LMJA 3U8MA 3EAMA 5LG3A 4UM1A 4TNVA 3EHZA 4TWFA 3RIFA 3UU5A 2Y7YA 5LXBA 4ZRUA 5J5IA 4HFCA 4IREA 2XQ4A 2LKGA 4Z90A 2C9TA 2YN6A 2PH9A 4AFGA 4HFDA 3TLTA 3RIAA 1UV6A 3U8NA 1OEDC 3TLUA 5AFMA 4X5TA 2WNCA 1OEDE 2LKHA 2XQ9A 4ZJTA 5TVCA 4IL4A 4UM3P 3U8JA 2VL0A 5AFJA 2XQ3A 2BYRA 4QAAA 3WTOA 4A98A 5SYOA 3RQWA 5FJVA 3SH1A 2X00D 4ILAA 5HEUA 4HFHA 2XYTA 3P4WA 4DBMA 4LMLA 2Y54A 5HEHA 3TLWA 2QC1B 3UU3A 5IUXA 3WTMA 2ZJUA 3UUBA 3WTKA 2Y58A 5AFMB 5AFHA 2W8FA 5HEJA 5HCMA 2XQ7A 4FRRA 3WTNA 3JAEA 4QH1A 5L4HA 5J5HA 3JADA 4HFBA 2Y57A 4QABA 4NZBA 2YKSA 4ZZBA 2WN9A 3ZKRA 3TLVA 4COFA 2BYSA 2WNLA 4QACA 3SQ6A 2M6IA 2BJ0A 4HFIA 3SQ9A 1OEDB 5HEOA 2UZ6A 4XK9A 5AFNA 5AFKA 2BG9A 3PEOA 2M6BA 4TWDA 3RI5A 2BYPA 4NPPA 4ALXA 2Y56A 4UXUA 4AFTA 4F8HA 2XNVA 3C84A 5AFLA 2WNJA 4PIRA 4HFEA 2BG9B 5CFBA 4IL9A 5KE4A 5BW2A 3UQ7A 4LMKA 2YMDA 5BRXA 2BYNA 1UX2A 4BQTA 2YMEA 3WTLA 2XZ5A 5HEGA 3IGQA
chains in the Genus database with same CATH superfamily
5DABA 3OYXA 3RPUA 1V9DA 3QB5K 5L47A 2WU5A 5DJQC 1FEWA 3EABA 4I55E 3O4XE 2XNTA 5IYZE 4DR7T 4ZS2A 1YKHB 4PJLA 1XMOT 4H9QC 4TNWA 2FJBA 3J7Yq 5J0ZA 4HQPA 2BZBA 2BYQA 5JQGE 2XSBA 3ZC0A 2JQHA 3PUZF 5ABFB 2KNDA 3KVBA 2JQ9A 4PNIA 2LOPA 2Z6EA 1UX5A 3HR0A 3Q5EA 4CXXA 2XY8B 4ZJSA 5FY7A 2NOXA 2LSJA 3AEBA 3TLTA 5AFMA 2VKJA 4DR4T 4X20E 2N2NA 5FXVA 4QAAA 4IT4A 2X0YA 1W0BA 4TZ4C 4HFHA 4H63V 2XAQB 4U74A 3UU3A 5J1GA 5AFMB 2A72A 2RA1A 1SHZC 4GKJT 3ETVA 1T8BA 3ZKRA 4X62T 3GN5B 2HHHT 2BKNA 2K24A 4IGUA 3AE4A 2BG9A 2KLQA 3F57A 2XAHB 2WWVA 4P0AA 3N9MA 5ABEA 2ODUA 3CK6A 2YEVC 4F6RC 3KV9A 4I4TE 4NIQA 3I0OA 5BRXA 1VCTA 3AEGA 2ACZA 3RYHE 4DR6T 3Q5DA 3QOFA 1HNXT 2BS2A 2E9XB 2XUEA 4DV0T 2L8KA 4CXWA 3RRCA 5LG4A 2EHOC 5J2TE 4HWDA 5C3JA 4AQFA 2X9WA 2Q9QB 2XZ6A 3RX6A 4B3ST 2E5VA 2WQYA 2IDOB 2XQAA 4JI8T 3SWHA 2ODVA 2WWUA 4U7YA 3LBXA 5HXSA 5AQUB 4Z91A 1EZ3A 4A5XA 1Z8UA 3RIUA 3PUAA 3QUJA 2VWAA 5LYJE 4YFSA 3P4RA 3ABVA 5FY0A 2C5JA 4YSYA 5FL1A 1HNZT 3N9NA 1S35A 1OEDC 5LNKA 1HR0T 3CQGB 4UM3P 1FIOA 3T1HT 3ZT7A 3B57A 4FI5A 4XAXB 4ZI3D 5M4YA 1T72A 2Y54A 3KV5A 3WTMA 2NTYA 3WTKA 2Y58A 3FHNA 1ZHCA 4DNDA 2XM2A 5AQKB 4COFA 5L3EB 2OV9A 1I94T 2CWYA 2W61A 3QK6A 3AE8A 4H9PC 3FZFB 1NWMX 2D0UA 2OLTA 4A56A 4YSZA 2ZMAA 2BYNA 1MIWA 3VU7H 3WTJA 2V7IA 5LGTB 5AQIB 3WTIA 4CI2B 2LHRA 4EAHA 2KWIB 4WBNE 1I9BA 2X0HA 4IIJE 3WTHA 3H3MA 4IDNA 2E2AA 5EK3A 4BFQA 3U8LA 3SIOA 2WY2A 3RRWA 2VASA 2WM9A 3LDQB 4JI7T 2KWHA 3JCFA 5TAOA 3ZJ1A 4HN9A 3QB5A 1XMQT 3HKCE 1HFAA 1MMNA 4DR2T 1D1AA 2DHRA 2VKHA 3EAMA 2E9XA 4UM1A 2WDQA 5KMGP 3LFMA 4X5TA 3MACA 4L0RA 2HN1A 4UF0A 4LF6T 1KNPA 2V1DB 5LGUB 3P4QA 4IE6A 1NENA 4LMLA 3TLWA 5J5HA 5CGMA 4DUYT 4NZBA 2YKSA 4IE4A 2UUAT 4ZI2D 2WNLA 2J4GA 2L9QA 5HEOA 4ILUA 2UZ6A 3PEOA 3RI5A 2Y8DA 2YDSA 2SPCA 2EHOD 2LE8A 2UXBT 5A1LA 1NAFA 4QKNA 5ABGA 3K1SA 2I0MA 3AA7B 4TX5A 1UX4A 2XZ5A 3LK3B 2X9YA 2E9XC 2MYSA 2UXXB 4AI6A 4HEAA 2NP9A 4YTMA 4UF0B 3UU8A 1YKEB 4ERRA 4OK0A 4DIDB 1B7TA 1O3XA 3PE0A 4YTNA 1AJ3A 2YOEA 2LSYA 2CHOA 3CX7B 2PBIA 3OJAA 4LFAT 4UY2A 5JH7E 1LKXA 3AE7A 3ZMZB 2Q9QD 1D1BA 5EK4A 4JEHB 3ANWB 2W66A 5C8YE 3ZPOA 2QA7A 4JI0T 2PH9A 1US7B 2F4VT 1Y64B 5HYAA 3TLUA 1WR0A 2FBWA 3RYFE 5CA0E 2Y6XA 4UVBB 4L9IA 4UIGA 5JDHA 3C64A 1MMDA 4IDOA 1XDOA 3I1AA 3P4PA 2DI4A 3ZJ2A 4PFPA 4BA9A 1E2AA 4EEBA 2VL8A 3N5LA 4KX6A 2EHOB 4KI0F 2G0UA 1BR1A 1IBKT 4CN1A 2ZLYA 4B3TT 3UQ7A 2YMDA 5JREA 5BMVE 3WTLA 2XAJB 3IBPA 2FJAA 2DNXA 4YXDA 4QXHB 3TKLB 1WCRA 2RPAA 2B76A 4KBMB 4O4LE 5CA1E 4UM3S 3U8KA 3BQLA 2DWGA 3ZDGA 4JV5T 4UV9B 2XNUA 5C2TA 2WU2A 3ZSSA 2WMNA 4K0UA 1I6ZA 4MALA 2IC9A 4ZS3A 3C98B 2I59A 3CWZB 4HFCA 4Z90A 4AFGA 3AE3A 3K3OA 1OEDE 2YU1A 5TVCA 2D0TA 3RQWA 5L3DB 3FXEB 5LBQB 3BK9A 4GYSA 3H3AA 3KBTA 2LSGA 3JAEA 2LSKA 2CMRA 5EK2A 2MOZA 5IHYA 5KXJA 4QX7B 3WI3A 4WZXA 2CRBA 1MIVA 3AA6B 3SQ9A 2VQFT 4MLKA 3ZN0B 5AFNA 4PFOA 4ALXA 4ZHQE 1KFYA 2J1DG 5FY1A 2JQQA 2XQYA 3M65A 1CHUA 4ANJA 2YK0A 2HPJA 5AQFB 4LF7T 4UM3A 2M67A 4P0BA 1L0VA 2PFVA 4AISA 3Q2MA 4XHEA 4KMCA 1FMWA 3DJBA 2XAGB 5FNVE 4CZZB 4HWIB 3ZT5A 3T8OA 4B6XA 5IWAT 4WV9A 5BP0A 4QH4A 3PUQA 1SA0E 3GUAA 2V6XA 3NZPA 2VQET 3ZN1B 2BR8A 3JC6D 2XQ6A 1BR0A 3EI0A 5HXRA 3U8MA 4X1YE 4UR9A 3LJCA 5JR9A 3Q9DA 4ZRUA 1QLBA 4HTEA 3LK42 1OWAA 4NXMT 3C50A 4AQGA 3AA0B 5SYOA 1XNRT 1Z0PA 4OX9T 1KNRA 4QXCB 5FYMA 2WB5A 1XDPA 4HFBA 3A5XA 4ZZBA 2BKOA 4EGWA 4IE7A 1W0AA 2WDRA 3UUMA 4YTPA 1T7SA 2M6IA 4JI1T 1KNZA 2K48A 4H9RC 4I0UA 3RYIE 2E5LT 2WNJA 5FXXA 3PUGA 4U72A 5HAXA 4H63H 2NW9A 2X68A 3ZDHA 2NTXA 2W0GA 3UFEA 3AEEA 4UEMA 3HL6A 4X66T 4AFHA 3K3QC 4ZI7E 1JNZA 3C4ZA 4DUZT 4AKHA 3O9XA 3N2GE 1IZNB 3IHRA 2CPTA 2JMHA 3AE9A 3RKGA 4QH5A 3PV0F 5LMNT 4ZEYA 2MAWA 3SS1A 4CN4A 2UXNB 2DWKA 4FJOA 4GIWA 3RF1A 5J5FA 4ZI3C 4PJJA 3X1DA 3RKOA 2Y7YA 3AAAB 3AAEB 2LKGA 3PJAJ 5HXCA 2VL0A 3OPCA 2LM9A 4U7IA 4DVDA 3ONXA 3F31A 2IHR1 4JI3T 2D9DA 2XM1A 3GA8A 3WTNA 1QSDA 2ES0A 3T1YT 4JUYA 1KF6A 4O4JE 2BYSA 3L3PA 3PTRB 3SQ6A 2BJ0A 1X9BA 2ZM6T 5HWXA 5AFKA 4UV8B 3AA1B 2Y56A 1OXZA 1YXRA 1DU2A 4HFEA 5KE4A 2CM0A 3L09A 4YSXA 4PK6A 3ZCJA 5LA6E 2BG9E 3OKQA 3DTOA 4U2ZA 4LFBT 3EDVA 1NEKA 2E8IA 3O1IA 4DMWA 2W62A 5JMEA 2K5BB 4X1IE 3EDUA 4BJNA 4PW8A 3PJAA 4B3RT 5CB4E 3R84B 1UW6A 1HX1B 4B3MT 5HCJA 2ZJVA 3ONJA 2D5UA 4HFVA 5LB7B 5JDNA 5LOVE 1Y01A 2PG8A 4P1NA 5AQVB 3U8NA 3UUXB 2UXDT 3M3ZB 5HWYA 4IL4A 3ZMUB 2IMLA 3I9YA 4DBMA 2X9XA 5HEHA 4U3CA 4YLHA 1S94A 2BBJA 1WFDA 3E22E 5ABFA 3JADA 2Y57A 4GYRA 3AE5A 4E7SA 4IHJE 2WN9A 3GMIA 3PU3A 4JLEA 2Q9QC 2N1GA 3PUYF 5HXEA 2R6GF 3MXZA 2A3DA 5AQGB 2JMKA 3N9LA 2VURA 1E7PA 4DV1T 3UT5E 2XHEB 4IDQA 4EZHA 2KT9A 4HWCA 2A9UA 4WNKA 4BQTA 1XWMA 2YDQA 2W00A 2W63A 4U31A 4ZK4A 4CI1B 1KK7A 3EUHA 3FXDB 3NRYA 1BR4A 5JRCB 3RQUA 4QHOA 1WRDA 1WYCA 4YHHT 4D01A 1VCSA 2XJ7A 5L3GB 3AE2A 3WAKA 3ZLIA 2LRLA 3ZCIA 3PUWF 2WS3A 2WAUA 3T4MA 3F2EA 4NXNT 2VKDA 3WAJA 4XZCA 2X9HA 2PTFA 2WNCA 5LJNA 3CX6B 2XQ3A 2BYRA 3WTOA 3CVRA 2XYTA 1M7KA 3V5SA 3LK2B 5L4HA 5FKYA 3P7IA 1HG2A 2CWOA 4KHPT 5LMUT 3ZMVB 1HS7A 3ZYKA 2IUBA 2YDRA 4HWFA 3IEEA 4QXBB 1E1HB 4LF4T 3KV4A 2JRKA 4JI4T 3HI2A 3FZMB 3S4UA 3ZSTA 2X67A 2K9AA 1UX2A 2IIUA 4H9NC 4ASKA 4J2CA 3WIPA 2XZEA 1UUSA 4Q25A 3PUVF 2Q9QA 1T98A 2X0LB 2AXDS 4JBWF 5FXWA 2XQ5A 4ISSA 1HF8A 2X00A 4EZ1A 4KUMB 4C91A 1MMAA 2V7MA 3LSVA 4G63A 3MJXA 4ILBA 4H9SE 5KDMC 1GQEA 3CMLA 5AQPB 3AAIA 3BQKA 3RIFA 3CQXC 4JYAT 5J5IA 2C9TA 3P8CD 1UV6A 5AQRB 1HX8A 4CXYA 5F5WA 4U2YA 5JTGA 1MMGA 3ETUA 4EYYR 2XQ9A 2CE7A 2DLRA 2NWBA 2UU9T 5E0OA 3VKHA 1WYBA 4A98A 4ILAA 5HEUA 3FBZA 1N34T 4LFCT 1N32T 3G06A 2C0SA 3D0TA 3N9OA 5LP6E 2JQKA 5LGNB 4LF9T 2W8FA 3PURA 4QABA 3E08A 2LSIA 1JNRA 3C4XA 2KINB 4EOZB 2VVNA 3ESLA 2WBLA 4GKKT 4YHJA 4AFTA 2FJDA 1IBMT 3NKZA 4CI3B 3SFEA 2V7KA 2V5CA 2C5KT 2V6YA 2VKOA 4DV6T 4O2BE 4EYUA 2NW7A 4V1Av 2ZM8A 2LM2A 2OA5A 4GK0E 5AQSB 2W8GA 3RYCE 3FZLB 1X79A 3N2KE 3I9WA 4DO0A 4TWHA 2HN2A 5BR8T 3AEAA 3LG7A 2IC6A 2W67A 3HKEE 4DR3T 5LHHB 4DV7T 4TV8E 4ZI2C 3P50A 4DBQA 3CIRA 2VVSA 4ADZA 4MFRA 3VRBA 2HH7A 3NWIA 4X64T 2V6YB 2ZM0A 2CHNA 2LJLA 5L3BB 2QRXA 2LEHA 2X66A 2E9XD 4IDPA 4ZXLA 5JR9C 4ZJTA 1IAPA 4PK5A 5LHGB 3O1JA 1D0XA 3ANWA 5FJVA 2H3RA 2QC1B 2DCFA 3VR9A 3RIUC 5IUXA 3UUBA 1D0YA 3OBVE 3PUSA 4EZ4A 3AVSA 3SRZA 5AQNB 3TLVA 2BBHA 4AKIA 4XK9A 3NVOA 5LBMA 4TWDA 1SUMB 2H89A 2NW8A 2CBIA 4K0KT 5AFLA 4IDZA 3AXJB 2BG9B 3KINB 3B13A 4DR1T 5CFBA 3VRAA 1WR6A 2BS4A 2UUBT 1J1JA 5LHIB 5AINA 5LJMA 1IBLT 3DP7A 2I6HA 2H88A 5GONE 5KZUA 4DBRA 3RC3A 5F8PA 3OTOT 3RC8A 3J9X1 4A97A 3VR8A 1UK5A 2CBJA 2XQ8A 3PMZA 3ZEFB 4ZK1A 5KX5E 4JI2T 4BJMA 4ZR6A 1J5WA 1ZOYA 1HNWT 4O8SA 1H7CA 3TLSA 2BR7A 1OEDA 1MNDA 1YW0A 5H6QB 3L8RA 5FP3A 4EEDA 2MTQA 5ADXL 2UUCT 1LVFA 1N36T 3FB2A 5JDQA 5F3JA 2Y48B 3AE1A 2QYWA 3SH1A 4EB6E 3ZT6A 3AECA 1UGOA 1BR2A 3NZQA 4N78D 3HA4A 2MBGA 5JDMA 1D1CA 1UURA 3NBXX 4QACA 2XPKA 3P4SA 3ZMSB 3ZMTB 3A7MA 2M6BA 3B5MA 4UXUA 3C84A 5L2LA 2V7JA 3EVYA 4U33A 2ACXA 4AKGA 4IL9A 1LRZA 3N9PA 3CPZA 3PU8A 1ZEEA 1VOMA 5DQVA 2YMEA 5HEGA 3UQ4A 3W15B 1HG5A 2XAFB 4QWNB 2IAKA 2V7LA 5L4EA 4QX8B 4TUYE 5ABHA 3ZYMA 2WMOA 1MNEA 4O2AE 4TN7B 2B1EA 4B5DA 1R8IA 5L3FB 3E0ZA 3PUXF 1G8XA 4X65T 4UELA 2UXCT 2PGZA 2L3LA 4E7ZA 3PDYA 4AQFC 5H6RB 4HGAA 5DQWA 4EXTA 3HKBE 4LMJA 2CA5A 3R6NA 1IJ5A 4OYKA 4TWFA 2BVMA 5LXBA 4AXPA 3KV6A 4AIUA 3RIAA 5AFUL 4JEUB 2CXLA 1M62A 4CN6A 3KVAA 5FXZA 5FVKA 2MPKA 1D0ZA 5AQJB 3AVRA 3N2OA 3OYZA 2QVAA 3FBLA 3P4WA 3K8PC 3UULA 2W4XA 5AFHA 2XQ7A 1CUNA 3L39A 4CQIA 3MKDA 4KHZF 2FUPA 5AQHB 4HFIA 4DV2T 4DR5T 2DL1A 2XNVA 4UXNB 2FJEA 1IJ6A 4PIRA 1U5PA 2WDVA 3RH3A 4HWHA 2WSSV 4AKRB 2V5DA 2BKPA 5JDGA 3AXJA 3CQCB 2A2FX 1J5ET 1HTJF 4HE8A 4I43B 1G73A 2V26A 5CJ5A 4WW0A 3BQIA 3GN5A 3AE6A 2NR4A 2IW5B 4UVCB 3U78A 4ILCA 5CO5A 1HCIA 4I50E 2W2UA 2PJQA 3VKGA 1U4QA 2LLYA 1YQ3A 2D2SA 4ZZCA 3FZHB 4PAGA 4NUUA 3QNUA 1SE7A 4JI6T 4JI5T 4BAYB 5AQMB 4DV4T 4P09A 3VHLA 2J62A 5EZYE 3Q5WA 4LF5T 4PJMA 3U8JA 2C5IT 4OHFA 2RP4A 5FL0A 2WP9A 2BVLA 3ONLC 5AQQB 4DV5T 2ZM2A 2YINA 5HCMA 2BDEA 3LBXB 4QH1A 1LVKA 4YY3T 2P9BA 2HPLA 3I0QA 5AQOB 4DV3T 3V5UA 5ETWA 4Z8XA 4NPPA 3SFDA 4PK4A 2QGSA 5LCYA 2KMFA 2WZHA 3ZYLA 4C90A 4H9OC 4IE5A 4LMKA 2GK9A 2LOSA 4GK5E 4GOUA 4LF8T 2XASB 2KSRA 3UU6A 4PJNA 2N9DA 4O4IE 5L3CB 1QUUA 5J2UE 1MIYA 3AB3B 3NRXA 4EV6A 2WZYA 3AEFA 3JAFA 3JC6C 4L5GA 4ISTA 5LG3A 3IF8B 5FMNA 4OFZA 4IREA 2XQ4A 4ZOLE 4DMVA 2CXFA 3GWHA 2AE9A 5JDLA 3A8YC 4MHCA 1ZP0A 2H7OA 2X00D 4O4HE 2VK9A 3KDSE 2JPFA 2JIWA 3H37A 3RGLA 4G2AA 4KP3C 2VB6A 2JJ9A 5HEJA 4FRRA 2CLYB 4X1KE 3UUNA 5AQLB 5HXHA 1ZV4X 4HKAA 1FMVA 2BS3A 3SOLA 1W9RA 2BYPA 2EHOA 2J47A 4F8HA 2X51A 3UFGA 3MZKB 4NUVA 4TV9E 3MA9A 3MK7C 4M1PA 2CLYC 4UVAB 2LT3A 1UCUA 2KXPB 2WCAA 3HKDE 5JRCA 5FVLA 4AQYT 3RHWA 2YU2A 5JVDE 2BG9C 3C79A 1XNQT 3UU4A 2XYSA 2XTLA 4MBQA 1XZYA 5AQTB 3CKDA 1W09A 3C51A 2CEAA 2LHNA 3K3NA 4OYJA 3CX8B 5J5GA 3C4WA 1FJGT 1ZKEA 2V8SV 4TNVA 2K3WA 3EHZA 3UU5A 2CCQA 3N9QA 2YN6A 4HFDA 1WLXA 4YJ2E 2KZ7B 3QC9A 5JR9B 2LKHA 1YQ4A 4WYVA 4YJ3E 5AFJA 3RLFF 3ZC1A 2H7VC 4IE0A 4WBOA 4XBFB 2LRKA 2ZJUA 4AKLA 2WZIA 5JDFA 3O1HA 1YD8G 3IA3A 1N33T 4EIWA 1VRBA 2CXDA 3UTKA 1OEDB 3Q5XA 3KBUA 5LXTE 2XSAA 3AEDA 3FZKB 3U3IA 3KFWX 5BW2A 3OVUA 1KEYA 4YT0A 3IGQA
chains in the Genus database with same CATH topology
3UQ4A 3ZDHA 4UM3A 3WIPA 4ZK4A 5L47A 2BG9E 3WTJA 5AINA 2W8GA 3WTIA 2KSRA 5L4EA 4AFHA 4TWHA 3RHWA 4XHEA 1I9BA 2XNTA 2BG9C 3UU8A 3WTHA 3C79A 5KZUA 2XQ5A 3UU6A 2XZ6A 4BFQA 2X00A 3U8LA 3SIOA 2XQAA 4EZ1A 4TNWA 3RQUA 4B5DA 3P50A 4HQPA 4A97A 5J0ZA 2YOEA 5JMEA 3UU4A 2XQ8A 4WV9A 4UM3S 3U8KA 2XYSA 5BP0A 4QH4A 4QH5A 2BYQA 4D01A 4Z91A 3PMZA 3LSVA 4ZK1A 3ZDGA 4UY2A 2XNUA 3GUAA 2PGZA 4ILCA 5CO5A 2LM2A 1UW6A 4ZR6A 2BR8A 5HCJA 2WZYA 4ILBA 2MAWA 2ZJVA 2LLYA 2XQ6A 2BR7A 3TLSA 3EI0A 1OEDA 5J5GA 4ZZCA 3JAFA 3T4MA 5J5FA 4ZJSA 4LMJA 3U8MA 3EAMA 5LG3A 4UM1A 4TNVA 3EHZA 4TWFA 3RIFA 3UU5A 2Y7YA 5LXBA 4ZRUA 5J5IA 4HFCA 4IREA 2XQ4A 2LKGA 4Z90A 2C9TA 2YN6A 2PH9A 4AFGA 4HFDA 3TLTA 3RIAA 1UV6A 3U8NA 1OEDC 3TLUA 5AFMA 4X5TA 2WNCA 1OEDE 2LKHA 2XQ9A 4ZJTA 5TVCA 4IL4A 4UM3P 3U8JA 2VL0A 5AFJA 2XQ3A 2BYRA 4QAAA 3WTOA 4A98A 5SYOA 3RQWA 5FJVA 3SH1A 2X00D 4ILAA 5HEUA 4HFHA 2XYTA 3P4WA 4DBMA 4LMLA 2Y54A 5HEHA 3TLWA 2QC1B 3UU3A 5IUXA 3WTMA 2ZJUA 3UUBA 3WTKA 2Y58A 5AFMB 5AFHA 2W8FA 5HEJA 5HCMA 2XQ7A 4FRRA 3WTNA 3JAEA 4QH1A 5L4HA 5J5HA 3JADA 4HFBA 2Y57A 4QABA 4NZBA 2YKSA 4ZZBA 2WN9A 3ZKRA 3TLVA 4COFA 2BYSA 2WNLA 4QACA 3SQ6A 2M6IA 2BJ0A 4HFIA 3SQ9A 1OEDB 5HEOA 2UZ6A 4XK9A 5AFNA 5AFKA 2BG9A 3PEOA 2M6BA 4TWDA 3RI5A 2BYPA 4NPPA 4ALXA 2Y56A 4UXUA 4AFTA 4F8HA 2XNVA 3C84A 5AFLA 2WNJA 4PIRA 4HFEA 2BG9B 5CFBA 4IL9A 5KE4A 5BW2A 3UQ7A 4LMKA 2YMDA 5BRXA 2BYNA 1UX2A 4BQTA 2YMEA 3WTLA 2XZ5A 5HEGA 3IGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQ4 A;  3ZDH A;  4UM3 A;  3WIP A;  4ZK4 A;  5L47 A;  2BG9 E;  3WTJ A;  5AIN A;  2W8G A;  3WTI A;  2KSR A;  5L4E A;  4AFH A;  4TWH A;  3RHW A;  4XHE A;  1I9B A;  2XNT A;  2BG9 C;  3UU8 A;  3WTH A;  3C79 A;  5KZU A;  2XQ5 A;  3UU6 A;  2XZ6 A;  4BFQ A;  2X00 A;  3U8L A;  3SIO A;  2XQA A;  4EZ1 A;  4TNW A;  3RQU A;  4B5D A;  3P50 A;  4HQP A;  4A97 A;  5J0Z A;  2YOE A;  5JME A;  3UU4 A;  2XQ8 A;  4WV9 A;  4UM3 S;  3U8K A;  2XYS A;  5BP0 A;  4QH4 A;  4QH5 A;  2BYQ A;  4D01 A;  4Z91 A;  3PMZ A;  3LSV A;  4ZK1 A;  3ZDG A;  4UY2 A;  2XNU A;  3GUA A;  2PGZ A;  4ILC A;  5CO5 A;  2LM2 A;  1UW6 A;  4ZR6 A;  2BR8 A;  5HCJ A;  2WZY A;  4ILB A;  2MAW A;  2ZJV A;  2LLY A;  2XQ6 A;  2BR7 A;  3TLS A;  3EI0 A;  1OED A;  5J5G A;  4ZZC A;  3JAF A;  3T4M A;  5J5F A;  4ZJS A;  4LMJ A;  3U8M A;  3EAM A;  5LG3 A;  4UM1 A;  4TNV A;  3EHZ A;  4TWF A;  3RIF A;  3UU5 A;  2Y7Y A;  5LXB A;  4ZRU A;  5J5I A;  4HFC A;  4IRE A;  2XQ4 A;  2LKG A;  4Z90 A;  2C9T A;  2YN6 A;  2PH9 A;  4AFG A;  4HFD A;  3TLT A;  3RIA A;  1UV6 A;  3U8N A;  1OED C;  3TLU A;  5AFM A;  4X5T A;  2WNC A;  1OED E;  2LKH A;  2XQ9 A;  4ZJT A;  5TVC A;  4IL4 A;  4UM3 P;  3U8J A;  2VL0 A;  5AFJ A;  2XQ3 A;  2BYR A;  4QAA A;  3WTO A;  4A98 A;  5SYO A;  3RQW A;  5FJV A;  3SH1 A;  2X00 D;  4ILA A;  5HEU A;  4HFH A;  2XYT A;  3P4W A;  4DBM A;  4LML A;  2Y54 A;  5HEH A;  3TLW A;  2QC1 B;  3UU3 A;  5IUX A;  3WTM A;  2ZJU A;  3UUB A;  3WTK A;  2Y58 A;  5AFM B;  5AFH A;  2W8F A;  5HEJ A;  5HCM A;  2XQ7 A;  4FRR A;  3WTN A;  3JAE A;  4QH1 A;  5L4H A;  5J5H A;  3JAD A;  4HFB A;  2Y57 A;  4QAB A;  4NZB A;  2YKS A;  4ZZB A;  2WN9 A;  3ZKR A;  3TLV A;  4COF A;  2BYS A;  2WNL A;  4QAC A;  3SQ6 A;  2M6I A;  2BJ0 A;  4HFI A;  3SQ9 A;  1OED B;  5HEO A;  2UZ6 A;  4XK9 A;  5AFN A;  5AFK A;  2BG9 A;  3PEO A;  2M6B A;  4TWD A;  3RI5 A;  2BYP A;  4NPP A;  4ALX A;  2Y56 A;  4UXU A;  4AFT A;  4F8H A;  2XNV A;  3C84 A;  5AFL A;  2WNJ A;  4PIR A;  4HFE A;  2BG9 B;  5CFB A;  4IL9 A;  5KE4 A;  5BW2 A;  3UQ7 A;  4LMK A;  2YMD A;  5BRX A;  2BYN A;  1UX2 A;  4BQT A;  2YME A;  3WTL A;  2XZ5 A;  5HEG A;  3IGQ A; 
#chains in the Genus database with same CATH topology
 5DAB A;  3OYX A;  3RPU A;  1V9D A;  3QB5 K;  5L47 A;  2WU5 A;  5DJQ C;  1FEW A;  3EAB A;  4I55 E;  3O4X E;  2XNT A;  5IYZ E;  4DR7 T;  4ZS2 A;  1YKH B;  4PJL A;  1XMO T;  4H9Q C;  4TNW A;  2FJB A;  3J7Y q;  5J0Z A;  4HQP A;  2BZB A;  2BYQ A;  5JQG E;  2XSB A;  3ZC0 A;  2JQH A;  3PUZ F;  5ABF B;  2KND A;  3KVB A;  2JQ9 A;  4PNI A;  2LOP A;  2Z6E A;  1UX5 A;  3HR0 A;  3Q5E A;  4CXX A;  2XY8 B;  4ZJS A;  5FY7 A;  2NOX A;  2LSJ A;  3AEB A;  3TLT A;  5AFM A;  2VKJ A;  4DR4 T;  4X20 E;  2N2N A;  5FXV A;  4QAA A;  4IT4 A;  2X0Y A;  1W0B A;  4TZ4 C;  4HFH A;  4H63 V;  2XAQ B;  4U74 A;  3UU3 A;  5J1G A;  5AFM B;  2A72 A;  2RA1 A;  1SHZ C;  4GKJ T;  3ETV A;  1T8B A;  3ZKR A;  4X62 T;  3GN5 B;  2HHH T;  2BKN A;  2K24 A;  4IGU A;  3AE4 A;  2BG9 A;  2KLQ A;  3F57 A;  2XAH B;  2WWV A;  4P0A A;  3N9M A;  5ABE A;  2ODU A;  3CK6 A;  2YEV C;  4F6R C;  3KV9 A;  4I4T E;  4NIQ A;  3I0O A;  5BRX A;  1VCT A;  3AEG A;  2ACZ A;  3RYH E;  4DR6 T;  3Q5D A;  3QOF A;  1HNX T;  2BS2 A;  2E9X B;  2XUE A;  4DV0 T;  2L8K A;  4CXW A;  3RRC A;  5LG4 A;  2EHO C;  5J2T E;  4HWD A;  5C3J A;  4AQF A;  2X9W A;  2Q9Q B;  2XZ6 A;  3RX6 A;  4B3S T;  2E5V A;  2WQY A;  2IDO B;  2XQA A;  4JI8 T;  3SWH A;  2ODV A;  2WWU A;  4U7Y A;  3LBX A;  5HXS A;  5AQU B;  4Z91 A;  1EZ3 A;  4A5X A;  1Z8U A;  3RIU A;  3PUA A;  3QUJ A;  2VWA A;  5LYJ E;  4YFS A;  3P4R A;  3ABV A;  5FY0 A;  2C5J A;  4YSY A;  5FL1 A;  1HNZ T;  3N9N A;  1S35 A;  1OED C;  5LNK A;  1HR0 T;  3CQG B;  4UM3 P;  1FIO A;  3T1H T;  3ZT7 A;  3B57 A;  4FI5 A;  4XAX B;  4ZI3 D;  5M4Y A;  1T72 A;  2Y54 A;  3KV5 A;  3WTM A;  2NTY A;  3WTK A;  2Y58 A;  3FHN A;  1ZHC A;  4DND A;  2XM2 A;  5AQK B;  4COF A;  5L3E B;  2OV9 A;  1I94 T;  2CWY A;  2W61 A;  3QK6 A;  3AE8 A;  4H9P C;  3FZF B;  1NWM X;  2D0U A;  2OLT A;  4A56 A;  4YSZ A;  2ZMA A;  2BYN A;  1MIW A;  3VU7 H;  3WTJ A;  2V7I A;  5LGT B;  5AQI B;  3WTI A;  4CI2 B;  2LHR A;  4EAH A;  2KWI B;  4WBN E;  1I9B A;  2X0H A;  4IIJ E;  3WTH A;  3H3M A;  4IDN A;  2E2A A;  5EK3 A;  4BFQ A;  3U8L A;  3SIO A;  2WY2 A;  3RRW A;  2VAS A;  2WM9 A;  3LDQ B;  4JI7 T;  2KWH A;  3JCF A;  5TAO A;  3ZJ1 A;  4HN9 A;  3QB5 A;  1XMQ T;  3HKC E;  1HFA A;  1MMN A;  4DR2 T;  1D1A A;  2DHR A;  2VKH A;  3EAM A;  2E9X A;  4UM1 A;  2WDQ A;  5KMG P;  3LFM A;  4X5T A;  3MAC A;  4L0R A;  2HN1 A;  4UF0 A;  4LF6 T;  1KNP A;  2V1D B;  5LGU B;  3P4Q A;  4IE6 A;  1NEN A;  4LML A;  3TLW A;  5J5H A;  5CGM A;  4DUY T;  4NZB A;  2YKS A;  4IE4 A;  2UUA T;  4ZI2 D;  2WNL A;  2J4G A;  2L9Q A;  5HEO A;  4ILU A;  2UZ6 A;  3PEO A;  3RI5 A;  2Y8D A;  2YDS A;  2SPC A;  2EHO D;  2LE8 A;  2UXB T;  5A1L A;  1NAF A;  4QKN A;  5ABG A;  3K1S A;  2I0M A;  3AA7 B;  4TX5 A;  1UX4 A;  2XZ5 A;  3LK3 B;  2X9Y A;  2E9X C;  2MYS A;  2UXX B;  4AI6 A;  4HEA A;  2NP9 A;  4YTM A;  4UF0 B;  3UU8 A;  1YKE B;  4ERR A;  4OK0 A;  4DID B;  1B7T A;  1O3X A;  3PE0 A;  4YTN A;  1AJ3 A;  2YOE A;  2LSY A;  2CHO A;  3CX7 B;  2PBI A;  3OJA A;  4LFA T;  4UY2 A;  5JH7 E;  1LKX A;  3AE7 A;  3ZMZ B;  2Q9Q D;  1D1B A;  5EK4 A;  4JEH B;  3ANW B;  2W66 A;  5C8Y E;  3ZPO A;  2QA7 A;  4JI0 T;  2PH9 A;  1US7 B;  2F4V T;  1Y64 B;  5HYA A;  3TLU A;  1WR0 A;  2FBW A;  3RYF E;  5CA0 E;  2Y6X A;  4UVB B;  4L9I A;  4UIG A;  5JDH A;  3C64 A;  1MMD A;  4IDO A;  1XDO A;  3I1A A;  3P4P A;  2DI4 A;  3ZJ2 A;  4PFP A;  4BA9 A;  1E2A A;  4EEB A;  2VL8 A;  3N5L A;  4KX6 A;  2EHO B;  4KI0 F;  2G0U A;  1BR1 A;  1IBK T;  4CN1 A;  2ZLY A;  4B3T T;  3UQ7 A;  2YMD A;  5JRE A;  5BMV E;  3WTL A;  2XAJ B;  3IBP A;  2FJA A;  2DNX A;  4YXD A;  4QXH B;  3TKL B;  1WCR A;  2RPA A;  2B76 A;  4KBM B;  4O4L E;  5CA1 E;  4UM3 S;  3U8K A;  3BQL A;  2DWG A;  3ZDG A;  4JV5 T;  4UV9 B;  2XNU A;  5C2T A;  2WU2 A;  3ZSS A;  2WMN A;  4K0U A;  1I6Z A;  4MAL A;  2IC9 A;  4ZS3 A;  3C98 B;  2I59 A;  3CWZ B;  4HFC A;  4Z90 A;  4AFG A;  3AE3 A;  3K3O A;  1OED E;  2YU1 A;  5TVC A;  2D0T A;  3RQW A;  5L3D B;  3FXE B;  5LBQ B;  3BK9 A;  4GYS A;  3H3A A;  3KBT A;  2LSG A;  3JAE A;  2LSK A;  2CMR A;  5EK2 A;  2MOZ A;  5IHY A;  5KXJ A;  4QX7 B;  3WI3 A;  4WZX A;  2CRB A;  1MIV A;  3AA6 B;  3SQ9 A;  2VQF T;  4MLK A;  3ZN0 B;  5AFN A;  4PFO A;  4ALX A;  4ZHQ E;  1KFY A;  2J1D G;  5FY1 A;  2JQQ A;  2XQY A;  3M65 A;  1CHU A;  4ANJ A;  2YK0 A;  2HPJ A;  5AQF B;  4LF7 T;  4UM3 A;  2M67 A;  4P0B A;  1L0V A;  2PFV A;  4AIS A;  3Q2M A;  4XHE A;  4KMC A;  1FMW A;  3DJB A;  2XAG B;  5FNV E;  4CZZ B;  4HWI B;  3ZT5 A;  3T8O A;  4B6X A;  5IWA T;  4WV9 A;  5BP0 A;  4QH4 A;  3PUQ A;  1SA0 E;  3GUA A;  2V6X A;  3NZP A;  2VQE T;  3ZN1 B;  2BR8 A;  3JC6 D;  2XQ6 A;  1BR0 A;  3EI0 A;  5HXR A;  3U8M A;  4X1Y E;  4UR9 A;  3LJC A;  5JR9 A;  3Q9D A;  4ZRU A;  1QLB A;  4HTE A;  3LK4 2;  1OWA A;  4NXM T;  3C50 A;  4AQG A;  3AA0 B;  5SYO A;  1XNR T;  1Z0P A;  4OX9 T;  1KNR A;  4QXC B;  5FYM A;  2WB5 A;  1XDP A;  4HFB A;  3A5X A;  4ZZB A;  2BKO A;  4EGW A;  4IE7 A;  1W0A A;  2WDR A;  3UUM A;  4YTP A;  1T7S A;  2M6I A;  4JI1 T;  1KNZ A;  2K48 A;  4H9R C;  4I0U A;  3RYI E;  2E5L T;  2WNJ A;  5FXX A;  3PUG A;  4U72 A;  5HAX A;  4H63 H;  2NW9 A;  2X68 A;  3ZDH A;  2NTX A;  2W0G A;  3UFE A;  3AEE A;  4UEM A;  3HL6 A;  4X66 T;  4AFH A;  3K3Q C;  4ZI7 E;  1JNZ A;  3C4Z A;  4DUZ T;  4AKH A;  3O9X A;  3N2G E;  1IZN B;  3IHR A;  2CPT A;  2JMH A;  3AE9 A;  3RKG A;  4QH5 A;  3PV0 F;  5LMN T;  4ZEY A;  2MAW A;  3SS1 A;  4CN4 A;  2UXN B;  2DWK A;  4FJO A;  4GIW A;  3RF1 A;  5J5F A;  4ZI3 C;  4PJJ A;  3X1D A;  3RKO A;  2Y7Y A;  3AAA B;  3AAE B;  2LKG A;  3PJA J;  5HXC A;  2VL0 A;  3OPC A;  2LM9 A;  4U7I A;  4DVD A;  3ONX A;  3F31 A;  2IHR 1;  4JI3 T;  2D9D A;  2XM1 A;  3GA8 A;  3WTN A;  1QSD A;  2ES0 A;  3T1Y T;  4JUY A;  1KF6 A;  4O4J E;  2BYS A;  3L3P A;  3PTR B;  3SQ6 A;  2BJ0 A;  1X9B A;  2ZM6 T;  5HWX A;  5AFK A;  4UV8 B;  3AA1 B;  2Y56 A;  1OXZ A;  1YXR A;  1DU2 A;  4HFE A;  5KE4 A;  2CM0 A;  3L09 A;  4YSX A;  4PK6 A;  3ZCJ A;  5LA6 E;  2BG9 E;  3OKQ A;  3DTO A;  4U2Z A;  4LFB T;  3EDV A;  1NEK A;  2E8I A;  3O1I A;  4DMW A;  2W62 A;  5JME A;  2K5B B;  4X1I E;  3EDU A;  4BJN A;  4PW8 A;  3PJA A;  4B3R T;  5CB4 E;  3R84 B;  1UW6 A;  1HX1 B;  4B3M T;  5HCJ A;  2ZJV A;  3ONJ A;  2D5U A;  4HFV A;  5LB7 B;  5JDN A;  5LOV E;  1Y01 A;  2PG8 A;  4P1N A;  5AQV B;  3U8N A;  3UUX B;  2UXD T;  3M3Z B;  5HWY A;  4IL4 A;  3ZMU B;  2IML A;  3I9Y A;  4DBM A;  2X9X A;  5HEH A;  4U3C A;  4YLH A;  1S94 A;  2BBJ A;  1WFD A;  3E22 E;  5ABF A;  3JAD A;  2Y57 A;  4GYR A;  3AE5 A;  4E7S A;  4IHJ E;  2WN9 A;  3GMI A;  3PU3 A;  4JLE A;  2Q9Q C;  2N1G A;  3PUY F;  5HXE A;  2R6G F;  3MXZ A;  2A3D A;  5AQG B;  2JMK A;  3N9L A;  2VUR A;  1E7P A;  4DV1 T;  3UT5 E;  2XHE B;  4IDQ A;  4EZH A;  2KT9 A;  4HWC A;  2A9U A;  4WNK A;  4BQT A;  1XWM A;  2YDQ A;  2W00 A;  2W63 A;  4U31 A;  4ZK4 A;  4CI1 B;  1KK7 A;  3EUH A;  3FXD B;  3NRY A;  1BR4 A;  5JRC B;  3RQU A;  4QHO A;  1WRD A;  1WYC A;  4YHH T;  4D01 A;  1VCS A;  2XJ7 A;  5L3G B;  3AE2 A;  3WAK A;  3ZLI A;  2LRL A;  3ZCI A;  3PUW F;  2WS3 A;  2WAU A;  3T4M A;  3F2E A;  4NXN T;  2VKD A;  3WAJ A;  4XZC A;  2X9H A;  2PTF A;  2WNC A;  5LJN A;  3CX6 B;  2XQ3 A;  2BYR A;  3WTO A;  3CVR A;  2XYT A;  1M7K A;  3V5S A;  3LK2 B;  5L4H A;  5FKY A;  3P7I A;  1HG2 A;  2CWO A;  4KHP T;  5LMU T;  3ZMV B;  1HS7 A;  3ZYK A;  2IUB A;  2YDR A;  4HWF A;  3IEE A;  4QXB B;  1E1H B;  4LF4 T;  3KV4 A;  2JRK A;  4JI4 T;  3HI2 A;  3FZM B;  3S4U A;  3ZST A;  2X67 A;  2K9A A;  1UX2 A;  2IIU A;  4H9N C;  4ASK A;  4J2C A;  3WIP A;  2XZE A;  1UUS A;  4Q25 A;  3PUV F;  2Q9Q A;  1T98 A;  2X0L B;  2AXD S;  4JBW F;  5FXW A;  2XQ5 A;  4ISS A;  1HF8 A;  2X00 A;  4EZ1 A;  4KUM B;  4C91 A;  1MMA A;  2V7M A;  3LSV A;  4G63 A;  3MJX A;  4ILB A;  4H9S E;  5KDM C;  1GQE A;  3CML A;  5AQP B;  3AAI A;  3BQK A;  3RIF A;  3CQX C;  4JYA T;  5J5I A;  2C9T A;  3P8C D;  1UV6 A;  5AQR B;  1HX8 A;  4CXY A;  5F5W A;  4U2Y A;  5JTG A;  1MMG A;  3ETU A;  4EYY R;  2XQ9 A;  2CE7 A;  2DLR A;  2NWB A;  2UU9 T;  5E0O A;  3VKH A;  1WYB A;  4A98 A;  4ILA A;  5HEU A;  3FBZ A;  1N34 T;  4LFC T;  1N32 T;  3G06 A;  2C0S A;  3D0T A;  3N9O A;  5LP6 E;  2JQK A;  5LGN B;  4LF9 T;  2W8F A;  3PUR A;  4QAB A;  3E08 A;  2LSI A;  1JNR A;  3C4X A;  2KIN B;  4EOZ B;  2VVN A;  3ESL A;  2WBL A;  4GKK T;  4YHJ A;  4AFT A;  2FJD A;  1IBM T;  3NKZ A;  4CI3 B;  3SFE A;  2V7K A;  2V5C A;  2C5K T;  2V6Y A;  2VKO A;  4DV6 T;  4O2B E;  4EYU A;  2NW7 A;  4V1A v;  2ZM8 A;  2LM2 A;  2OA5 A;  4GK0 E;  5AQS B;  2W8G A;  3RYC E;  3FZL B;  1X79 A;  3N2K E;  3I9W A;  4DO0 A;  4TWH A;  2HN2 A;  5BR8 T;  3AEA A;  3LG7 A;  2IC6 A;  2W67 A;  3HKE E;  4DR3 T;  5LHH B;  4DV7 T;  4TV8 E;  4ZI2 C;  3P50 A;  4DBQ A;  3CIR A;  2VVS A;  4ADZ A;  4MFR A;  3VRB A;  2HH7 A;  3NWI A;  4X64 T;  2V6Y B;  2ZM0 A;  2CHN A;  2LJL A;  5L3B B;  2QRX A;  2LEH A;  2X66 A;  2E9X D;  4IDP A;  4ZXL A;  5JR9 C;  4ZJT A;  1IAP A;  4PK5 A;  5LHG B;  3O1J A;  1D0X A;  3ANW A;  5FJV A;  2H3R A;  2QC1 B;  2DCF A;  3VR9 A;  3RIU C;  5IUX A;  3UUB A;  1D0Y A;  3OBV E;  3PUS A;  4EZ4 A;  3AVS A;  3SRZ A;  5AQN B;  3TLV A;  2BBH A;  4AKI A;  4XK9 A;  3NVO A;  5LBM A;  4TWD A;  1SUM B;  2H89 A;  2NW8 A;  2CBI A;  4K0K T;  5AFL A;  4IDZ A;  3AXJ B;  2BG9 B;  3KIN B;  3B13 A;  4DR1 T;  5CFB A;  3VRA A;  1WR6 A;  2BS4 A;  2UUB T;  1J1J A;  5LHI B;  5AIN A;  5LJM A;  1IBL T;  3DP7 A;  2I6H A;  2H88 A;  5GON E;  5KZU A;  4DBR A;  3RC3 A;  5F8P A;  3OTO T;  3RC8 A;  3J9X 1;  4A97 A;  3VR8 A;  1UK5 A;  2CBJ A;  2XQ8 A;  3PMZ A;  3ZEF B;  4ZK1 A;  5KX5 E;  4JI2 T;  4BJM A;  4ZR6 A;  1J5W A;  1ZOY A;  1HNW T;  4O8S A;  1H7C A;  3TLS A;  2BR7 A;  1OED A;  1MND A;  1YW0 A;  5H6Q B;  3L8R A;  5FP3 A;  4EED A;  2MTQ A;  5ADX L;  2UUC T;  1LVF A;  1N36 T;  3FB2 A;  5JDQ A;  5F3J A;  2Y48 B;  3AE1 A;  2QYW A;  3SH1 A;  4EB6 E;  3ZT6 A;  3AEC A;  1UGO A;  1BR2 A;  3NZQ A;  4N78 D;  3HA4 A;  2MBG A;  5JDM A;  1D1C A;  1UUR A;  3NBX X;  4QAC A;  2XPK A;  3P4S A;  3ZMS B;  3ZMT B;  3A7M A;  2M6B A;  3B5M A;  4UXU A;  3C84 A;  5L2L A;  2V7J A;  3EVY A;  4U33 A;  2ACX A;  4AKG A;  4IL9 A;  1LRZ A;  3N9P A;  3CPZ A;  3PU8 A;  1ZEE A;  1VOM A;  5DQV A;  2YME A;  5HEG A;  3UQ4 A;  3W15 B;  1HG5 A;  2XAF B;  4QWN B;  2IAK A;  2V7L A;  5L4E A;  4QX8 B;  4TUY E;  5ABH A;  3ZYM A;  2WMO A;  1MNE A;  4O2A E;  4TN7 B;  2B1E A;  4B5D A;  1R8I A;  5L3F B;  3E0Z A;  3PUX F;  1G8X A;  4X65 T;  4UEL A;  2UXC T;  2PGZ A;  2L3L A;  4E7Z A;  3PDY A;  4AQF C;  5H6R B;  4HGA A;  5DQW A;  4EXT A;  3HKB E;  4LMJ A;  2CA5 A;  3R6N A;  1IJ5 A;  4OYK A;  4TWF A;  2BVM A;  5LXB A;  4AXP A;  3KV6 A;  4AIU A;  3RIA A;  5AFU L;  4JEU B;  2CXL A;  1M62 A;  4CN6 A;  3KVA A;  5FXZ A;  5FVK A;  2MPK A;  1D0Z A;  5AQJ B;  3AVR A;  3N2O A;  3OYZ A;  2QVA A;  3FBL A;  3P4W A;  3K8P C;  3UUL A;  2W4X A;  5AFH A;  2XQ7 A;  1CUN A;  3L39 A;  4CQI A;  3MKD A;  4KHZ F;  2FUP A;  5AQH B;  4HFI A;  4DV2 T;  4DR5 T;  2DL1 A;  2XNV A;  4UXN B;  2FJE A;  1IJ6 A;  4PIR A;  1U5P A;  2WDV A;  3RH3 A;  4HWH A;  2WSS V;  4AKR B;  2V5D A;  2BKP A;  5JDG A;  3AXJ A;  3CQC B;  2A2F X;  1J5E T;  1HTJ F;  4HE8 A;  4I43 B;  1G73 A;  2V26 A;  5CJ5 A;  4WW0 A;  3BQI A;  3GN5 A;  3AE6 A;  2NR4 A;  2IW5 B;  4UVC B;  3U78 A;  4ILC A;  5CO5 A;  1HCI A;  4I50 E;  2W2U A;  2PJQ A;  3VKG A;  1U4Q A;  2LLY A;  1YQ3 A;  2D2S A;  4ZZC A;  3FZH B;  4PAG A;  4NUU A;  3QNU A;  1SE7 A;  4JI6 T;  4JI5 T;  4BAY B;  5AQM B;  4DV4 T;  4P09 A;  3VHL A;  2J62 A;  5EZY E;  3Q5W A;  4LF5 T;  4PJM A;  3U8J A;  2C5I T;  4OHF A;  2RP4 A;  5FL0 A;  2WP9 A;  2BVL A;  3ONL C;  5AQQ B;  4DV5 T;  2ZM2 A;  2YIN A;  5HCM A;  2BDE A;  3LBX B;  4QH1 A;  1LVK A;  4YY3 T;  2P9B A;  2HPL A;  3I0Q A;  5AQO B;  4DV3 T;  3V5U A;  5ETW A;  4Z8X A;  4NPP A;  3SFD A;  4PK4 A;  2QGS A;  5LCY A;  2KMF A;  2WZH A;  3ZYL A;  4C90 A;  4H9O C;  4IE5 A;  4LMK A;  2GK9 A;  2LOS A;  4GK5 E;  4GOU A;  4LF8 T;  2XAS B;  2KSR A;  3UU6 A;  4PJN A;  2N9D A;  4O4I E;  5L3C B;  1QUU A;  5J2U E;  1MIY A;  3AB3 B;  3NRX A;  4EV6 A;  2WZY A;  3AEF A;  3JAF A;  3JC6 C;  4L5G A;  4IST A;  5LG3 A;  3IF8 B;  5FMN A;  4OFZ A;  4IRE A;  2XQ4 A;  4ZOL E;  4DMV A;  2CXF A;  3GWH A;  2AE9 A;  5JDL A;  3A8Y C;  4MHC A;  1ZP0 A;  2H7O A;  2X00 D;  4O4H E;  2VK9 A;  3KDS E;  2JPF A;  2JIW A;  3H37 A;  3RGL A;  4G2A A;  4KP3 C;  2VB6 A;  2JJ9 A;  5HEJ A;  4FRR A;  2CLY B;  4X1K E;  3UUN A;  5AQL B;  5HXH A;  1ZV4 X;  4HKA A;  1FMV A;  2BS3 A;  3SOL A;  1W9R A;  2BYP A;  2EHO A;  2J47 A;  4F8H A;  2X51 A;  3UFG A;  3MZK B;  4NUV A;  4TV9 E;  3MA9 A;  3MK7 C;  4M1P A;  2CLY C;  4UVA B;  2LT3 A;  1UCU A;  2KXP B;  2WCA A;  3HKD E;  5JRC A;  5FVL A;  4AQY T;  3RHW A;  2YU2 A;  5JVD E;  2BG9 C;  3C79 A;  1XNQ T;  3UU4 A;  2XYS A;  2XTL A;  4MBQ A;  1XZY A;  5AQT B;  3CKD A;  1W09 A;  3C51 A;  2CEA A;  2LHN A;  3K3N A;  4OYJ A;  3CX8 B;  5J5G A;  3C4W A;  1FJG T;  1ZKE A;  2V8S V;  4TNV A;  2K3W A;  3EHZ A;  3UU5 A;  2CCQ A;  3N9Q A;  2YN6 A;  4HFD A;  1WLX A;  4YJ2 E;  2KZ7 B;  3QC9 A;  5JR9 B;  2LKH A;  1YQ4 A;  4WYV A;  4YJ3 E;  5AFJ A;  3RLF F;  3ZC1 A;  2H7V C;  4IE0 A;  4WBO A;  4XBF B;  2LRK A;  2ZJU A;  4AKL A;  2WZI A;  5JDF A;  3O1H A;  1YD8 G;  3IA3 A;  1N33 T;  4EIW A;  1VRB A;  2CXD A;  3UTK A;  1OED B;  3Q5X A;  3KBU A;  5LXT E;  2XSA A;  3AED A;  3FZK B;  3U3I A;  3KFW X;  5BW2 A;  3OVU A;  1KEY A;  4YT0 A;  3IGQ A; 
#chains in the Genus database with same CATH homology
 3UQ4 A;  3ZDH A;  4UM3 A;  3WIP A;  4ZK4 A;  5L47 A;  2BG9 E;  3WTJ A;  5AIN A;  2W8G A;  3WTI A;  2KSR A;  5L4E A;  4AFH A;  4TWH A;  3RHW A;  4XHE A;  1I9B A;  2XNT A;  2BG9 C;  3UU8 A;  3WTH A;  3C79 A;  5KZU A;  2XQ5 A;  3UU6 A;  2XZ6 A;  4BFQ A;  2X00 A;  3U8L A;  3SIO A;  2XQA A;  4EZ1 A;  4TNW A;  3RQU A;  4B5D A;  3P50 A;  4HQP A;  4A97 A;  5J0Z A;  2YOE A;  5JME A;  3UU4 A;  2XQ8 A;  4WV9 A;  4UM3 S;  3U8K A;  2XYS A;  5BP0 A;  4QH4 A;  4QH5 A;  2BYQ A;  4D01 A;  4Z91 A;  3PMZ A;  3LSV A;  4ZK1 A;  3ZDG A;  4UY2 A;  2XNU A;  3GUA A;  2PGZ A;  4ILC A;  5CO5 A;  2LM2 A;  1UW6 A;  4ZR6 A;  2BR8 A;  5HCJ A;  2WZY A;  4ILB A;  2MAW A;  2ZJV A;  2LLY A;  2XQ6 A;  2BR7 A;  3TLS A;  3EI0 A;  1OED A;  5J5G A;  4ZZC A;  3JAF A;  3T4M A;  5J5F A;  4ZJS A;  4LMJ A;  3U8M A;  3EAM A;  5LG3 A;  4UM1 A;  4TNV A;  3EHZ A;  4TWF A;  3RIF A;  3UU5 A;  2Y7Y A;  5LXB A;  4ZRU A;  5J5I A;  4HFC A;  4IRE A;  2XQ4 A;  2LKG A;  4Z90 A;  2C9T A;  2YN6 A;  2PH9 A;  4AFG A;  4HFD A;  3TLT A;  3RIA A;  1UV6 A;  3U8N A;  1OED C;  3TLU A;  5AFM A;  4X5T A;  2WNC A;  1OED E;  2LKH A;  2XQ9 A;  4ZJT A;  5TVC A;  4IL4 A;  4UM3 P;  3U8J A;  2VL0 A;  5AFJ A;  2XQ3 A;  2BYR A;  4QAA A;  3WTO A;  4A98 A;  5SYO A;  3RQW A;  5FJV A;  3SH1 A;  2X00 D;  4ILA A;  5HEU A;  4HFH A;  2XYT A;  3P4W A;  4DBM A;  4LML A;  2Y54 A;  5HEH A;  3TLW A;  2QC1 B;  3UU3 A;  5IUX A;  3WTM A;  2ZJU A;  3UUB A;  3WTK A;  2Y58 A;  5AFM B;  5AFH A;  2W8F A;  5HEJ A;  5HCM A;  2XQ7 A;  4FRR A;  3WTN A;  3JAE A;  4QH1 A;  5L4H A;  5J5H A;  3JAD A;  4HFB A;  2Y57 A;  4QAB A;  4NZB A;  2YKS A;  4ZZB A;  2WN9 A;  3ZKR A;  3TLV A;  4COF A;  2BYS A;  2WNL A;  4QAC A;  3SQ6 A;  2M6I A;  2BJ0 A;  4HFI A;  3SQ9 A;  1OED B;  5HEO A;  2UZ6 A;  4XK9 A;  5AFN A;  5AFK A;  2BG9 A;  3PEO A;  2M6B A;  4TWD A;  3RI5 A;  2BYP A;  4NPP A;  4ALX A;  2Y56 A;  4UXU A;  4AFT A;  4F8H A;  2XNV A;  3C84 A;  5AFL A;  2WNJ A;  4PIR A;  4HFE A;  2BG9 B;  5CFB A;  4IL9 A;  5KE4 A;  5BW2 A;  3UQ7 A;  4LMK A;  2YMD A;  5BRX A;  2BYN A;  1UX2 A;  4BQT A;  2YME A;  3WTL A;  2XZ5 A;  5HEG A;  3IGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...