3TLSA

The glic pentameric ligand-gated ion channel e19'p mutant in a locally-closed conformation (lc2 subtype)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVPTNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 91
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlsA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlsA01
2WZYA 1OEDC 2C9TA 5L4HA 2KSRA 5HEUA 5FJVA 4IREA 2X00D 4AFTA 5IUXA 3WTKA 2ZJUA 3RI5A 2YN6A 2YMDA 5AFJA 4ZRUA 3JADA 5KZUA 5HEOA 3PEOA 3RIAA 5J5GA 4ZJTA 2XZ6A 2Y57A 2M6IA 3UU4A 2BYNA 4QH4A 5AFLA 2QC1B 2WNCA 5LG3A 5AFNA 4Z90A 5AFKA 4QH1A 5TVCA 4TNWA 4F8HA 4B5DA 3UU8A 5BW2A 5J5IA 4AFGA 2WNLA 4UM3A 4TWFA 4TWHA 3TLWA 1OEDA 4HFCA 4LMKA 3U8NA 3U8LA 2XNUA 2BG9A 3U8KA 3WTIA 4PIRA 3UQ7A 3PMZA 4ZZCA 1UW6A 2W8GA 4TNVA 2PGZA 4NZBA 5LXBA 2LLYA 4ZZBA 2W8FA 3RIFA 5AFHA 2YMEA 5J5FA 3SIOA 3WTHA 3T4MA 4UY2A 3RQWA 3U8MA 3ZDGA 2BYPA 5J0ZA 5SYOA 4A98A 4HQPA 4WV9A 5HEGA 4FRRA 4X5TA 3TLSA 3UUBA 4IL4A 5AINA 5HCJA 3TLVA 4Z91A 4NPPA 4ZK1A 3ZDHA 4XHEA 4BQTA 4HFEA 4XK9A 2LKHA 4QH5A 4UM3P 4IL9A 2XQ6A 5BP0A 3UU5A 4A97A 4DBMA 2X00A 2BYSA 2XNVA 2XNTA 4LMJA 2WN9A 2MAWA 3TLUA 3RHWA 2BR7A 1OEDB 2M6BA 4TWDA 2YKSA 2BG9B 3EI0A 2Y7YA 5HEJA 5CO5A 2XYTA 2XQ7A 2BJ0A 4UM1A 2XZ5A 5BRXA 3U8JA 1I9BA 4ILAA 2BYRA 4ZJSA 2BYQA 3SH1A 3EHZA 2LKGA 5AFMA 2XQAA 5CFBA 5L47A 4UM3S 4ALXA 3C84A 2UZ6A 1UV6A 3WTMA 2BG9E 2VL0A 5L4EA 3RQUA 2LM2A 4HFBA 3SQ6A 4LMLA 2XQ8A 2Y54A 2Y58A 2XQ9A 4QABA 5HEHA 3ZKRA 3WTLA 3TLTA 4AFHA 4BFQA 5KE4A 2BG9C 4QAAA 5HCMA 2XQ5A 3GUAA 3JAEA 4ILCA 5J5HA 4D01A 3WIPA 2XQ3A 4ILBA 3WTJA 5JMEA 3IGQA 4COFA 3UQ4A 4QACA 2PH9A 4HFHA 1UX2A 2XQ4A 3P50A 3UU6A 2XYSA 2WNJA 4ZR6A 3LSVA 2Y56A 3WTOA 3P4WA 4HFDA 3UU3A 4HFIA 3SQ9A 3WTNA 2ZJVA 4EZ1A 4UXUA 1OEDE 2BR8A 4ZK4A 3C79A 3EAMA 2YOEA 3JAFA 5AFMB
chains in the Genus database with same CATH superfamily
2LOSA 3FBZA 4ZXLA 3SOLA 2WZYA 5LA6E 1UGOA 4PJNA 2H7VC 3UUNA 2WWVA 4CN6A 3HKBE 4WZXA 3C4XA 4IE6A 2V6YA 3MXZA 4NXMT 3CQCB 1UX4A 5KDMC 1V9DA 4ZZBA 2PJQA 3ZC0A 1HS7A 5AQIB 2LE8A 2KMFA 4BJNA 4DR7T 1GQEA 2XAQB 1KF6A 3C4WA 5FXXA 2FJEA 5AFUL 1XWMA 1HNXT 3Q5XA 4ASKA 1Z0PA 2YDRA 1G73A 2BR7A 4HN9A 5CO5A 2WCAA 4ILAA 3AAEB 2W0GA 2IHR1 2XQAA 3Q5DA 1UUSA 3Q2MA 4LF6T 4AQFA 5L3DB 5LOVE 4ADZA 4DUYT 1J5WA 3IEEA 3UQ4A 2UUAT 4EV6A 3LSVA 2XTLA 5LMUT 2Y8DA 2MYSA 2YU1A 2JQKA 1WYCA 2CXDA 2A3DA 3K3QC 1IAPA 5IUXA 3WTKA 4A5XA 1VOMA 5AFJA 4LF8T 4YSZA 3DP7A 4HWDA 1FMVA 3PUVF 3RIAA 5JRCB 2DCFA 2KNDA 3AEEA 3M65A 5FKYA 3U8KA 3UQ7A 2PFVA 2X66A 2WY2A 3ZPOA 4DV5T 3RIFA 5JDMA 4LFAT 3IBPA 5HEGA 1XDOA 3ZDHA 4XK9A 4UM3P 3RRWA 4QWNB 4HE8A 3IA3A 5BP0A 2LHNA 4LF9T 3JC6D 2WN9A 4HKAA 1MNEA 1VRBA 3EI0A 2YK0A 2Y48B 3ZMVB 3MJXA 4AKHA 3CK6A 4DR5T 4JI0T 1XMQT 5JDHA 4GK5E 4IDPA 2HN1A 3LG7A 3CKDA 3SQ6A 1KNZA 3T8OA 3PUXF 4CXWA 3Q9DA 2IMLA 5HYAA 5J5HA 3OYZA 3CQXC 2Q9QC 2X67A 2AE9A 3L3PA 3UU6A 3ZSTA 1WYBA 4ZEYA 4ISSA 2XZEA 1IBLT 4PAGA 4LFCT 5L3CB 4GK0E 5L4HA 4WBOA 2CEAA 4JI5T 3AE4A 4O4IE 2E9XD 4DR4T 5L3GB 1W0AA 2E2AA 2WU5A 2QC1B 4OX9T 2KINB 2P9BA 3U8NA 1BR4A 3U78A 3IF8B 3PV0F 4JV5T 5AFHA 2UXXB 3MA9A 2NOXA 5H6RB 4XZCA 5AQFB 5AQGB 4XHEA 2X9HA 4GKKT 4HWHA 2BKPA 2X9XA 2PTFA 4YY3T 4YT0A 3H3AA 2OA5A 3FB2A 5HEJA 5H6QB 2V7IA 5CFBA 4ALXA 2DNXA 3VKGA 2RA1A 4O4JE 4UEMA 2ZM6T 4JI2T 2UUCT 5KX5E 3BK9A 5JRCA 2IAKA 2FUPA 4H9OC 1S94A 5LHGB 2A2FX 4QACA 2X0YA 2FJBA 4E7SA 1Y64B 4EZ1A 2V7JA 2KWHA 4PK5A 5J2TE 5ABGA 2UXBT 2W2UA 5LG3A 4QH1A 3C4ZA 1R8IA 3HA4A 4ERRA 4M1PA 3KV5A 5DQWA 1U4QA 4UXNB 5AQTB 3JCFA 3ONLC 3FBLA 5LYJE 2JMKA 3SIOA 4F6RC 2YINA 4DVDA 1HNZT 4Z91A 3AB3B 2XASB 3FXDB 2E5VA 2X0LB 1D1CA 1QUUA 4QH5A 1SA0E 5FXVA 5CB4E 4U31A 1HX1B 1NENA 5TAOA 4LMJA 4DR1T 3NBXX 3F31A 4TWDA 5LG4A 4XBFB 2CA5A 1W09A 3RYIE 5CA0E 3RIUC 1CHUA 4QX7B 3SH1A 2X9YA 4MBQA 3B5MA 1T7SA 4IHJE 3K3OA 4LMLA 3LDQB 5HEHA 2IDOB 4H9SE 5HAXA 4YSXA 4OYJA 5HCMA 2LT3A 2V5DA 2XQ3A 4U33A 3FZFB 5JMEA 3IGQA 4OHFA 4ZR6A 1ZKEA 4HFDA 1DU2A 2VQFT 4P09A 2EHOC 4X62T 2ZJUA 5IWAT 3VKHA 3HKEE 4EYUA 4ILUA 5JDNA 3J7Yq 4DV0T 3N9LA 1WRDA 4AKIA 3CX8B 3L39A 2M6IA 3UU4A 2BYNA 2AXDS 3QUJA 3FZHB 5JR9B 2WNLA 3V5SA 3N2KE 5JVDE 5LBMA 2W8GA 2PGZA 2W8FA 4BA9A 3ZEFB 1B7TA 3WTHA 2SPCA 2V5CA 3VR9A 3AE1A 2VKHA 3PUSA 2OV9A 3AEAA 4DR3T 4I43B 3ZCIA 1X9BA 4A97A 4DBMA 4CXYA 2VQET 3NVOA 2N2NA 4V1Av 5LNKA 1FEWA 1MNDA 5LCYA 3F57A 4EYYR 2Y6XA 3P4RA 2V1DB 3X1DA 2MPKA 1I6ZA 2VWAA 1BR0A 4BAYB 3JAEA 4U2YA 3R84B 2IC9A 1N32T 3B57A 4JLEA 1FJGT 2BKOA 4PJLA 2ZJVA 4JYAT 3MZKB 4DMVA 4GYSA 4U3CA 4TX5A 3ESLA 2CXLA 5M4YA 2B76A 5JTGA 5KMGP 4UV9B 3UUMA 2BS2A 1JNRA 2WDRA 4ZRUA 4ZS3A 5HEOA 4GIWA 2XSAA 4KI0F 4J2CA 5J1GA 1T98A 5EZYE 2FJAA 2I0MA 5DQVA 3GA8A 5TVCA 2JQ9A 1BR2A 4AFGA 1WCRA 4TWHA 3RYHE 4CI2B 1UURA 4WW0A 5FMNA 3U8MA 2G0UA 3AA6B 5SYOA 4FRRA 4EZHA 4YLHA 2K5BB 5HXCA 5AQJB 4UVBB 4O2BE 2X00A 2KWIB 2PBIA 2XJ7A 3TLUA 2M6BA 2YKSA 1D1AA 4DV2T 2HH7A 2XZ5A 5AQQB 5AQRB 3QB5A 3O1JA 5JDQA 4IE4A 5FYMA 1N33T 2BG9E 1CUNA 4ZI7E 5E0OA 5FXZA 2WZIA 3VHLA 3ZT6A 3C64A 4ZI2D 4ISTA 3WAKA 2E5LT 5FP3A 4CI1B 1IJ6A 2H3RA 5JR9A 2WZHA 3OKQA 4ANJA 4PJJA 4P1NA 4YTPA 5CA1E 4E7ZA 3ZYLA 2CWYA 5AQVB 2V7LA 2WQYA 2C9TA 4JI3T 4IREA 4OFZA 2FJDA 3AA1B 3VRAA 3CMLA 4NUUA 3AE3A 4X64T 3H3MA 2E8IA 3ZMUB 1KNRA 4UELA 4UM3A 2WU2A 3PUQA 4WNKA 3AE9A 2C5KT 2VASA 3RGLA 3AEGA 4YXDA 2LSJA 3PUAA 5ABEA 5KXJA 3MKDA 1LRZA 4IL4A 3KDSE 3KV6A 4AISA 2KT9A 2LKHA 2VL8A 4IDZA 2B1EA 2IUBA 3ZSSA 3UU5A 2H89A 3CPZA 1MIVA 2YDSA 4UIGA 4JI4T 2Y7YA 5C3JA 3RF1A 4UR9A 5BMVE 4PNIA 2I6HA 4WBNE 2BYQA 2LKGA 4K0KT 4MHCA 5L47A 4I0UA 4HWIB 3PUWF 5ABFB 4HFVA 4UVAB 2LM2A 1NAFA 2K24A 4FI5A 2CE7A 3GN5B 2VK9A 1SUMB 2BS3A 5JDFA 5L3BB 3RKGA 2JPFA 1WR0A 3HKDE 4COFA 2MOZA 1YKHB 3P50A 2WNJA 3PJAA 2Y56A 4MFRA 4UXUA 2W62A 5C8YE 2RP4A 2WS3A 2CLYC 5HWYA 3RI5A 5L3FB 3LBXB 4TUYE 2A9UA 3ZC1A 1IZNB 5A1LA 3PEOA 5DJQC 3LJCA 3AXJB 4XAXB 5BW2A 2F4VT 4PIRA 3HR0A 1D0ZA 4TNVA 3HL6A 3F2EA 3PU8A 1UK5A 4O4LE 5F8PA 5LGUB 2JQHA 5FY1A 4X5TA 1XZYA 3VRBA 4YSYA 3QNUA 4OYKA 2NTYA 4AKRB 3SS1A 1H7CA 3L8RA 3QOFA 3NWIA 1FMWA 3L09A 4P0AA 2EHOB 2WWUA 3O4XE 4EB6E 4OK0A 5C2TA 5FXWA 4BJMA 3K8PC 3U8JA 2JQQA 4H9QC 1HNWT 3ZCJA 4QHOA 1YQ4A 2VL0A 3AVRA 4AXPA 4LFBT 2HHHT 3K3NA 2W4XA 3ZMZB 4IDOA 2WMOA 2BVMA 4D01A 2QVAA 1XMOT 2XYSA 2V7MA 2C5JA 1KK7A 1ZP0A 4PJMA 4G2AA 3H37A 3JAFA 5FY0A 4B3RT 1M62A 1KFYA 3E0ZA 3LK42 2J1DG 4AQYT 3U3IA 5IHYA 1VCSA 2BBJA 1WLXA 4QH4A 5AQLB 5AFNA 4I50E 4Z90A 2H7OA 4DUZT 3ZMSB 2NR4A 3ZT7A 3OYXA 4CQIA 4DBQA 3ZYKA 5AQUB 3ZLIA 3Q5WA 5ABFA 4KX6A 1VCTA 1X79A 5LB7B 3GN5A 2XY8B 2MTQA 3D0TA 1LVKA 4P0BA 1WR6A 2CHOA 2UXNB 3HKCE 3FZKB 2X51A 3KVAA 5AQHB 5EK2A 2BG9B 4IE0A 3PUGA 3P8CD 3AE2A 2LSGA 3E22E 1I9BA 3G06A 2GK9A 4Z8XA 4UV8B 5LHIB 3BQLA 2XAHB 3QB5K 1I94T 3N9NA 5ABHA 4QABA 3ZKRA 3WTLA 3LBXA 2ZM8A 3JC6C 1N36T 3AXJA 1E1HB 4X1IE 3KV9A 2DWGA 3WIPA 1HCIA 2XSBA 2JJ9A 3C79A 1OXZA 4PK4A 2CPTA 2YOEA 3AE8A 2ZLYA 3UULA 3EDUA 5LJNA 2CHNA 5HEUA 3EABA 2X00D 3N2GE 5JDLA 3NZQA 3A7MA 4JBWF 4TN7B 5KZUA 2QGSA 3UFEA 3ETUA 1AJ3A 5AFKA 3OBVE 5J5IA 2EHOA 1LKXA 3TLWA 2N9DA 3SFDA 3WTIA 5EK4A 4KHZF 3PMZA 4U7IA 4JI6T 1MMGA 1G8XA 3ZDGA 4YHHT 4A98A 4DV1T 2E9XC 5ADXL 4DV4T 1LVFA 3SWHA 3RH3A 3RRCA 4EIWA 4JI7T 1FIOA 2JRKA 2M67A 2R6GF 4YFSA 5HXEA 5JREA 2LRLA 3ZN1B 1HR0T 2LSIA 4DIDB 3A5XA 1HG5A 4UM3S 3T1HT 3NKZA 2UZ6A 3AVSA 4K0UA 2JIWA 1ZOYA 4HFBA 2VVNA 2QA7A 2Y58A 4KMCA 3TLTA 3KBUA 5FVKA 4KHPT 4Q25A 3AEDA 5J2UE 3CIRA 2K48A 4DR2T 2ZM0A 4HFHA 2XQ4A 3OVUA 4DV7T 4FJOA 2D0TA 3KV4A 3C51A 4HEAA 4L0RA 3I1AA 4EAHA 2CBJA 2HN2A 5LMNT 1HG2A 4HWFA 1OEDC 4LF5T 1D1BA 2L3LA 4H9PC 4KP3C 3RX6A 3CX7B 3I0QA 3NZPA 2XZ6A 5AFLA 3VU7H 3UFGA 4TWFA 3ABVA 4LMKA 2BG9A 3PURA 4B6XA 4DR6T 1QSDA 4U72A 4ZZCA 1IBKT 2LSYA 3FXEB 2YMEA 5HXHA 4QXBB 2V8SV 5J0ZA 4C90A 2BKNA 3J9X1 3RC8A 5FL1A 3RLFF 2VB6A 4N78D 4O4HE 2XAGB 3ANWB 2CXFA 4KUMB 5FY7A 2PG8A 3SFEA 2MAWA 2RPAA 1NEKA 2VURA 2DL1A 3PE0A 4AKLA 3E08A 3PTRB 2Q9QD 1XNQT 2BYRA 2Q9QB 4I55E 1WFDA 5FVLA 3LK3B 2CBIA 3RQUA 3IHRA 5EK3A 1M7KA 1MIYA 2DLRA 4QAAA 2XM1A 4IIJE 4ILCA 4B3ST 1QLBA 4QX8B 4ILBA 3WTJA 1YXRA 1ZHCA 3AE5A 3UUXB 3NRXA 4DV3T 4HFIA 3AECA 2UXCT 4JEHB 4CI3B 5AFMB 4ZI3C 4JI8T 5F5WA 3TKLB 1UX5A 2WSSV 2KSRA 4H9RC 2DI4A 4AFTA 2CCQA 3O9XA 5AQSB 3FZMB 4U2ZA 2W00A 2YN6A 5AQPB 3O1IA 2LM9A 2CWOA 1SHZC 1MMNA 4X1KE 1KEYA 3P4QA 4TNWA 4UF0B 3P7IA 4DV6T 3O1HA 4X66T 3B13A 4WYVA 2KLQA 4ZS2A 5J5FA 4PW8A 5HXSA 3RYCE 2K9AA 5JR9C 4NPPA 4ZK1A 2C5IT 1S35A 5LXTE 4L5GA 4GKJT 1ZEEA 2XUEA 5DABA 3LFMA 5HWXA 2XNTA 4AQFC 3EVYA 3RHWA 3PUYF 2LEHA 2XQ7A 3QK6A 2XPKA 3N9PA 2V6XA 4ZJSA 4AKGA 5L4EA 4U74A 2Z6EA 2XQ8A 3ZN0B 2Y54A 2IW5B 1BR1A 2L9QA 2XQ5A 2NP9A 2V7KA 4LF4T 1E2AA 2XAFB 1N34T 1YD8G 4MLKA 4G63A 3WTOA 2XM2A 3WTNA 2DWKA 2ZM2A 3UT5E 2N1GA 3EDVA 3ZT5A 2ODVA 3MACA 3ZYMA 2KZ7B 2YMDA 3PUZF 5JQGE 2V26A 2XAJB 3ANWA 4NIQA 4IDNA 2WDVA 3ZJ1A 2BS4A 4LF7T 5AQOB 4H63H 4F8HA 2J4GA 2XQYA 5FL0A 5BR8T 4HGAA 2ODUA 4YTNA 4HFCA 2X0HA 2VKOA 3UTKA 3HI2A 2Q9QA 2WB5A 1J5ET 2BYPA 3AAIA 1MMAA 4AIUA 3WAJA 1EZ3A 3AA0B 3R6NA 5HCJA 3I9WA 1W9RA 4BQTA 3ONJA 1Y01A 2QRXA 4IL9A 2XQ6A 1O3XA 4JUYA 5LGNB 5F3JA 5CJ5A 3RPUA 4H9NC 1IBMT 3AEFA 4ZHQE 1US7B 2BJ0A 5BRXA 1D0YA 3EHZA 5AFMA 1IJ5A 4X20E 4AI6A 4NXNT 2HPJA 3RC3A 1HFAA 3M3ZB 2EHOD 4AFHA 1D0XA 4DNDA 4IE7A 5JDGA 1W0BA 3LK2B 2WBLA 5LGTB 3BQKA 2YU2A 5FNVE 2MBGA 3SRZA 3PJAJ 2YEVC 3OJAA 3UU3A 2IIUA 3SQ9A 2E9XB 4UF0A 4ZK4A 4DMWA 4B3MT 1YKEB 2UXDT 3N9MA 3S4UA 3N9QA 5FJVA 2BVLA 4PFPA 4ZI2C 3GMIA 4UVCB 3JADA 5J5GA 4O8SA 2CM0A 2CMRA 3RKOA 4B5DA 3A8YC 2KXPB 4HTEA 2W61A 2D2SA 3U8LA 2UU9T 1J1JA 2ACZA 5AQNB 2W67A 2LLYA 2YDQA 4UY2A 1SE7A 4GYRA 1HTJF 4NUVA 1U5PA 5AINA 4EXTA 3PDYA 4DO0A 3T1YT 4HFEA 4H63V 1NWMX 4IE5A 1JNZA 3DJBA 3I0OA 2XNVA 5IYZE 4C91A 1OEDB 2J47A 2WM9A 4EGWA 4YJ2E 3C84A 3C98B 3WTMA 4A56A 5LHHB 4QXHB 4CN1A 4BFQA 1YW0A 5KE4A 5AQKB 4TV9E 2X68A 2NW8A 4EOZB 1T8BA 4CXXA 1UX2A 5JH7E 2ES0A 4YTMA 3N9OA 2L8KA 2BZBA 4KBMB 1E7PA 5AQMB 1MIWA 2K3WA 2IC6A 1UCUA 4JEUB 3K1SA 4ZOLE 3AA7B 2HPLA 4GOUA 3RIUA 2BBHA 2J62A 4IT4A 4ZJTA 2NWBA 5LJMA 2WNCA 4PK6A 3P4PA 3ZMTB 2D9DA 4L9IA 2WP9A 3C50A 5ETWA 4EEDA 4EEBA 3P4SA 1HX8A 3I9YA 3FZLB 4X1YE 3WI3A 4NZBA 2FBWA 3QC9A 4O2AE 2LOPA 3T4MA 3RQWA 2UUBT 4HQPA 5CGMA 3W15B 3UUBA 2X9WA 2QYWA 1T72A 4HWCA 2V6YB 4TV8E 4ZI3D 2DHRA 3ETVA 3AAAB 2NW9A 2BYSA 1Z8UA 4YJ3E 2LJLA 2XYTA 2E9XA 3VR8A 3Q5EA 5L3EB 3FHNA 2D0UA 2LSKA 5HXRA 5GONE 3N2OA 4IDQA 2WMNA 4TZ4C 2NW7A 4IGUA 3CVRA 2XQ9A 3ZJ2A 3RYFE 2OLTA 2W66A 2VKDA 3ONXA 2LRKA 3GUAA 3OPCA 5L2LA 4JI1T 2JMHA 1HF8A 3KBTA 3GWHA 4EZ4A 4QXCB 2BDEA 2BR8A 3PU3A 3CWZB 3BQIA 3CQGB 3OTOT 3EUHA 2Y57A 4U7YA 2D5UA 2WAUA 3AE6A 3UU8A 3N5LA 4I4TE 2I59A 1OEDA 4AQGA 2XNUA 2LHRA 2XHEB 2ZMAA 1MMDA 1UW6A 3NRYA 1XNRT 5LXBA 3KFWX 4WV9A 3KINB 3TLSA 3TLVA 4PFOA 1ZV4X 2W63A 1KNPA 2H88A 4B3TT 2WDQA 4CN4A 3DTOA 4UM1A 4QKNA 4DBRA 5LP6E 2VKJA 3MK7C 3KVBA 2A72A 1UV6A 3AEBA 2ACXA 4MALA 2BG9C 5LBQB 2C0SA 3V5UA 3AE7A 2NTXA 2CLYB 4YHJA 2PH9A 1OWAA 4CZZB 3CX6B 1YQ3A 2CRBA 3P4WA 1OEDE 1L0VA 2VVSA 3EAMA 4X65T 1XDPA
chains in the Genus database with same CATH topology
2WZYA 1OEDC 2C9TA 5L4HA 2KSRA 5HEUA 5FJVA 4IREA 2X00D 4AFTA 5IUXA 3WTKA 2ZJUA 3RI5A 2YN6A 2YMDA 5AFJA 4ZRUA 3JADA 5KZUA 5HEOA 3PEOA 3RIAA 5J5GA 4ZJTA 2XZ6A 2Y57A 2M6IA 3UU4A 2BYNA 4QH4A 5AFLA 2QC1B 2WNCA 5LG3A 5AFNA 4Z90A 5AFKA 4QH1A 5TVCA 4TNWA 4F8HA 4B5DA 3UU8A 5BW2A 5J5IA 4AFGA 2WNLA 4UM3A 4TWFA 4TWHA 3TLWA 1OEDA 4HFCA 4LMKA 3U8NA 3U8LA 2XNUA 2BG9A 3U8KA 3WTIA 4PIRA 3UQ7A 3PMZA 4ZZCA 1UW6A 2W8GA 4TNVA 2PGZA 4NZBA 5LXBA 2LLYA 4ZZBA 2W8FA 3RIFA 5AFHA 2YMEA 5J5FA 3SIOA 3WTHA 3T4MA 4UY2A 3RQWA 3U8MA 3ZDGA 2BYPA 5J0ZA 5SYOA 4A98A 4HQPA 4WV9A 5HEGA 4FRRA 4X5TA 3TLSA 3UUBA 4IL4A 5AINA 5HCJA 3TLVA 4Z91A 4NPPA 4ZK1A 3ZDHA 4XHEA 4BQTA 4HFEA 4XK9A 2LKHA 4QH5A 4UM3P 4IL9A 2XQ6A 5BP0A 3UU5A 4A97A 4DBMA 2X00A 2BYSA 2XNVA 2XNTA 4LMJA 2WN9A 2MAWA 3TLUA 3RHWA 2BR7A 1OEDB 2M6BA 4TWDA 2YKSA 2BG9B 3EI0A 2Y7YA 5HEJA 5CO5A 2XYTA 2XQ7A 2BJ0A 4UM1A 2XZ5A 5BRXA 3U8JA 1I9BA 4ILAA 2BYRA 4ZJSA 2BYQA 3SH1A 3EHZA 2LKGA 5AFMA 2XQAA 5CFBA 5L47A 4UM3S 4ALXA 3C84A 2UZ6A 1UV6A 3WTMA 2BG9E 2VL0A 5L4EA 3RQUA 2LM2A 4HFBA 3SQ6A 4LMLA 2XQ8A 2Y54A 2Y58A 2XQ9A 4QABA 5HEHA 3ZKRA 3WTLA 3TLTA 4AFHA 4BFQA 5KE4A 2BG9C 4QAAA 5HCMA 2XQ5A 3GUAA 3JAEA 4ILCA 5J5HA 4D01A 3WIPA 2XQ3A 4ILBA 3WTJA 5JMEA 3IGQA 4COFA 3UQ4A 4QACA 2PH9A 4HFHA 1UX2A 2XQ4A 3P50A 3UU6A 2XYSA 2WNJA 4ZR6A 3LSVA 2Y56A 3WTOA 3P4WA 4HFDA 3UU3A 4HFIA 3SQ9A 3WTNA 2ZJVA 4EZ1A 4UXUA 1OEDE 2BR8A 4ZK4A 3C79A 3EAMA 2YOEA 3JAFA 5AFMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZY A;  1OED C;  2C9T A;  5L4H A;  2KSR A;  5HEU A;  5FJV A;  4IRE A;  2X00 D;  4AFT A;  5IUX A;  3WTK A;  2ZJU A;  3RI5 A;  2YN6 A;  2YMD A;  5AFJ A;  4ZRU A;  3JAD A;  5KZU A;  5HEO A;  3PEO A;  3RIA A;  5J5G A;  4ZJT A;  2XZ6 A;  2Y57 A;  2M6I A;  3UU4 A;  2BYN A;  4QH4 A;  5AFL A;  2QC1 B;  2WNC A;  5LG3 A;  5AFN A;  4Z90 A;  5AFK A;  4QH1 A;  5TVC A;  4TNW A;  4F8H A;  4B5D A;  3UU8 A;  5BW2 A;  5J5I A;  4AFG A;  2WNL A;  4UM3 A;  4TWF A;  4TWH A;  3TLW A;  1OED A;  4HFC A;  4LMK A;  3U8N A;  3U8L A;  2XNU A;  2BG9 A;  3U8K A;  3WTI A;  4PIR A;  3UQ7 A;  3PMZ A;  4ZZC A;  1UW6 A;  2W8G A;  4TNV A;  2PGZ A;  4NZB A;  5LXB A;  2LLY A;  4ZZB A;  2W8F A;  3RIF A;  5AFH A;  2YME A;  5J5F A;  3SIO A;  3WTH A;  3T4M A;  4UY2 A;  3RQW A;  3U8M A;  3ZDG A;  2BYP A;  5J0Z A;  5SYO A;  4A98 A;  4HQP A;  4WV9 A;  5HEG A;  4FRR A;  4X5T A;  3TLS A;  3UUB A;  4IL4 A;  5AIN A;  5HCJ A;  3TLV A;  4Z91 A;  4NPP A;  4ZK1 A;  3ZDH A;  4XHE A;  4BQT A;  4HFE A;  4XK9 A;  2LKH A;  4QH5 A;  4UM3 P;  4IL9 A;  2XQ6 A;  5BP0 A;  3UU5 A;  4A97 A;  4DBM A;  2X00 A;  2BYS A;  2XNV A;  2XNT A;  4LMJ A;  2WN9 A;  2MAW A;  3TLU A;  3RHW A;  2BR7 A;  1OED B;  2M6B A;  4TWD A;  2YKS A;  2BG9 B;  3EI0 A;  2Y7Y A;  5HEJ A;  5CO5 A;  2XYT A;  2XQ7 A;  2BJ0 A;  4UM1 A;  2XZ5 A;  5BRX A;  3U8J A;  1I9B A;  4ILA A;  2BYR A;  4ZJS A;  2BYQ A;  3SH1 A;  3EHZ A;  2LKG A;  5AFM A;  2XQA A;  5CFB A;  5L47 A;  4UM3 S;  4ALX A;  3C84 A;  2UZ6 A;  1UV6 A;  3WTM A;  2BG9 E;  2VL0 A;  5L4E A;  3RQU A;  2LM2 A;  4HFB A;  3SQ6 A;  4LML A;  2XQ8 A;  2Y54 A;  2Y58 A;  2XQ9 A;  4QAB A;  5HEH A;  3ZKR A;  3WTL A;  3TLT A;  4AFH A;  4BFQ A;  5KE4 A;  2BG9 C;  4QAA A;  5HCM A;  2XQ5 A;  3GUA A;  3JAE A;  4ILC A;  5J5H A;  4D01 A;  3WIP A;  2XQ3 A;  4ILB A;  3WTJ A;  5JME A;  3IGQ A;  4COF A;  3UQ4 A;  4QAC A;  2PH9 A;  4HFH A;  1UX2 A;  2XQ4 A;  3P50 A;  3UU6 A;  2XYS A;  2WNJ A;  4ZR6 A;  3LSV A;  2Y56 A;  3WTO A;  3P4W A;  4HFD A;  3UU3 A;  4HFI A;  3SQ9 A;  3WTN A;  2ZJV A;  4EZ1 A;  4UXU A;  1OED E;  2BR8 A;  4ZK4 A;  3C79 A;  3EAM A;  2YOE A;  3JAF A;  5AFM B; 
#chains in the Genus database with same CATH topology
 2LOS A;  3FBZ A;  4ZXL A;  3SOL A;  2WZY A;  5LA6 E;  1UGO A;  4PJN A;  2H7V C;  3UUN A;  2WWV A;  4CN6 A;  3HKB E;  4WZX A;  3C4X A;  4IE6 A;  2V6Y A;  3MXZ A;  4NXM T;  3CQC B;  1UX4 A;  5KDM C;  1V9D A;  4ZZB A;  2PJQ A;  3ZC0 A;  1HS7 A;  5AQI B;  2LE8 A;  2KMF A;  4BJN A;  4DR7 T;  1GQE A;  2XAQ B;  1KF6 A;  3C4W A;  5FXX A;  2FJE A;  5AFU L;  1XWM A;  1HNX T;  3Q5X A;  4ASK A;  1Z0P A;  2YDR A;  1G73 A;  2BR7 A;  4HN9 A;  5CO5 A;  2WCA A;  4ILA A;  3AAE B;  2W0G A;  2IHR 1;  2XQA A;  3Q5D A;  1UUS A;  3Q2M A;  4LF6 T;  4AQF A;  5L3D B;  5LOV E;  4ADZ A;  4DUY T;  1J5W A;  3IEE A;  3UQ4 A;  2UUA T;  4EV6 A;  3LSV A;  2XTL A;  5LMU T;  2Y8D A;  2MYS A;  2YU1 A;  2JQK A;  1WYC A;  2CXD A;  2A3D A;  3K3Q C;  1IAP A;  5IUX A;  3WTK A;  4A5X A;  1VOM A;  5AFJ A;  4LF8 T;  4YSZ A;  3DP7 A;  4HWD A;  1FMV A;  3PUV F;  3RIA A;  5JRC B;  2DCF A;  2KND A;  3AEE A;  3M65 A;  5FKY A;  3U8K A;  3UQ7 A;  2PFV A;  2X66 A;  2WY2 A;  3ZPO A;  4DV5 T;  3RIF A;  5JDM A;  4LFA T;  3IBP A;  5HEG A;  1XDO A;  3ZDH A;  4XK9 A;  4UM3 P;  3RRW A;  4QWN B;  4HE8 A;  3IA3 A;  5BP0 A;  2LHN A;  4LF9 T;  3JC6 D;  2WN9 A;  4HKA A;  1MNE A;  1VRB A;  3EI0 A;  2YK0 A;  2Y48 B;  3ZMV B;  3MJX A;  4AKH A;  3CK6 A;  4DR5 T;  4JI0 T;  1XMQ T;  5JDH A;  4GK5 E;  4IDP A;  2HN1 A;  3LG7 A;  3CKD A;  3SQ6 A;  1KNZ A;  3T8O A;  3PUX F;  4CXW A;  3Q9D A;  2IML A;  5HYA A;  5J5H A;  3OYZ A;  3CQX C;  2Q9Q C;  2X67 A;  2AE9 A;  3L3P A;  3UU6 A;  3ZST A;  1WYB A;  4ZEY A;  4ISS A;  2XZE A;  1IBL T;  4PAG A;  4LFC T;  5L3C B;  4GK0 E;  5L4H A;  4WBO A;  2CEA A;  4JI5 T;  3AE4 A;  4O4I E;  2E9X D;  4DR4 T;  5L3G B;  1W0A A;  2E2A A;  2WU5 A;  2QC1 B;  4OX9 T;  2KIN B;  2P9B A;  3U8N A;  1BR4 A;  3U78 A;  3IF8 B;  3PV0 F;  4JV5 T;  5AFH A;  2UXX B;  3MA9 A;  2NOX A;  5H6R B;  4XZC A;  5AQF B;  5AQG B;  4XHE A;  2X9H A;  4GKK T;  4HWH A;  2BKP A;  2X9X A;  2PTF A;  4YY3 T;  4YT0 A;  3H3A A;  2OA5 A;  3FB2 A;  5HEJ A;  5H6Q B;  2V7I A;  5CFB A;  4ALX A;  2DNX A;  3VKG A;  2RA1 A;  4O4J E;  4UEM A;  2ZM6 T;  4JI2 T;  2UUC T;  5KX5 E;  3BK9 A;  5JRC A;  2IAK A;  2FUP A;  4H9O C;  1S94 A;  5LHG B;  2A2F X;  4QAC A;  2X0Y A;  2FJB A;  4E7S A;  1Y64 B;  4EZ1 A;  2V7J A;  2KWH A;  4PK5 A;  5J2T E;  5ABG A;  2UXB T;  2W2U A;  5LG3 A;  4QH1 A;  3C4Z A;  1R8I A;  3HA4 A;  4ERR A;  4M1P A;  3KV5 A;  5DQW A;  1U4Q A;  4UXN B;  5AQT B;  3JCF A;  3ONL C;  3FBL A;  5LYJ E;  2JMK A;  3SIO A;  4F6R C;  2YIN A;  4DVD A;  1HNZ T;  4Z91 A;  3AB3 B;  2XAS B;  3FXD B;  2E5V A;  2X0L B;  1D1C A;  1QUU A;  4QH5 A;  1SA0 E;  5FXV A;  5CB4 E;  4U31 A;  1HX1 B;  1NEN A;  5TAO A;  4LMJ A;  4DR1 T;  3NBX X;  3F31 A;  4TWD A;  5LG4 A;  4XBF B;  2CA5 A;  1W09 A;  3RYI E;  5CA0 E;  3RIU C;  1CHU A;  4QX7 B;  3SH1 A;  2X9Y A;  4MBQ A;  3B5M A;  1T7S A;  4IHJ E;  3K3O A;  4LML A;  3LDQ B;  5HEH A;  2IDO B;  4H9S E;  5HAX A;  4YSX A;  4OYJ A;  5HCM A;  2LT3 A;  2V5D A;  2XQ3 A;  4U33 A;  3FZF B;  5JME A;  3IGQ A;  4OHF A;  4ZR6 A;  1ZKE A;  4HFD A;  1DU2 A;  2VQF T;  4P09 A;  2EHO C;  4X62 T;  2ZJU A;  5IWA T;  3VKH A;  3HKE E;  4EYU A;  4ILU A;  5JDN A;  3J7Y q;  4DV0 T;  3N9L A;  1WRD A;  4AKI A;  3CX8 B;  3L39 A;  2M6I A;  3UU4 A;  2BYN A;  2AXD S;  3QUJ A;  3FZH B;  5JR9 B;  2WNL A;  3V5S A;  3N2K E;  5JVD E;  5LBM A;  2W8G A;  2PGZ A;  2W8F A;  4BA9 A;  3ZEF B;  1B7T A;  3WTH A;  2SPC A;  2V5C A;  3VR9 A;  3AE1 A;  2VKH A;  3PUS A;  2OV9 A;  3AEA A;  4DR3 T;  4I43 B;  3ZCI A;  1X9B A;  4A97 A;  4DBM A;  4CXY A;  2VQE T;  3NVO A;  2N2N A;  4V1A v;  5LNK A;  1FEW A;  1MND A;  5LCY A;  3F57 A;  4EYY R;  2Y6X A;  3P4R A;  2V1D B;  3X1D A;  2MPK A;  1I6Z A;  2VWA A;  1BR0 A;  4BAY B;  3JAE A;  4U2Y A;  3R84 B;  2IC9 A;  1N32 T;  3B57 A;  4JLE A;  1FJG T;  2BKO A;  4PJL A;  2ZJV A;  4JYA T;  3MZK B;  4DMV A;  4GYS A;  4U3C A;  4TX5 A;  3ESL A;  2CXL A;  5M4Y A;  2B76 A;  5JTG A;  5KMG P;  4UV9 B;  3UUM A;  2BS2 A;  1JNR A;  2WDR A;  4ZRU A;  4ZS3 A;  5HEO A;  4GIW A;  2XSA A;  4KI0 F;  4J2C A;  5J1G A;  1T98 A;  5EZY E;  2FJA A;  2I0M A;  5DQV A;  3GA8 A;  5TVC A;  2JQ9 A;  1BR2 A;  4AFG A;  1WCR A;  4TWH A;  3RYH E;  4CI2 B;  1UUR A;  4WW0 A;  5FMN A;  3U8M A;  2G0U A;  3AA6 B;  5SYO A;  4FRR A;  4EZH A;  4YLH A;  2K5B B;  5HXC A;  5AQJ B;  4UVB B;  4O2B E;  2X00 A;  2KWI B;  2PBI A;  2XJ7 A;  3TLU A;  2M6B A;  2YKS A;  1D1A A;  4DV2 T;  2HH7 A;  2XZ5 A;  5AQQ B;  5AQR B;  3QB5 A;  3O1J A;  5JDQ A;  4IE4 A;  5FYM A;  1N33 T;  2BG9 E;  1CUN A;  4ZI7 E;  5E0O A;  5FXZ A;  2WZI A;  3VHL A;  3ZT6 A;  3C64 A;  4ZI2 D;  4IST A;  3WAK A;  2E5L T;  5FP3 A;  4CI1 B;  1IJ6 A;  2H3R A;  5JR9 A;  2WZH A;  3OKQ A;  4ANJ A;  4PJJ A;  4P1N A;  4YTP A;  5CA1 E;  4E7Z A;  3ZYL A;  2CWY A;  5AQV B;  2V7L A;  2WQY A;  2C9T A;  4JI3 T;  4IRE A;  4OFZ A;  2FJD A;  3AA1 B;  3VRA A;  3CML A;  4NUU A;  3AE3 A;  4X64 T;  3H3M A;  2E8I A;  3ZMU B;  1KNR A;  4UEL A;  4UM3 A;  2WU2 A;  3PUQ A;  4WNK A;  3AE9 A;  2C5K T;  2VAS A;  3RGL A;  3AEG A;  4YXD A;  2LSJ A;  3PUA A;  5ABE A;  5KXJ A;  3MKD A;  1LRZ A;  4IL4 A;  3KDS E;  3KV6 A;  4AIS A;  2KT9 A;  2LKH A;  2VL8 A;  4IDZ A;  2B1E A;  2IUB A;  3ZSS A;  3UU5 A;  2H89 A;  3CPZ A;  1MIV A;  2YDS A;  4UIG A;  4JI4 T;  2Y7Y A;  5C3J A;  3RF1 A;  4UR9 A;  5BMV E;  4PNI A;  2I6H A;  4WBN E;  2BYQ A;  2LKG A;  4K0K T;  4MHC A;  5L47 A;  4I0U A;  4HWI B;  3PUW F;  5ABF B;  4HFV A;  4UVA B;  2LM2 A;  1NAF A;  2K24 A;  4FI5 A;  2CE7 A;  3GN5 B;  2VK9 A;  1SUM B;  2BS3 A;  5JDF A;  5L3B B;  3RKG A;  2JPF A;  1WR0 A;  3HKD E;  4COF A;  2MOZ A;  1YKH B;  3P50 A;  2WNJ A;  3PJA A;  2Y56 A;  4MFR A;  4UXU A;  2W62 A;  5C8Y E;  2RP4 A;  2WS3 A;  2CLY C;  5HWY A;  3RI5 A;  5L3F B;  3LBX B;  4TUY E;  2A9U A;  3ZC1 A;  1IZN B;  5A1L A;  3PEO A;  5DJQ C;  3LJC A;  3AXJ B;  4XAX B;  5BW2 A;  2F4V T;  4PIR A;  3HR0 A;  1D0Z A;  4TNV A;  3HL6 A;  3F2E A;  3PU8 A;  1UK5 A;  4O4L E;  5F8P A;  5LGU B;  2JQH A;  5FY1 A;  4X5T A;  1XZY A;  3VRB A;  4YSY A;  3QNU A;  4OYK A;  2NTY A;  4AKR B;  3SS1 A;  1H7C A;  3L8R A;  3QOF A;  3NWI A;  1FMW A;  3L09 A;  4P0A A;  2EHO B;  2WWU A;  3O4X E;  4EB6 E;  4OK0 A;  5C2T A;  5FXW A;  4BJM A;  3K8P C;  3U8J A;  2JQQ A;  4H9Q C;  1HNW T;  3ZCJ A;  4QHO A;  1YQ4 A;  2VL0 A;  3AVR A;  4AXP A;  4LFB T;  2HHH T;  3K3N A;  2W4X A;  3ZMZ B;  4IDO A;  2WMO A;  2BVM A;  4D01 A;  2QVA A;  1XMO T;  2XYS A;  2V7M A;  2C5J A;  1KK7 A;  1ZP0 A;  4PJM A;  4G2A A;  3H37 A;  3JAF A;  5FY0 A;  4B3R T;  1M62 A;  1KFY A;  3E0Z A;  3LK4 2;  2J1D G;  4AQY T;  3U3I A;  5IHY A;  1VCS A;  2BBJ A;  1WLX A;  4QH4 A;  5AQL B;  5AFN A;  4I50 E;  4Z90 A;  2H7O A;  4DUZ T;  3ZMS B;  2NR4 A;  3ZT7 A;  3OYX A;  4CQI A;  4DBQ A;  3ZYK A;  5AQU B;  3ZLI A;  3Q5W A;  5ABF A;  4KX6 A;  1VCT A;  1X79 A;  5LB7 B;  3GN5 A;  2XY8 B;  2MTQ A;  3D0T A;  1LVK A;  4P0B A;  1WR6 A;  2CHO A;  2UXN B;  3HKC E;  3FZK B;  2X51 A;  3KVA A;  5AQH B;  5EK2 A;  2BG9 B;  4IE0 A;  3PUG A;  3P8C D;  3AE2 A;  2LSG A;  3E22 E;  1I9B A;  3G06 A;  2GK9 A;  4Z8X A;  4UV8 B;  5LHI B;  3BQL A;  2XAH B;  3QB5 K;  1I94 T;  3N9N A;  5ABH A;  4QAB A;  3ZKR A;  3WTL A;  3LBX A;  2ZM8 A;  3JC6 C;  1N36 T;  3AXJ A;  1E1H B;  4X1I E;  3KV9 A;  2DWG A;  3WIP A;  1HCI A;  2XSB A;  2JJ9 A;  3C79 A;  1OXZ A;  4PK4 A;  2CPT A;  2YOE A;  3AE8 A;  2ZLY A;  3UUL A;  3EDU A;  5LJN A;  2CHN A;  5HEU A;  3EAB A;  2X00 D;  3N2G E;  5JDL A;  3NZQ A;  3A7M A;  4JBW F;  4TN7 B;  5KZU A;  2QGS A;  3UFE A;  3ETU A;  1AJ3 A;  5AFK A;  3OBV E;  5J5I A;  2EHO A;  1LKX A;  3TLW A;  2N9D A;  3SFD A;  3WTI A;  5EK4 A;  4KHZ F;  3PMZ A;  4U7I A;  4JI6 T;  1MMG A;  1G8X A;  3ZDG A;  4YHH T;  4A98 A;  4DV1 T;  2E9X C;  5ADX L;  4DV4 T;  1LVF A;  3SWH A;  3RH3 A;  3RRC A;  4EIW A;  4JI7 T;  1FIO A;  2JRK A;  2M67 A;  2R6G F;  4YFS A;  5HXE A;  5JRE A;  2LRL A;  3ZN1 B;  1HR0 T;  2LSI A;  4DID B;  3A5X A;  1HG5 A;  4UM3 S;  3T1H T;  3NKZ A;  2UZ6 A;  3AVS A;  4K0U A;  2JIW A;  1ZOY A;  4HFB A;  2VVN A;  2QA7 A;  2Y58 A;  4KMC A;  3TLT A;  3KBU A;  5FVK A;  4KHP T;  4Q25 A;  3AED A;  5J2U E;  3CIR A;  2K48 A;  4DR2 T;  2ZM0 A;  4HFH A;  2XQ4 A;  3OVU A;  4DV7 T;  4FJO A;  2D0T A;  3KV4 A;  3C51 A;  4HEA A;  4L0R A;  3I1A A;  4EAH A;  2CBJ A;  2HN2 A;  5LMN T;  1HG2 A;  4HWF A;  1OED C;  4LF5 T;  1D1B A;  2L3L A;  4H9P C;  4KP3 C;  3RX6 A;  3CX7 B;  3I0Q A;  3NZP A;  2XZ6 A;  5AFL A;  3VU7 H;  3UFG A;  4TWF A;  3ABV A;  4LMK A;  2BG9 A;  3PUR A;  4B6X A;  4DR6 T;  1QSD A;  4U72 A;  4ZZC A;  1IBK T;  2LSY A;  3FXE B;  2YME A;  5HXH A;  4QXB B;  2V8S V;  5J0Z A;  4C90 A;  2BKN A;  3J9X 1;  3RC8 A;  5FL1 A;  3RLF F;  2VB6 A;  4N78 D;  4O4H E;  2XAG B;  3ANW B;  2CXF A;  4KUM B;  5FY7 A;  2PG8 A;  3SFE A;  2MAW A;  2RPA A;  1NEK A;  2VUR A;  2DL1 A;  3PE0 A;  4AKL A;  3E08 A;  3PTR B;  2Q9Q D;  1XNQ T;  2BYR A;  2Q9Q B;  4I55 E;  1WFD A;  5FVL A;  3LK3 B;  2CBI A;  3RQU A;  3IHR A;  5EK3 A;  1M7K A;  1MIY A;  2DLR A;  4QAA A;  2XM1 A;  4IIJ E;  4ILC A;  4B3S T;  1QLB A;  4QX8 B;  4ILB A;  3WTJ A;  1YXR A;  1ZHC A;  3AE5 A;  3UUX B;  3NRX A;  4DV3 T;  4HFI A;  3AEC A;  2UXC T;  4JEH B;  4CI3 B;  5AFM B;  4ZI3 C;  4JI8 T;  5F5W A;  3TKL B;  1UX5 A;  2WSS V;  2KSR A;  4H9R C;  2DI4 A;  4AFT A;  2CCQ A;  3O9X A;  5AQS B;  3FZM B;  4U2Z A;  2W00 A;  2YN6 A;  5AQP B;  3O1I A;  2LM9 A;  2CWO A;  1SHZ C;  1MMN A;  4X1K E;  1KEY A;  3P4Q A;  4TNW A;  4UF0 B;  3P7I A;  4DV6 T;  3O1H A;  4X66 T;  3B13 A;  4WYV A;  2KLQ A;  4ZS2 A;  5J5F A;  4PW8 A;  5HXS A;  3RYC E;  2K9A A;  5JR9 C;  4NPP A;  4ZK1 A;  2C5I T;  1S35 A;  5LXT E;  4L5G A;  4GKJ T;  1ZEE A;  2XUE A;  5DAB A;  3LFM A;  5HWX A;  2XNT A;  4AQF C;  3EVY A;  3RHW A;  3PUY F;  2LEH A;  2XQ7 A;  3QK6 A;  2XPK A;  3N9P A;  2V6X A;  4ZJS A;  4AKG A;  5L4E A;  4U74 A;  2Z6E A;  2XQ8 A;  3ZN0 B;  2Y54 A;  2IW5 B;  1BR1 A;  2L9Q A;  2XQ5 A;  2NP9 A;  2V7K A;  4LF4 T;  1E2A A;  2XAF B;  1N34 T;  1YD8 G;  4MLK A;  4G63 A;  3WTO A;  2XM2 A;  3WTN A;  2DWK A;  2ZM2 A;  3UT5 E;  2N1G A;  3EDV A;  3ZT5 A;  2ODV A;  3MAC A;  3ZYM A;  2KZ7 B;  2YMD A;  3PUZ F;  5JQG E;  2V26 A;  2XAJ B;  3ANW A;  4NIQ A;  4IDN A;  2WDV A;  3ZJ1 A;  2BS4 A;  4LF7 T;  5AQO B;  4H63 H;  4F8H A;  2J4G A;  2XQY A;  5FL0 A;  5BR8 T;  4HGA A;  2ODU A;  4YTN A;  4HFC A;  2X0H A;  2VKO A;  3UTK A;  3HI2 A;  2Q9Q A;  2WB5 A;  1J5E T;  2BYP A;  3AAI A;  1MMA A;  4AIU A;  3WAJ A;  1EZ3 A;  3AA0 B;  3R6N A;  5HCJ A;  3I9W A;  1W9R A;  4BQT A;  3ONJ A;  1Y01 A;  2QRX A;  4IL9 A;  2XQ6 A;  1O3X A;  4JUY A;  5LGN B;  5F3J A;  5CJ5 A;  3RPU A;  4H9N C;  1IBM T;  3AEF A;  4ZHQ E;  1US7 B;  2BJ0 A;  5BRX A;  1D0Y A;  3EHZ A;  5AFM A;  1IJ5 A;  4X20 E;  4AI6 A;  4NXN T;  2HPJ A;  3RC3 A;  1HFA A;  3M3Z B;  2EHO D;  4AFH A;  1D0X A;  4DND A;  4IE7 A;  5JDG A;  1W0B A;  3LK2 B;  2WBL A;  5LGT B;  3BQK A;  2YU2 A;  5FNV E;  2MBG A;  3SRZ A;  3PJA J;  2YEV C;  3OJA A;  3UU3 A;  2IIU A;  3SQ9 A;  2E9X B;  4UF0 A;  4ZK4 A;  4DMW A;  4B3M T;  1YKE B;  2UXD T;  3N9M A;  3S4U A;  3N9Q A;  5FJV A;  2BVL A;  4PFP A;  4ZI2 C;  3GMI A;  4UVC B;  3JAD A;  5J5G A;  4O8S A;  2CM0 A;  2CMR A;  3RKO A;  4B5D A;  3A8Y C;  2KXP B;  4HTE A;  2W61 A;  2D2S A;  3U8L A;  2UU9 T;  1J1J A;  2ACZ A;  5AQN B;  2W67 A;  2LLY A;  2YDQ A;  4UY2 A;  1SE7 A;  4GYR A;  1HTJ F;  4NUV A;  1U5P A;  5AIN A;  4EXT A;  3PDY A;  4DO0 A;  3T1Y T;  4HFE A;  4H63 V;  1NWM X;  4IE5 A;  1JNZ A;  3DJB A;  3I0O A;  2XNV A;  5IYZ E;  4C91 A;  1OED B;  2J47 A;  2WM9 A;  4EGW A;  4YJ2 E;  3C84 A;  3C98 B;  3WTM A;  4A56 A;  5LHH B;  4QXH B;  4CN1 A;  4BFQ A;  1YW0 A;  5KE4 A;  5AQK B;  4TV9 E;  2X68 A;  2NW8 A;  4EOZ B;  1T8B A;  4CXX A;  1UX2 A;  5JH7 E;  2ES0 A;  4YTM A;  3N9O A;  2L8K A;  2BZB A;  4KBM B;  1E7P A;  5AQM B;  1MIW A;  2K3W A;  2IC6 A;  1UCU A;  4JEU B;  3K1S A;  4ZOL E;  3AA7 B;  2HPL A;  4GOU A;  3RIU A;  2BBH A;  2J62 A;  4IT4 A;  4ZJT A;  2NWB A;  5LJM A;  2WNC A;  4PK6 A;  3P4P A;  3ZMT B;  2D9D A;  4L9I A;  2WP9 A;  3C50 A;  5ETW A;  4EED A;  4EEB A;  3P4S A;  1HX8 A;  3I9Y A;  3FZL B;  4X1Y E;  3WI3 A;  4NZB A;  2FBW A;  3QC9 A;  4O2A E;  2LOP A;  3T4M A;  3RQW A;  2UUB T;  4HQP A;  5CGM A;  3W15 B;  3UUB A;  2X9W A;  2QYW A;  1T72 A;  4HWC A;  2V6Y B;  4TV8 E;  4ZI3 D;  2DHR A;  3ETV A;  3AAA B;  2NW9 A;  2BYS A;  1Z8U A;  4YJ3 E;  2LJL A;  2XYT A;  2E9X A;  3VR8 A;  3Q5E A;  5L3E B;  3FHN A;  2D0U A;  2LSK A;  5HXR A;  5GON E;  3N2O A;  4IDQ A;  2WMN A;  4TZ4 C;  2NW7 A;  4IGU A;  3CVR A;  2XQ9 A;  3ZJ2 A;  3RYF E;  2OLT A;  2W66 A;  2VKD A;  3ONX A;  2LRK A;  3GUA A;  3OPC A;  5L2L A;  4JI1 T;  2JMH A;  1HF8 A;  3KBT A;  3GWH A;  4EZ4 A;  4QXC B;  2BDE A;  2BR8 A;  3PU3 A;  3CWZ B;  3BQI A;  3CQG B;  3OTO T;  3EUH A;  2Y57 A;  4U7Y A;  2D5U A;  2WAU A;  3AE6 A;  3UU8 A;  3N5L A;  4I4T E;  2I59 A;  1OED A;  4AQG A;  2XNU A;  2LHR A;  2XHE B;  2ZMA A;  1MMD A;  1UW6 A;  3NRY A;  1XNR T;  5LXB A;  3KFW X;  4WV9 A;  3KIN B;  3TLS A;  3TLV A;  4PFO A;  1ZV4 X;  2W63 A;  1KNP A;  2H88 A;  4B3T T;  2WDQ A;  4CN4 A;  3DTO A;  4UM1 A;  4QKN A;  4DBR A;  5LP6 E;  2VKJ A;  3MK7 C;  3KVB A;  2A72 A;  1UV6 A;  3AEB A;  2ACX A;  4MAL A;  2BG9 C;  5LBQ B;  2C0S A;  3V5U A;  3AE7 A;  2NTX A;  2CLY B;  4YHJ A;  2PH9 A;  1OWA A;  4CZZ B;  3CX6 B;  1YQ3 A;  2CRB A;  3P4W A;  1OED E;  1L0V A;  2VVS A;  3EAM A;  4X65 T;  1XDP A; 
#chains in the Genus database with same CATH homology
 2WZY A;  1OED C;  2C9T A;  5L4H A;  2KSR A;  5HEU A;  5FJV A;  4IRE A;  2X00 D;  4AFT A;  5IUX A;  3WTK A;  2ZJU A;  3RI5 A;  2YN6 A;  2YMD A;  5AFJ A;  4ZRU A;  3JAD A;  5KZU A;  5HEO A;  3PEO A;  3RIA A;  5J5G A;  4ZJT A;  2XZ6 A;  2Y57 A;  2M6I A;  3UU4 A;  2BYN A;  4QH4 A;  5AFL A;  2QC1 B;  2WNC A;  5LG3 A;  5AFN A;  4Z90 A;  5AFK A;  4QH1 A;  5TVC A;  4TNW A;  4F8H A;  4B5D A;  3UU8 A;  5BW2 A;  5J5I A;  4AFG A;  2WNL A;  4UM3 A;  4TWF A;  4TWH A;  3TLW A;  1OED A;  4HFC A;  4LMK A;  3U8N A;  3U8L A;  2XNU A;  2BG9 A;  3U8K A;  3WTI A;  4PIR A;  3UQ7 A;  3PMZ A;  4ZZC A;  1UW6 A;  2W8G A;  4TNV A;  2PGZ A;  4NZB A;  5LXB A;  2LLY A;  4ZZB A;  2W8F A;  3RIF A;  5AFH A;  2YME A;  5J5F A;  3SIO A;  3WTH A;  3T4M A;  4UY2 A;  3RQW A;  3U8M A;  3ZDG A;  2BYP A;  5J0Z A;  5SYO A;  4A98 A;  4HQP A;  4WV9 A;  5HEG A;  4FRR A;  4X5T A;  3TLS A;  3UUB A;  4IL4 A;  5AIN A;  5HCJ A;  3TLV A;  4Z91 A;  4NPP A;  4ZK1 A;  3ZDH A;  4XHE A;  4BQT A;  4HFE A;  4XK9 A;  2LKH A;  4QH5 A;  4UM3 P;  4IL9 A;  2XQ6 A;  5BP0 A;  3UU5 A;  4A97 A;  4DBM A;  2X00 A;  2BYS A;  2XNV A;  2XNT A;  4LMJ A;  2WN9 A;  2MAW A;  3TLU A;  3RHW A;  2BR7 A;  1OED B;  2M6B A;  4TWD A;  2YKS A;  2BG9 B;  3EI0 A;  2Y7Y A;  5HEJ A;  5CO5 A;  2XYT A;  2XQ7 A;  2BJ0 A;  4UM1 A;  2XZ5 A;  5BRX A;  3U8J A;  1I9B A;  4ILA A;  2BYR A;  4ZJS A;  2BYQ A;  3SH1 A;  3EHZ A;  2LKG A;  5AFM A;  2XQA A;  5CFB A;  5L47 A;  4UM3 S;  4ALX A;  3C84 A;  2UZ6 A;  1UV6 A;  3WTM A;  2BG9 E;  2VL0 A;  5L4E A;  3RQU A;  2LM2 A;  4HFB A;  3SQ6 A;  4LML A;  2XQ8 A;  2Y54 A;  2Y58 A;  2XQ9 A;  4QAB A;  5HEH A;  3ZKR A;  3WTL A;  3TLT A;  4AFH A;  4BFQ A;  5KE4 A;  2BG9 C;  4QAA A;  5HCM A;  2XQ5 A;  3GUA A;  3JAE A;  4ILC A;  5J5H A;  4D01 A;  3WIP A;  2XQ3 A;  4ILB A;  3WTJ A;  5JME A;  3IGQ A;  4COF A;  3UQ4 A;  4QAC A;  2PH9 A;  4HFH A;  1UX2 A;  2XQ4 A;  3P50 A;  3UU6 A;  2XYS A;  2WNJ A;  4ZR6 A;  3LSV A;  2Y56 A;  3WTO A;  3P4W A;  4HFD A;  3UU3 A;  4HFI A;  3SQ9 A;  3WTN A;  2ZJV A;  4EZ1 A;  4UXU A;  1OED E;  2BR8 A;  4ZK4 A;  3C79 A;  3EAM A;  2YOE A;  3JAF A;  5AFM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...