3TLSA

The glic pentameric ligand-gated ion channel e19'p mutant in a locally-closed conformation (lc2 subtype)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVPTNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 91
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlsA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlsA01
2C9TA 5J5IA 3SH1A 2Y54A 5HCJA 2BG9A 3EHZA 3JADA 2XNTA 4AFHA 4HFDA 3WTKA 2XNUA 2LKHA 4FRRA 4HFEA 1OEDB 4NPPA 5KZUA 2LKGA 5HEHA 3UQ7A 5HEGA 2BR7A 4QACA 5L4EA 4UM3P 3U8KA 4D01A 3JAFA 2ZJVA 3UQ4A 4ILBA 2Y58A 2VL0A 2BYSA 5LXBA 4ZR6A 4HFCA 5AFHA 3UU6A 4COFA 4IL9A 3TLVA 2XNVA 4F8HA 4ZZCA 3JAEA 4LMJA 4UM1A 4AFTA 4UY2A 2XQAA 3WTOA 3P4WA 5AFNA 3U8NA 5TVCA 5AFLA 4NZBA 5KE4A 2YN6A 3U8JA 4ZZBA 4QH4A 2ZJUA 5SYOA 2XQ7A 3UU5A 2WN9A 3WTIA 3ZDHA 5J5HA 4ZRUA 2XQ6A 3UU8A 1OEDE 4HQPA 3LSVA 2YOEA 2M6IA 5L47A 3C79A 4TWDA 3GUAA 2XQ9A 3RIFA 4A97A 3C84A 3PEOA 4UM3A 4ILCA 4LMLA 4ZK4A 4HFBA 1I9BA 4B5DA 2PH9A 3WTMA 5AFMB 2BYNA 3P50A 5AFKA 2W8GA 5J0ZA 2XYTA 3TLUA 5J5GA 2WNLA 4BQTA 2LLYA 3RHWA 2XQ8A 2X00A 2X00D 5HEOA 3RIAA 2BYRA 3WTHA 2BG9C 4X5TA 4TWHA 2M6BA 3IGQA 4XK9A 5BW2A 4Z91A 5CFBA 4ALXA 4QABA 3RQWA 4ZJTA 2YMDA 2YMEA 4QAAA 2UZ6A 4TWFA 4LMKA 1UW6A 2YKSA 4Z90A 1UX2A 3ZKRA 2QC1B 3ZDGA 2Y7YA 3TLSA 5AFJA 2XQ4A 2W8FA 4DBMA 4HFHA 5HEUA 2XZ5A 3U8MA 3EI0A 4HFIA 3SQ6A 2XQ5A 3TLTA 3RI5A 2WZYA 2Y56A 3WTJA 4XHEA 5J5FA 3WIPA 5L4HA 2XQ3A 3SQ9A 3T4MA 2MAWA 4IL4A 4A98A 4ZK1A 1UV6A 5BP0A 4UM3S 3PMZA 5HCMA 4TNVA 4IREA 4QH5A 3UUBA 4ILAA 4ZJSA 4UXUA 1OEDA 5CO5A 3TLWA 5AFMA 4WV9A 4QH1A 5AINA 3UU3A 2Y57A 2WNJA 3SIOA 4BFQA 4PIRA 3WTLA 4TNWA 5JMEA 2KSRA 5FJVA 4EZ1A 5LG3A 2BG9E 5HEJA 2WNCA 5IUXA 3U8LA 5BRXA 2BG9B 1OEDC 2BYQA 2XYSA 3WTNA 2LM2A 3EAMA 4AFGA 3UU4A 2BJ0A 2PGZA 3RQUA 2BR8A 2XZ6A 2BYPA
chains in the Genus database with same CATH superfamily
1N33T 3EHZA 3JADA 2CWYA 2D0UA 3KFWX 3AXJA 4HGAA 2A72A 1ZP0A 3UUNA 3ABVA 1US7B 3WTOA 4CXXA 3FZFB 4CI1B 3KV6A 1KNRA 4IE5A 3LSVA 1WLXA 2YOEA 1UX4A 3K8PC 1KNPA 2WDRA 4WZXA 3E0ZA 4GOUA 1ZOYA 3P50A 4U2YA 5M4YA 4DR6T 2WWVA 3ZCIA 4Z8XA 3AE5A 4U3CA 2JQ9A 2VWAA 2LJLA 4PJMA 1MMNA 1YKHB 1BR0A 1UW6A 4Z90A 3ZDGA 1MNDA 2XASB 2WQYA 4AKIA 2AXDS 5DJQC 3KVAA 4XHEA 2PTFA 3RX6A 3SQ9A 1W9RA 3ZN0B 1D0ZA 2YU1A 2WZIA 5CJ5A 2E8IA 2W2UA 4KUMB 5FP3A 5LOVE 2J62A 4ISSA 2BYPA 4DO0A 3N9QA 4H9PC 2Y54A 5LJMA 3UUXB 3QB5A 2WU5A 5KZUA 3RGLA 5HEHA 4MBQA 3BK9A 4O4LE 2BR7A 2RPAA 4UM3P 3ZC0A 4A5XA 2H88A 3UU6A 3UTKA 1D1CA 2I59A 4IDQA 3ZMZB 5AQOB 4H9RC 2Q9QD 2KLQA 3CK6A 2XQ9A 4DR5T 1FMVA 4LMLA 2H7VC 4IIJE 1N32T 5ETWA 2V7LA 3M65A 3TLUA 4DMWA 3ZYMA 4YXDA 5HWXA 4E7ZA 4X65T 3B13A 2YDQA 4DBQA 5CFBA 4ALXA 2YMEA 2N1GA 1T72A 3I0OA 2LHRA 3KBUA 4HFHA 2EHOB 4HFIA 5FYMA 2L3LA 2UUBT 4L0RA 4AQGA 1CHUA 4CI2B 4ILAA 2CXDA 1IBMT 1XNRT 4WV9A 3O4XE 4PK4A 4TZ4C 2X68A 3GN5B 2WSSV 3SH1A 3P4QA 2BG9A 4EXTA 2E9XD 3N9PA 2X67A 3AE8A 3SS1A 2CHNA 4OK0A 3U8KA 3ONXA 4AKLA 5KDMC 3WAJA 4COFA 1L0VA 3UUMA 1I6ZA 3VR9A 2XNVA 4UEMA 3U8NA 5AQSB 5LP6E 3NRYA 3U8JA 4PFOA 2KWHA 4AQFA 3H3MA 4DR2T 5LBQB 5LGUB 2KWIB 5EK3A 4EAHA 3PUXF 4DUYT 4HFBA 2BKPA 2BYNA 4DR1T 5AFKA 2LLYA 1UX5A 1HX1B 4IGUA 2BG9C 2R6GF 1SE7A 4QABA 4ZJTA 3CVRA 1EZ3A 3ZKRA 5JDFA 4CQIA 5FKYA 4OX9T 3SOLA 3RI5A 5LHHB 2WMOA 3T4MA 1D1BA 2VQFT 4UM3S 5AQRB 5ABFB 2IHR1 2K5BB 4JI1T 3TLWA 2HN2A 3LG7A 2UUAT 2WB5A 2IC9A 3AA6B 3P8CD 3RYHE 4ZI2D 2XAHB 2E5LT 3EDVA 5JR9A 3M3ZB 2CCQA 3ZMUB 4GIWA 3R6NA 2XPKA 3T8OA 4K0KT 3PJAA 5HEGA 4O4IE 2WWUA 2Y8DA 2QGSA 2XAGB 4YJ2E 4PJNA 4F8HA 1XWMA 5KE4A 3GWHA 3I1AA 3CQXC 4B3RT 3IA3A 2HHHT 3S4UA 3ANWA 3VHLA 3AEGA 3CWZB 1V9DA 3AECA 1YW0A 4XZCA 4BJMA 1M62A 4NUVA 1D0XA 5LB7B 2YK0A 4HN9A 3PUSA 4L5GA 2X9YA 3WTHA 2IUBA 2KINB 5F3JA 1Z0PA 4MFRA 2V5DA 5C3JA 3KV5A 3NZQA 1NAFA 4LMKA 4QHOA 4P09A 1W09A 4GYSA 5BMVE 2ODUA 2BVMA 2FJAA 2VB6A 2MAWA 3OJAA 3HR0A 2CLYB 3F31A 1UUSA 4DBRA 5AFMA 3U3IA 4X1YE 3OBVE 2XAQB 1XMQT 4OYKA 4CI3B 2PGZA 3VKHA 5LYJE 4DNDA 2K3WA 5AQNB 4AFHA 2XUEA 4ZI3C 2BZBA 2JIWA 1YKEB 1MIWA 3QUJA 5DABA 3AEAA 1VCSA 3ZN1B 3C98B 2Y58A 2VL0A 4ZR6A 5F5WA 3TLVA 3VR8A 1SA0E 3ONLC 5L3BB 5AFNA 2ZM0A 3FXDB 1IZNB 5H6QB 2D5UA 2E2AA 4EIWA 3FZKB 2DWGA 3FHNA 1E7PA 3PUGA 2WN9A 1W0BA 4QXCB 4JV5T 1T8BA 3QB5K 2BKNA 4ZK4A 4DV3T 4HFVA 4U31A 4EEBA 3I9YA 4ZI7E 2EHOC 1QUUA 2YMDA 3PDYA 4YSXA 1KNZA 2KXPB 4UV8B 3MACA 3MZKB 2V8SV 2VVNA 2XQ5A 4IDZA 5J5FA 4DVDA 4ZK1A 1UV6A 2WMNA 4N78D 2KNDA 4UXUA 1HR0T 4LFAT 2XSBA 2V7IA 3KBTA 3MXZA 3AE9A 4PIRA 4AQYT 4M1PA 3U8LA 3AEEA 2E9XB 2D0TA 4ANJA 4AFGA 1YQ4A 4X1IE 2J4GA 3FZMB 4UR9A 1O3XA 2WY2A 3N2OA 5J2UE 4HWIB 1HX8A 2XM1A 2Q9QC 4JUYA 2LKHA 4HFEA 4YSYA 2L8KA 1YD8G 4GKJT 2VKDA 5CA0E 1X79A 3LJCA 4CXYA 2UXNB 5LXBA 1XMOT 4A56A 3ZEFB 5J1GA 4U74A 3VKGA 3HA4A 3KVBA 4I50E 5FXXA 5AQTB 4DV1T 4I4TE 5L3FB 3AEFA 2V6YB 4DR3T 4QH4A 3PTRB 2P9BA 2LRKA 4HWFA 1FMWA 4H9NC 5LMNT 1FEWA 1BR2A 2N2NA 2QYWA 5J0ZA 2NR4A 5E0OA 4IDNA 1WYCA 3LBXA 4NXNT 2X00D 2FUPA 2LSIA 3C64A 2WDQA 4U72A 1NENA 4Z91A 3EUHA 1HG2A 5LGTB 3AEBA 4PW8A 1HNZT 5HEUA 4EZ4A 4K0UA 1LRZA 1AJ3A 3SQ6A 3ETUA 5L2LA 1IJ6A 5FNVE 3C50A 2PBIA 5LHIB 4JI4T 1DU2A 1CUNA 1M7KA 3P4SA 2ZM2A 3AE7A 2LSKA 2MTQA 2WNJA 2JMKA 3A7MA 3AB3B 4H63H 4C91A 4ZEYA 3AE4A 1KK7A 2NTYA 3LK42 2Z6EA 3RYFE 2LKGA 4IE0A 3UQ7A 3JAFA 3CX6B 4HFCA 2MPKA 5HXSA 1HCIA 5HYAA 3JAEA 4KHZF 4WW0A 2JQKA 2QRXA 4DV7T 5JDHA 4PK6A 4ZRUA 4H63V 5JDNA 2JPFA 3QK6A 2B76A 2M6IA 2A9UA 2ZMAA 3C84A 4ILCA 5TAOA 4B5DA 5AQGB 4L9IA 4U33A 2XY8B 4IE7A 4LFCT 2V6XA 5AFUL 3A5XA 3AEDA 5AQPB 2BDEA 1JNZA 4HKAA 3ZMVB 4DUZT 3ANWB 3IGQA 3MJXA 4QAAA 4MHCA 4TWFA 1R8IA 3MK7C 4X64T 2CA5A 2UXDT 2KT9A 1HS7A 4ASKA 1WR6A 2WZYA 2W00A 2Y56A 3RIUA 3WTJA 4TN7B 4LFBT 2V1DB 4C90A 3PV0F 4X20E 5EZYE 4A98A 3VU7H 5JDGA 2DNXA 2LOPA 4ZXLA 2Y57A 4CN1A 2HH7A 2HPJA 5FJVA 2BG9E 5LA6E 1SHZC 5JH7E 2LM2A 2VK9A 3DP7A 1WCRA 4FRRA 5HAXA 2Q9QA 3PJAJ 3HKDE 2MBGA 4D01A 3Q5XA 4NUUA 2XSAA 2YEVC 2CHOA 2WCAA 1OWAA 4CN6A 2ZJUA 1T7SA 5JQGE 2DI4A 3P7IA 4EYYR 3NKZA 3V5UA 5FMNA 1KEYA 4UV9B 2I0MA 3CMLA 5AQJB 3C4WA 3FZHB 4MALA 2V7KA 2X9WA 2NP9A 3WTMA 4EEDA 5AFMB 4YTNA 1X9BA 4LF8T 5FXZA 5JDQA 1KF6A 3CIRA 3RIAA 2BYRA 2CWOA 2WAUA 2OA5A 5BW2A 1Z8UA 3RRCA 3FBZA 2BS2A 2W66A 4NXMT 1UX2A 1ZEEA 2C0SA 4DBMA 2A2FX 4QX7B 2N9DA 3TLTA 1QLBA 5KXJA 2WM9A 3V5SA 4DV2T 2XAJB 4IL4A 5FVKA 5HCMA 4QH5A 1OEDA 4I43B 2FBWA 1IAPA 2NTXA 4PFPA 5LJNA 5IUXA 4DV5T 2IAKA 2VKJA 3HL6A 2FJDA 4BA9A 2C5KT 4U7YA 4AISA 1LVFA 3LDQB 4HWDA 2W4XA 3NBXX 2WS3A 1MIYA 2ES0A 1OEDB 2K48A 3UQ4A 4B3MT 3AE6A 4UXNB 3ZLIA 4O4HE 4ISTA 1NWMX 2I6HA 4JI8T 1J5ET 3DJBA 4YHJA 4AXPA 3ESLA 2YN6A 1SUMB 3RC8A 2DWKA 2LSYA 3CKDA 5FY1A 2AE9A 5KX5E 2V26A 4EYUA 2LT3A 5BR8T 1HG5A 3I0QA 4O2BE 4O8SA 2VASA 2PH9A 2CBJA 5IHYA 3E22E 2XYTA 5ABFA 3RHWA 3IHRA 3N9OA 2B1EA 2BKOA 4JI5T 2M6BA 1UCUA 3A8YC 3F2EA 3CPZA 5FL1A 2UZ6A 4JLEA 3EI0A 1GQEA 3HKCE 3PUWF 4XBFB 2KZ7B 4JI2T 5CB4E 5HXCA 1HNWT 5LG4A 2W62A 4BFQA 2KSRA 5LG3A 2WNCA 2ZM6T 1MIVA 5BRXA 3Q2MA 2BYQA 3LFMA 1XDOA 4DR4T 2XZ6A 4HEAA 5AQKB 4QXBB 5ABEA 4UIGA 3SFEA 4JI6T 4QACA 3I9WA 3ZJ1A 2ZJVA 4YHHT 2BYSA 3KV9A 2X9XA 5AFHA 5LXTE 5LNKA 4CXWA 4IE6A 2PFVA 2LSJA 3CX8B 2X66A 4QXHB 4PJJA 3W15B 4LF7T 5JR9C 2G0UA 4NZBA 2PJQA 4LF9T 2A3DA 3B5MA 3WTIA 3UU8A 4HQPA 2DL1A 1MMDA 3JCFA 4JI7T 4OHFA 3K3NA 5L47A 3C79A 3IBPA 1T98A 5C2TA 5GONE 3JC6D 2XQYA 3N9LA 4P0AA 3D0TA 3FB2A 2LEHA 4KBMB 4WNKA 2ACXA 5DQVA 4V1Av 3BQKA 4DIDB 3ZT6A 2EHOA 5AFJA 3SWHA 2W61A 2VKOA 3RKOA 2V5CA 2K24A 5LCYA 3ZPOA 2BS3A 3T1HT 1D1AA 3AE1A 4KX6A 3AAEB 4GKKT 4IDOA 3UUBA 4LF5T 4ZJSA 3NZPA 1ZHCA 3O1IA 5CA1E 4QH1A 5AINA 3SIOA 4DV0T 4EZ1A 2PG8A 1OEDC 2WU2A 3UU4A 1MMGA 4BJNA 5A1LA 4FI5A 1BR4A 2BBJA 5L3CB 2DLRA 5JREA 2C5JA 2HPLA 4PK5A 4IL9A 4WBNE 5KMGP 2JQHA 1XZYA 4PJLA 1WYBA 3BQLA 3NWIA 4UM1A 1U5PA 2RP4A 3PURA 3E08A 4UELA 3LBXB 4A97A 3PEOA 4YY3T 4WYVA 4LF4T 2F4VT 4AKHA 4B6XA 4O4JE 3C4ZA 3RYIE 4UVCB 3AA1B 2LOSA 3OVUA 3RRWA 2CE7A 2XQ8A 2J47A 1MNEA 3GMIA 3ZMTB 4GK0E 2HN1A 3VRAA 4TWHA 1IJ5A 3QNUA 3HI2A 5JDLA 2V6YA 2QC1B 2YKSA 3OYXA 4ZOLE 3KINB 2CXLA 2V7JA 3ZT7A 3ZC1A 4U7IA 1BR1A 5AQFB 1E2AA 1D0YA 5ABHA 2BVLA 1E1HB 4G63A 1MMAA 3F57A 4FJOA 1YXRA 5HCJA 2E9XA 2NWBA 2DHRA 3AE2A 3JC6C 3UT5E 2KMFA 2E9XC 4ILBA 2CLYC 3L39A 5FY0A 3LK2B 3K3OA 3ZT5A 1HF8A 4EV6A 4UY2A 3P4WA 4TX5A 1VCTA 4GYRA 1B7TA 3SFDA 5C8YE 2CMRA 3BQIA 3RIFA 4G2AA 4KI0F 1I9BA 2CM0A 3MKDA 5ABGA 3DTOA 2LE8A 3K3QC 2VL8A 2QVAA 4DV6T 4TV8E 4X5TA 3CQGB 4ADZA 4WBOA 3AAAB 3SRZA 3QOFA 4GK5E 5JVDE 2CXFA 2Y7YA 3TLSA 4YLHA 2IW5B 3K1SA 5ADXL 3TKLB 4BAYB 5HXHA 5L4HA 4OYJA 3O1HA 3PUQA 4YJ3E 4J2CA 5BP0A 2Y48B 5CO5A 3PUZF 3UU3A 2IIUA 4PAGA 2C5IT 2J1DG 4TNWA 3AVSA 5HEJA 1N34T 3Q5WA 5AQMB 2XYSA 5FVLA 3RQUA 3ZSSA 2VURA 1KFYA 5JRCA 2CEAA 3ONJA 4CZZB 2IC6A 2DCFA 5AQUB 2NW7A 1FIOA 1IBKT 5HXRA 3MA9A 3OYZA 4B3ST 2W67A 5AFLA 2XZEA 4LF6T 1I94T 4CN4A 2XQ7A 1YQ3A 3ZDHA 5J5HA 2NOXA 4UM3A 3UULA 3C4XA 2WP9A 3PUAA 4IDPA 4JYAT 3R84B 1S35A 2RA1A 5J5GA 1LKXA 4HWHA 2L9QA 2ZLYA 2UXXB 2XTLA 3N5LA 2BS4A 3AAIA 2LM9A 3Q9DA 4YTPA 2LRLA 5AQVB 5JTGA 3AA0B 4ZS3A 4ZS2A 3L8RA 4QWNB 2XJ7A 2YDSA 1OXZA 3PMZA 4X66T 3PE0A 4H9OC 4JI0T 2UXCT 2ODVA 4DR7T 2XM2A 5L3DB 1G73A 3EAMA 3LK3B 2BR8A 5JR9B 2C9TA 5EK2A 3HKEE 2D2SA 3NRXA 3RF1A 4YFSA 3PUYF 2W63A 4XAXB 1UK5A 1S94A 2UUCT 2K9AA 2LHNA 2M67A 2MYSA 2JQQA 2LSGA 3UFGA 5L3GB 3UFEA 2V7MA 1Y01A 3P4PA 3EABA 4LMJA 4P1NA 3WI3A 3RC3A 3L09A 1HNXT 2X51A 5FXVA 3OPCA 4ZI2C 5TVCA 5HXEA 3WAKA 4MLKA 5LHGB 3FXEB 3AA7B 4JI3T 4U2ZA 3KDSE 5LGNB 2CRBA 3RIUC 3N9NA 4O2AE 5J2TE 3O1JA 2WDVA 1WR0A 4AI6A 4TV9E 2WNLA 3ETVA 3CQCB 3PUVF 3ZYLA 2JJ9A 4YSZA 4UF0A 4X1KE 3RQWA 3J9X1 1J5WA 4AKRB 1U4QA 3T1YT 3RKGA 2XQ4A 2W8FA 1H7CA 5DQWA 5HWYA 4UF0B 3AE3A 2YDRA 3VRBA 2IDOB 3WIPA 2XQ3A 4TUYE 4KP3C 1J1JA 5LBMA 4IREA 1WFDA 1ZKEA 4ILUA 2UU9T 4KMCA 2BG9B 3EVYA 3RLFF 3FBLA 4H9SE 3ZJ2A 3GN5A 4P0BA 5J5IA 2ACZA 1WRDA 2XNTA 1N36T 2X0YA 1NEKA 3PU3A 4EGWA 4NPPA 1ZV4X 3NVOA 4AIUA 5L4EA 5IWAT 5AQHB 4KHPT 4E7SA 4ZZCA 2Q9QB 4AFTA 4YT0A 2XQAA 5FY7A 4PNIA 3G06A 4ZZBA 2YU2A 4AQFC 5SYOA 3UU5A 4YTMA 1OEDE 1FJGT 3HKBE 3RH3A 3EDUA 3GUAA 3J7Yq 2MOZA 3ZMSB 3CX7B 2H3RA 5JDMA 2XHEB 5AQLB 5EK4A 2W8GA 4BQTA 2WBLA 3H3AA 2X00A 2OV9A 4QX8B 5HEOA 2Y6XA 4IT4A 4XK9A 2FJEA 3U78A 2UXBT 3RYCE 3ZSTA 3QC9A 5IYZE 4UVAB 5AQIB 2SPCA 1UURA 1UGOA 4JBWF 2JMHA 2VVSA 4IE4A 4DMVA 2E5VA 2QA7A 3FZLB 2EHOD 2H89A 3OKQA 3L3PA 4EZHA 3WTLA 3OTOT 2OLTA 3N2GE 2VKHA 4HWCA 4HTEA 4UVBB 1QSDA 2X9HA 2X0LB 2D9DA 3IF8B 4B3TT 4HFDA 3ZYKA 3WTKA 2XNUA 2FJBA 3AVRA 3B57A 3RPUA 4ZHQE 2JRKA 2GK9A 4ZI3D 5F8PA 1JNRA 4JEHB 1VRBA 3N2KE 4EB6E 2CPTA 5FXWA 2ZM8A 5CGMA 4AKGA 5LMUT 1LVKA 4Q25A 1VOMA 5JRCB 2W0GA 4OFZA 2XQ6A 2NW9A 3O9XA 2X0HA 3Q5DA 4IHJE 4TWDA 2VQET 2YINA 2CBIA 1G8XA 2XAFB 4I55E 4ERRA 3PU8A 2WZHA 3KV4A 3H37A 4EOZB 4X62T 4F6RC 2NW8A 1HFAA 5AQQB 1IBLT 3GA8A 3IEEA 3Q5EA 3P4RA 3N9MA 4HE8A 2XZ5A 3U8MA 4JEUB 1Y64B 4NIQA 1W0AA 1XNQT 2BBHA 4TNVA 5FL0A 2H7OA 5L3EB 3AXJB 2IMLA 1XDPA 4I0UA 4QKNA 5JMEA 3C51A 3X1DA 3ZCJA 1HTJF 5H6RB 3WTNA 2BJ0A 4DV4T 4H9QC
chains in the Genus database with same CATH topology
2C9TA 5J5IA 3SH1A 2Y54A 5HCJA 2BG9A 3EHZA 3JADA 2XNTA 4AFHA 4HFDA 3WTKA 2XNUA 2LKHA 4FRRA 4HFEA 1OEDB 4NPPA 5KZUA 2LKGA 5HEHA 3UQ7A 5HEGA 2BR7A 4QACA 5L4EA 4UM3P 3U8KA 4D01A 3JAFA 2ZJVA 3UQ4A 4ILBA 2Y58A 2VL0A 2BYSA 5LXBA 4ZR6A 4HFCA 5AFHA 3UU6A 4COFA 4IL9A 3TLVA 2XNVA 4F8HA 4ZZCA 3JAEA 4LMJA 4UM1A 4AFTA 4UY2A 2XQAA 3WTOA 3P4WA 5AFNA 3U8NA 5TVCA 5AFLA 4NZBA 5KE4A 2YN6A 3U8JA 4ZZBA 4QH4A 2ZJUA 5SYOA 2XQ7A 3UU5A 2WN9A 3WTIA 3ZDHA 5J5HA 4ZRUA 2XQ6A 3UU8A 1OEDE 4HQPA 3LSVA 2YOEA 2M6IA 5L47A 3C79A 4TWDA 3GUAA 2XQ9A 3RIFA 4A97A 3C84A 3PEOA 4UM3A 4ILCA 4LMLA 4ZK4A 4HFBA 1I9BA 4B5DA 2PH9A 3WTMA 5AFMB 2BYNA 3P50A 5AFKA 2W8GA 5J0ZA 2XYTA 3TLUA 5J5GA 2WNLA 4BQTA 2LLYA 3RHWA 2XQ8A 2X00A 2X00D 5HEOA 3RIAA 2BYRA 3WTHA 2BG9C 4X5TA 4TWHA 2M6BA 3IGQA 4XK9A 5BW2A 4Z91A 5CFBA 4ALXA 4QABA 3RQWA 4ZJTA 2YMDA 2YMEA 4QAAA 2UZ6A 4TWFA 4LMKA 1UW6A 2YKSA 4Z90A 1UX2A 3ZKRA 2QC1B 3ZDGA 2Y7YA 3TLSA 5AFJA 2XQ4A 2W8FA 4DBMA 4HFHA 5HEUA 2XZ5A 3U8MA 3EI0A 4HFIA 3SQ6A 2XQ5A 3TLTA 3RI5A 2WZYA 2Y56A 3WTJA 4XHEA 5J5FA 3WIPA 5L4HA 2XQ3A 3SQ9A 3T4MA 2MAWA 4IL4A 4A98A 4ZK1A 1UV6A 5BP0A 4UM3S 3PMZA 5HCMA 4TNVA 4IREA 4QH5A 3UUBA 4ILAA 4ZJSA 4UXUA 1OEDA 5CO5A 3TLWA 5AFMA 4WV9A 4QH1A 5AINA 3UU3A 2Y57A 2WNJA 3SIOA 4BFQA 4PIRA 3WTLA 4TNWA 5JMEA 2KSRA 5FJVA 4EZ1A 5LG3A 2BG9E 5HEJA 2WNCA 5IUXA 3U8LA 5BRXA 2BG9B 1OEDC 2BYQA 2XYSA 3WTNA 2LM2A 3EAMA 4AFGA 3UU4A 2BJ0A 2PGZA 3RQUA 2BR8A 2XZ6A 2BYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C9T A;  5J5I A;  3SH1 A;  2Y54 A;  5HCJ A;  2BG9 A;  3EHZ A;  3JAD A;  2XNT A;  4AFH A;  4HFD A;  3WTK A;  2XNU A;  2LKH A;  4FRR A;  4HFE A;  1OED B;  4NPP A;  5KZU A;  2LKG A;  5HEH A;  3UQ7 A;  5HEG A;  2BR7 A;  4QAC A;  5L4E A;  4UM3 P;  3U8K A;  4D01 A;  3JAF A;  2ZJV A;  3UQ4 A;  4ILB A;  2Y58 A;  2VL0 A;  2BYS A;  5LXB A;  4ZR6 A;  4HFC A;  5AFH A;  3UU6 A;  4COF A;  4IL9 A;  3TLV A;  2XNV A;  4F8H A;  4ZZC A;  3JAE A;  4LMJ A;  4UM1 A;  4AFT A;  4UY2 A;  2XQA A;  3WTO A;  3P4W A;  5AFN A;  3U8N A;  5TVC A;  5AFL A;  4NZB A;  5KE4 A;  2YN6 A;  3U8J A;  4ZZB A;  4QH4 A;  2ZJU A;  5SYO A;  2XQ7 A;  3UU5 A;  2WN9 A;  3WTI A;  3ZDH A;  5J5H A;  4ZRU A;  2XQ6 A;  3UU8 A;  1OED E;  4HQP A;  3LSV A;  2YOE A;  2M6I A;  5L47 A;  3C79 A;  4TWD A;  3GUA A;  2XQ9 A;  3RIF A;  4A97 A;  3C84 A;  3PEO A;  4UM3 A;  4ILC A;  4LML A;  4ZK4 A;  4HFB A;  1I9B A;  4B5D A;  2PH9 A;  3WTM A;  5AFM B;  2BYN A;  3P50 A;  5AFK A;  2W8G A;  5J0Z A;  2XYT A;  3TLU A;  5J5G A;  2WNL A;  4BQT A;  2LLY A;  3RHW A;  2XQ8 A;  2X00 A;  2X00 D;  5HEO A;  3RIA A;  2BYR A;  3WTH A;  2BG9 C;  4X5T A;  4TWH A;  2M6B A;  3IGQ A;  4XK9 A;  5BW2 A;  4Z91 A;  5CFB A;  4ALX A;  4QAB A;  3RQW A;  4ZJT A;  2YMD A;  2YME A;  4QAA A;  2UZ6 A;  4TWF A;  4LMK A;  1UW6 A;  2YKS A;  4Z90 A;  1UX2 A;  3ZKR A;  2QC1 B;  3ZDG A;  2Y7Y A;  3TLS A;  5AFJ A;  2XQ4 A;  2W8F A;  4DBM A;  4HFH A;  5HEU A;  2XZ5 A;  3U8M A;  3EI0 A;  4HFI A;  3SQ6 A;  2XQ5 A;  3TLT A;  3RI5 A;  2WZY A;  2Y56 A;  3WTJ A;  4XHE A;  5J5F A;  3WIP A;  5L4H A;  2XQ3 A;  3SQ9 A;  3T4M A;  2MAW A;  4IL4 A;  4A98 A;  4ZK1 A;  1UV6 A;  5BP0 A;  4UM3 S;  3PMZ A;  5HCM A;  4TNV A;  4IRE A;  4QH5 A;  3UUB A;  4ILA A;  4ZJS A;  4UXU A;  1OED A;  5CO5 A;  3TLW A;  5AFM A;  4WV9 A;  4QH1 A;  5AIN A;  3UU3 A;  2Y57 A;  2WNJ A;  3SIO A;  4BFQ A;  4PIR A;  3WTL A;  4TNW A;  5JME A;  2KSR A;  5FJV A;  4EZ1 A;  5LG3 A;  2BG9 E;  5HEJ A;  2WNC A;  5IUX A;  3U8L A;  5BRX A;  2BG9 B;  1OED C;  2BYQ A;  2XYS A;  3WTN A;  2LM2 A;  3EAM A;  4AFG A;  3UU4 A;  2BJ0 A;  2PGZ A;  3RQU A;  2BR8 A;  2XZ6 A;  2BYP A; 
#chains in the Genus database with same CATH topology
 1N33 T;  3EHZ A;  3JAD A;  2CWY A;  2D0U A;  3KFW X;  3AXJ A;  4HGA A;  2A72 A;  1ZP0 A;  3UUN A;  3ABV A;  1US7 B;  3WTO A;  4CXX A;  3FZF B;  4CI1 B;  3KV6 A;  1KNR A;  4IE5 A;  3LSV A;  1WLX A;  2YOE A;  1UX4 A;  3K8P C;  1KNP A;  2WDR A;  4WZX A;  3E0Z A;  4GOU A;  1ZOY A;  3P50 A;  4U2Y A;  5M4Y A;  4DR6 T;  2WWV A;  3ZCI A;  4Z8X A;  3AE5 A;  4U3C A;  2JQ9 A;  2VWA A;  2LJL A;  4PJM A;  1MMN A;  1YKH B;  1BR0 A;  1UW6 A;  4Z90 A;  3ZDG A;  1MND A;  2XAS B;  2WQY A;  4AKI A;  2AXD S;  5DJQ C;  3KVA A;  4XHE A;  2PTF A;  3RX6 A;  3SQ9 A;  1W9R A;  3ZN0 B;  1D0Z A;  2YU1 A;  2WZI A;  5CJ5 A;  2E8I A;  2W2U A;  4KUM B;  5FP3 A;  5LOV E;  2J62 A;  4ISS A;  2BYP A;  4DO0 A;  3N9Q A;  4H9P C;  2Y54 A;  5LJM A;  3UUX B;  3QB5 A;  2WU5 A;  5KZU A;  3RGL A;  5HEH A;  4MBQ A;  3BK9 A;  4O4L E;  2BR7 A;  2RPA A;  4UM3 P;  3ZC0 A;  4A5X A;  2H88 A;  3UU6 A;  3UTK A;  1D1C A;  2I59 A;  4IDQ A;  3ZMZ B;  5AQO B;  4H9R C;  2Q9Q D;  2KLQ A;  3CK6 A;  2XQ9 A;  4DR5 T;  1FMV A;  4LML A;  2H7V C;  4IIJ E;  1N32 T;  5ETW A;  2V7L A;  3M65 A;  3TLU A;  4DMW A;  3ZYM A;  4YXD A;  5HWX A;  4E7Z A;  4X65 T;  3B13 A;  2YDQ A;  4DBQ A;  5CFB A;  4ALX A;  2YME A;  2N1G A;  1T72 A;  3I0O A;  2LHR A;  3KBU A;  4HFH A;  2EHO B;  4HFI A;  5FYM A;  2L3L A;  2UUB T;  4L0R A;  4AQG A;  1CHU A;  4CI2 B;  4ILA A;  2CXD A;  1IBM T;  1XNR T;  4WV9 A;  3O4X E;  4PK4 A;  4TZ4 C;  2X68 A;  3GN5 B;  2WSS V;  3SH1 A;  3P4Q A;  2BG9 A;  4EXT A;  2E9X D;  3N9P A;  2X67 A;  3AE8 A;  3SS1 A;  2CHN A;  4OK0 A;  3U8K A;  3ONX A;  4AKL A;  5KDM C;  3WAJ A;  4COF A;  1L0V A;  3UUM A;  1I6Z A;  3VR9 A;  2XNV A;  4UEM A;  3U8N A;  5AQS B;  5LP6 E;  3NRY A;  3U8J A;  4PFO A;  2KWH A;  4AQF A;  3H3M A;  4DR2 T;  5LBQ B;  5LGU B;  2KWI B;  5EK3 A;  4EAH A;  3PUX F;  4DUY T;  4HFB A;  2BKP A;  2BYN A;  4DR1 T;  5AFK A;  2LLY A;  1UX5 A;  1HX1 B;  4IGU A;  2BG9 C;  2R6G F;  1SE7 A;  4QAB A;  4ZJT A;  3CVR A;  1EZ3 A;  3ZKR A;  5JDF A;  4CQI A;  5FKY A;  4OX9 T;  3SOL A;  3RI5 A;  5LHH B;  2WMO A;  3T4M A;  1D1B A;  2VQF T;  4UM3 S;  5AQR B;  5ABF B;  2IHR 1;  2K5B B;  4JI1 T;  3TLW A;  2HN2 A;  3LG7 A;  2UUA T;  2WB5 A;  2IC9 A;  3AA6 B;  3P8C D;  3RYH E;  4ZI2 D;  2XAH B;  2E5L T;  3EDV A;  5JR9 A;  3M3Z B;  2CCQ A;  3ZMU B;  4GIW A;  3R6N A;  2XPK A;  3T8O A;  4K0K T;  3PJA A;  5HEG A;  4O4I E;  2WWU A;  2Y8D A;  2QGS A;  2XAG B;  4YJ2 E;  4PJN A;  4F8H A;  1XWM A;  5KE4 A;  3GWH A;  3I1A A;  3CQX C;  4B3R T;  3IA3 A;  2HHH T;  3S4U A;  3ANW A;  3VHL A;  3AEG A;  3CWZ B;  1V9D A;  3AEC A;  1YW0 A;  4XZC A;  4BJM A;  1M62 A;  4NUV A;  1D0X A;  5LB7 B;  2YK0 A;  4HN9 A;  3PUS A;  4L5G A;  2X9Y A;  3WTH A;  2IUB A;  2KIN B;  5F3J A;  1Z0P A;  4MFR A;  2V5D A;  5C3J A;  3KV5 A;  3NZQ A;  1NAF A;  4LMK A;  4QHO A;  4P09 A;  1W09 A;  4GYS A;  5BMV E;  2ODU A;  2BVM A;  2FJA A;  2VB6 A;  2MAW A;  3OJA A;  3HR0 A;  2CLY B;  3F31 A;  1UUS A;  4DBR A;  5AFM A;  3U3I A;  4X1Y E;  3OBV E;  2XAQ B;  1XMQ T;  4OYK A;  4CI3 B;  2PGZ A;  3VKH A;  5LYJ E;  4DND A;  2K3W A;  5AQN B;  4AFH A;  2XUE A;  4ZI3 C;  2BZB A;  2JIW A;  1YKE B;  1MIW A;  3QUJ A;  5DAB A;  3AEA A;  1VCS A;  3ZN1 B;  3C98 B;  2Y58 A;  2VL0 A;  4ZR6 A;  5F5W A;  3TLV A;  3VR8 A;  1SA0 E;  3ONL C;  5L3B B;  5AFN A;  2ZM0 A;  3FXD B;  1IZN B;  5H6Q B;  2D5U A;  2E2A A;  4EIW A;  3FZK B;  2DWG A;  3FHN A;  1E7P A;  3PUG A;  2WN9 A;  1W0B A;  4QXC B;  4JV5 T;  1T8B A;  3QB5 K;  2BKN A;  4ZK4 A;  4DV3 T;  4HFV A;  4U31 A;  4EEB A;  3I9Y A;  4ZI7 E;  2EHO C;  1QUU A;  2YMD A;  3PDY A;  4YSX A;  1KNZ A;  2KXP B;  4UV8 B;  3MAC A;  3MZK B;  2V8S V;  2VVN A;  2XQ5 A;  4IDZ A;  5J5F A;  4DVD A;  4ZK1 A;  1UV6 A;  2WMN A;  4N78 D;  2KND A;  4UXU A;  1HR0 T;  4LFA T;  2XSB A;  2V7I A;  3KBT A;  3MXZ A;  3AE9 A;  4PIR A;  4AQY T;  4M1P A;  3U8L A;  3AEE A;  2E9X B;  2D0T A;  4ANJ A;  4AFG A;  1YQ4 A;  4X1I E;  2J4G A;  3FZM B;  4UR9 A;  1O3X A;  2WY2 A;  3N2O A;  5J2U E;  4HWI B;  1HX8 A;  2XM1 A;  2Q9Q C;  4JUY A;  2LKH A;  4HFE A;  4YSY A;  2L8K A;  1YD8 G;  4GKJ T;  2VKD A;  5CA0 E;  1X79 A;  3LJC A;  4CXY A;  2UXN B;  5LXB A;  1XMO T;  4A56 A;  3ZEF B;  5J1G A;  4U74 A;  3VKG A;  3HA4 A;  3KVB A;  4I50 E;  5FXX A;  5AQT B;  4DV1 T;  4I4T E;  5L3F B;  3AEF A;  2V6Y B;  4DR3 T;  4QH4 A;  3PTR B;  2P9B A;  2LRK A;  4HWF A;  1FMW A;  4H9N C;  5LMN T;  1FEW A;  1BR2 A;  2N2N A;  2QYW A;  5J0Z A;  2NR4 A;  5E0O A;  4IDN A;  1WYC A;  3LBX A;  4NXN T;  2X00 D;  2FUP A;  2LSI A;  3C64 A;  2WDQ A;  4U72 A;  1NEN A;  4Z91 A;  3EUH A;  1HG2 A;  5LGT B;  3AEB A;  4PW8 A;  1HNZ T;  5HEU A;  4EZ4 A;  4K0U A;  1LRZ A;  1AJ3 A;  3SQ6 A;  3ETU A;  5L2L A;  1IJ6 A;  5FNV E;  3C50 A;  2PBI A;  5LHI B;  4JI4 T;  1DU2 A;  1CUN A;  1M7K A;  3P4S A;  2ZM2 A;  3AE7 A;  2LSK A;  2MTQ A;  2WNJ A;  2JMK A;  3A7M A;  3AB3 B;  4H63 H;  4C91 A;  4ZEY A;  3AE4 A;  1KK7 A;  2NTY A;  3LK4 2;  2Z6E A;  3RYF E;  2LKG A;  4IE0 A;  3UQ7 A;  3JAF A;  3CX6 B;  4HFC A;  2MPK A;  5HXS A;  1HCI A;  5HYA A;  3JAE A;  4KHZ F;  4WW0 A;  2JQK A;  2QRX A;  4DV7 T;  5JDH A;  4PK6 A;  4ZRU A;  4H63 V;  5JDN A;  2JPF A;  3QK6 A;  2B76 A;  2M6I A;  2A9U A;  2ZMA A;  3C84 A;  4ILC A;  5TAO A;  4B5D A;  5AQG B;  4L9I A;  4U33 A;  2XY8 B;  4IE7 A;  4LFC T;  2V6X A;  5AFU L;  3A5X A;  3AED A;  5AQP B;  2BDE A;  1JNZ A;  4HKA A;  3ZMV B;  4DUZ T;  3ANW B;  3IGQ A;  3MJX A;  4QAA A;  4MHC A;  4TWF A;  1R8I A;  3MK7 C;  4X64 T;  2CA5 A;  2UXD T;  2KT9 A;  1HS7 A;  4ASK A;  1WR6 A;  2WZY A;  2W00 A;  2Y56 A;  3RIU A;  3WTJ A;  4TN7 B;  4LFB T;  2V1D B;  4C90 A;  3PV0 F;  4X20 E;  5EZY E;  4A98 A;  3VU7 H;  5JDG A;  2DNX A;  2LOP A;  4ZXL A;  2Y57 A;  4CN1 A;  2HH7 A;  2HPJ A;  5FJV A;  2BG9 E;  5LA6 E;  1SHZ C;  5JH7 E;  2LM2 A;  2VK9 A;  3DP7 A;  1WCR A;  4FRR A;  5HAX A;  2Q9Q A;  3PJA J;  3HKD E;  2MBG A;  4D01 A;  3Q5X A;  4NUU A;  2XSA A;  2YEV C;  2CHO A;  2WCA A;  1OWA A;  4CN6 A;  2ZJU A;  1T7S A;  5JQG E;  2DI4 A;  3P7I A;  4EYY R;  3NKZ A;  3V5U A;  5FMN A;  1KEY A;  4UV9 B;  2I0M A;  3CML A;  5AQJ B;  3C4W A;  3FZH B;  4MAL A;  2V7K A;  2X9W A;  2NP9 A;  3WTM A;  4EED A;  5AFM B;  4YTN A;  1X9B A;  4LF8 T;  5FXZ A;  5JDQ A;  1KF6 A;  3CIR A;  3RIA A;  2BYR A;  2CWO A;  2WAU A;  2OA5 A;  5BW2 A;  1Z8U A;  3RRC A;  3FBZ A;  2BS2 A;  2W66 A;  4NXM T;  1UX2 A;  1ZEE A;  2C0S A;  4DBM A;  2A2F X;  4QX7 B;  2N9D A;  3TLT A;  1QLB A;  5KXJ A;  2WM9 A;  3V5S A;  4DV2 T;  2XAJ B;  4IL4 A;  5FVK A;  5HCM A;  4QH5 A;  1OED A;  4I43 B;  2FBW A;  1IAP A;  2NTX A;  4PFP A;  5LJN A;  5IUX A;  4DV5 T;  2IAK A;  2VKJ A;  3HL6 A;  2FJD A;  4BA9 A;  2C5K T;  4U7Y A;  4AIS A;  1LVF A;  3LDQ B;  4HWD A;  2W4X A;  3NBX X;  2WS3 A;  1MIY A;  2ES0 A;  1OED B;  2K48 A;  3UQ4 A;  4B3M T;  3AE6 A;  4UXN B;  3ZLI A;  4O4H E;  4IST A;  1NWM X;  2I6H A;  4JI8 T;  1J5E T;  3DJB A;  4YHJ A;  4AXP A;  3ESL A;  2YN6 A;  1SUM B;  3RC8 A;  2DWK A;  2LSY A;  3CKD A;  5FY1 A;  2AE9 A;  5KX5 E;  2V26 A;  4EYU A;  2LT3 A;  5BR8 T;  1HG5 A;  3I0Q A;  4O2B E;  4O8S A;  2VAS A;  2PH9 A;  2CBJ A;  5IHY A;  3E22 E;  2XYT A;  5ABF A;  3RHW A;  3IHR A;  3N9O A;  2B1E A;  2BKO A;  4JI5 T;  2M6B A;  1UCU A;  3A8Y C;  3F2E A;  3CPZ A;  5FL1 A;  2UZ6 A;  4JLE A;  3EI0 A;  1GQE A;  3HKC E;  3PUW F;  4XBF B;  2KZ7 B;  4JI2 T;  5CB4 E;  5HXC A;  1HNW T;  5LG4 A;  2W62 A;  4BFQ A;  2KSR A;  5LG3 A;  2WNC A;  2ZM6 T;  1MIV A;  5BRX A;  3Q2M A;  2BYQ A;  3LFM A;  1XDO A;  4DR4 T;  2XZ6 A;  4HEA A;  5AQK B;  4QXB B;  5ABE A;  4UIG A;  3SFE A;  4JI6 T;  4QAC A;  3I9W A;  3ZJ1 A;  2ZJV A;  4YHH T;  2BYS A;  3KV9 A;  2X9X A;  5AFH A;  5LXT E;  5LNK A;  4CXW A;  4IE6 A;  2PFV A;  2LSJ A;  3CX8 B;  2X66 A;  4QXH B;  4PJJ A;  3W15 B;  4LF7 T;  5JR9 C;  2G0U A;  4NZB A;  2PJQ A;  4LF9 T;  2A3D A;  3B5M A;  3WTI A;  3UU8 A;  4HQP A;  2DL1 A;  1MMD A;  3JCF A;  4JI7 T;  4OHF A;  3K3N A;  5L47 A;  3C79 A;  3IBP A;  1T98 A;  5C2T A;  5GON E;  3JC6 D;  2XQY A;  3N9L A;  4P0A A;  3D0T A;  3FB2 A;  2LEH A;  4KBM B;  4WNK A;  2ACX A;  5DQV A;  4V1A v;  3BQK A;  4DID B;  3ZT6 A;  2EHO A;  5AFJ A;  3SWH A;  2W61 A;  2VKO A;  3RKO A;  2V5C A;  2K24 A;  5LCY A;  3ZPO A;  2BS3 A;  3T1H T;  1D1A A;  3AE1 A;  4KX6 A;  3AAE B;  4GKK T;  4IDO A;  3UUB A;  4LF5 T;  4ZJS A;  3NZP A;  1ZHC A;  3O1I A;  5CA1 E;  4QH1 A;  5AIN A;  3SIO A;  4DV0 T;  4EZ1 A;  2PG8 A;  1OED C;  2WU2 A;  3UU4 A;  1MMG A;  4BJN A;  5A1L A;  4FI5 A;  1BR4 A;  2BBJ A;  5L3C B;  2DLR A;  5JRE A;  2C5J A;  2HPL A;  4PK5 A;  4IL9 A;  4WBN E;  5KMG P;  2JQH A;  1XZY A;  4PJL A;  1WYB A;  3BQL A;  3NWI A;  4UM1 A;  1U5P A;  2RP4 A;  3PUR A;  3E08 A;  4UEL A;  3LBX B;  4A97 A;  3PEO A;  4YY3 T;  4WYV A;  4LF4 T;  2F4V T;  4AKH A;  4B6X A;  4O4J E;  3C4Z A;  3RYI E;  4UVC B;  3AA1 B;  2LOS A;  3OVU A;  3RRW A;  2CE7 A;  2XQ8 A;  2J47 A;  1MNE A;  3GMI A;  3ZMT B;  4GK0 E;  2HN1 A;  3VRA A;  4TWH A;  1IJ5 A;  3QNU A;  3HI2 A;  5JDL A;  2V6Y A;  2QC1 B;  2YKS A;  3OYX A;  4ZOL E;  3KIN B;  2CXL A;  2V7J A;  3ZT7 A;  3ZC1 A;  4U7I A;  1BR1 A;  5AQF B;  1E2A A;  1D0Y A;  5ABH A;  2BVL A;  1E1H B;  4G63 A;  1MMA A;  3F57 A;  4FJO A;  1YXR A;  5HCJ A;  2E9X A;  2NWB A;  2DHR A;  3AE2 A;  3JC6 C;  3UT5 E;  2KMF A;  2E9X C;  4ILB A;  2CLY C;  3L39 A;  5FY0 A;  3LK2 B;  3K3O A;  3ZT5 A;  1HF8 A;  4EV6 A;  4UY2 A;  3P4W A;  4TX5 A;  1VCT A;  4GYR A;  1B7T A;  3SFD A;  5C8Y E;  2CMR A;  3BQI A;  3RIF A;  4G2A A;  4KI0 F;  1I9B A;  2CM0 A;  3MKD A;  5ABG A;  3DTO A;  2LE8 A;  3K3Q C;  2VL8 A;  2QVA A;  4DV6 T;  4TV8 E;  4X5T A;  3CQG B;  4ADZ A;  4WBO A;  3AAA B;  3SRZ A;  3QOF A;  4GK5 E;  5JVD E;  2CXF A;  2Y7Y A;  3TLS A;  4YLH A;  2IW5 B;  3K1S A;  5ADX L;  3TKL B;  4BAY B;  5HXH A;  5L4H A;  4OYJ A;  3O1H A;  3PUQ A;  4YJ3 E;  4J2C A;  5BP0 A;  2Y48 B;  5CO5 A;  3PUZ F;  3UU3 A;  2IIU A;  4PAG A;  2C5I T;  2J1D G;  4TNW A;  3AVS A;  5HEJ A;  1N34 T;  3Q5W A;  5AQM B;  2XYS A;  5FVL A;  3RQU A;  3ZSS A;  2VUR A;  1KFY A;  5JRC A;  2CEA A;  3ONJ A;  4CZZ B;  2IC6 A;  2DCF A;  5AQU B;  2NW7 A;  1FIO A;  1IBK T;  5HXR A;  3MA9 A;  3OYZ A;  4B3S T;  2W67 A;  5AFL A;  2XZE A;  4LF6 T;  1I94 T;  4CN4 A;  2XQ7 A;  1YQ3 A;  3ZDH A;  5J5H A;  2NOX A;  4UM3 A;  3UUL A;  3C4X A;  2WP9 A;  3PUA A;  4IDP A;  4JYA T;  3R84 B;  1S35 A;  2RA1 A;  5J5G A;  1LKX A;  4HWH A;  2L9Q A;  2ZLY A;  2UXX B;  2XTL A;  3N5L A;  2BS4 A;  3AAI A;  2LM9 A;  3Q9D A;  4YTP A;  2LRL A;  5AQV B;  5JTG A;  3AA0 B;  4ZS3 A;  4ZS2 A;  3L8R A;  4QWN B;  2XJ7 A;  2YDS A;  1OXZ A;  3PMZ A;  4X66 T;  3PE0 A;  4H9O C;  4JI0 T;  2UXC T;  2ODV A;  4DR7 T;  2XM2 A;  5L3D B;  1G73 A;  3EAM A;  3LK3 B;  2BR8 A;  5JR9 B;  2C9T A;  5EK2 A;  3HKE E;  2D2S A;  3NRX A;  3RF1 A;  4YFS A;  3PUY F;  2W63 A;  4XAX B;  1UK5 A;  1S94 A;  2UUC T;  2K9A A;  2LHN A;  2M67 A;  2MYS A;  2JQQ A;  2LSG A;  3UFG A;  5L3G B;  3UFE A;  2V7M A;  1Y01 A;  3P4P A;  3EAB A;  4LMJ A;  4P1N A;  3WI3 A;  3RC3 A;  3L09 A;  1HNX T;  2X51 A;  5FXV A;  3OPC A;  4ZI2 C;  5TVC A;  5HXE A;  3WAK A;  4MLK A;  5LHG B;  3FXE B;  3AA7 B;  4JI3 T;  4U2Z A;  3KDS E;  5LGN B;  2CRB A;  3RIU C;  3N9N A;  4O2A E;  5J2T E;  3O1J A;  2WDV A;  1WR0 A;  4AI6 A;  4TV9 E;  2WNL A;  3ETV A;  3CQC B;  3PUV F;  3ZYL A;  2JJ9 A;  4YSZ A;  4UF0 A;  4X1K E;  3RQW A;  3J9X 1;  1J5W A;  4AKR B;  1U4Q A;  3T1Y T;  3RKG A;  2XQ4 A;  2W8F A;  1H7C A;  5DQW A;  5HWY A;  4UF0 B;  3AE3 A;  2YDR A;  3VRB A;  2IDO B;  3WIP A;  2XQ3 A;  4TUY E;  4KP3 C;  1J1J A;  5LBM A;  4IRE A;  1WFD A;  1ZKE A;  4ILU A;  2UU9 T;  4KMC A;  2BG9 B;  3EVY A;  3RLF F;  3FBL A;  4H9S E;  3ZJ2 A;  3GN5 A;  4P0B A;  5J5I A;  2ACZ A;  1WRD A;  2XNT A;  1N36 T;  2X0Y A;  1NEK A;  3PU3 A;  4EGW A;  4NPP A;  1ZV4 X;  3NVO A;  4AIU A;  5L4E A;  5IWA T;  5AQH B;  4KHP T;  4E7S A;  4ZZC A;  2Q9Q B;  4AFT A;  4YT0 A;  2XQA A;  5FY7 A;  4PNI A;  3G06 A;  4ZZB A;  2YU2 A;  4AQF C;  5SYO A;  3UU5 A;  4YTM A;  1OED E;  1FJG T;  3HKB E;  3RH3 A;  3EDU A;  3GUA A;  3J7Y q;  2MOZ A;  3ZMS B;  3CX7 B;  2H3R A;  5JDM A;  2XHE B;  5AQL B;  5EK4 A;  2W8G A;  4BQT A;  2WBL A;  3H3A A;  2X00 A;  2OV9 A;  4QX8 B;  5HEO A;  2Y6X A;  4IT4 A;  4XK9 A;  2FJE A;  3U78 A;  2UXB T;  3RYC E;  3ZST A;  3QC9 A;  5IYZ E;  4UVA B;  5AQI B;  2SPC A;  1UUR A;  1UGO A;  4JBW F;  2JMH A;  2VVS A;  4IE4 A;  4DMV A;  2E5V A;  2QA7 A;  3FZL B;  2EHO D;  2H89 A;  3OKQ A;  3L3P A;  4EZH A;  3WTL A;  3OTO T;  2OLT A;  3N2G E;  2VKH A;  4HWC A;  4HTE A;  4UVB B;  1QSD A;  2X9H A;  2X0L B;  2D9D A;  3IF8 B;  4B3T T;  4HFD A;  3ZYK A;  3WTK A;  2XNU A;  2FJB A;  3AVR A;  3B57 A;  3RPU A;  4ZHQ E;  2JRK A;  2GK9 A;  4ZI3 D;  5F8P A;  1JNR A;  4JEH B;  1VRB A;  3N2K E;  4EB6 E;  2CPT A;  5FXW A;  2ZM8 A;  5CGM A;  4AKG A;  5LMU T;  1LVK A;  4Q25 A;  1VOM A;  5JRC B;  2W0G A;  4OFZ A;  2XQ6 A;  2NW9 A;  3O9X A;  2X0H A;  3Q5D A;  4IHJ E;  4TWD A;  2VQE T;  2YIN A;  2CBI A;  1G8X A;  2XAF B;  4I55 E;  4ERR A;  3PU8 A;  2WZH A;  3KV4 A;  3H37 A;  4EOZ B;  4X62 T;  4F6R C;  2NW8 A;  1HFA A;  5AQQ B;  1IBL T;  3GA8 A;  3IEE A;  3Q5E A;  3P4R A;  3N9M A;  4HE8 A;  2XZ5 A;  3U8M A;  4JEU B;  1Y64 B;  4NIQ A;  1W0A A;  1XNQ T;  2BBH A;  4TNV A;  5FL0 A;  2H7O A;  5L3E B;  3AXJ B;  2IML A;  1XDP A;  4I0U A;  4QKN A;  5JME A;  3C51 A;  3X1D A;  3ZCJ A;  1HTJ F;  5H6R B;  3WTN A;  2BJ0 A;  4DV4 T;  4H9Q C; 
#chains in the Genus database with same CATH homology
 2C9T A;  5J5I A;  3SH1 A;  2Y54 A;  5HCJ A;  2BG9 A;  3EHZ A;  3JAD A;  2XNT A;  4AFH A;  4HFD A;  3WTK A;  2XNU A;  2LKH A;  4FRR A;  4HFE A;  1OED B;  4NPP A;  5KZU A;  2LKG A;  5HEH A;  3UQ7 A;  5HEG A;  2BR7 A;  4QAC A;  5L4E A;  4UM3 P;  3U8K A;  4D01 A;  3JAF A;  2ZJV A;  3UQ4 A;  4ILB A;  2Y58 A;  2VL0 A;  2BYS A;  5LXB A;  4ZR6 A;  4HFC A;  5AFH A;  3UU6 A;  4COF A;  4IL9 A;  3TLV A;  2XNV A;  4F8H A;  4ZZC A;  3JAE A;  4LMJ A;  4UM1 A;  4AFT A;  4UY2 A;  2XQA A;  3WTO A;  3P4W A;  5AFN A;  3U8N A;  5TVC A;  5AFL A;  4NZB A;  5KE4 A;  2YN6 A;  3U8J A;  4ZZB A;  4QH4 A;  2ZJU A;  5SYO A;  2XQ7 A;  3UU5 A;  2WN9 A;  3WTI A;  3ZDH A;  5J5H A;  4ZRU A;  2XQ6 A;  3UU8 A;  1OED E;  4HQP A;  3LSV A;  2YOE A;  2M6I A;  5L47 A;  3C79 A;  4TWD A;  3GUA A;  2XQ9 A;  3RIF A;  4A97 A;  3C84 A;  3PEO A;  4UM3 A;  4ILC A;  4LML A;  4ZK4 A;  4HFB A;  1I9B A;  4B5D A;  2PH9 A;  3WTM A;  5AFM B;  2BYN A;  3P50 A;  5AFK A;  2W8G A;  5J0Z A;  2XYT A;  3TLU A;  5J5G A;  2WNL A;  4BQT A;  2LLY A;  3RHW A;  2XQ8 A;  2X00 A;  2X00 D;  5HEO A;  3RIA A;  2BYR A;  3WTH A;  2BG9 C;  4X5T A;  4TWH A;  2M6B A;  3IGQ A;  4XK9 A;  5BW2 A;  4Z91 A;  5CFB A;  4ALX A;  4QAB A;  3RQW A;  4ZJT A;  2YMD A;  2YME A;  4QAA A;  2UZ6 A;  4TWF A;  4LMK A;  1UW6 A;  2YKS A;  4Z90 A;  1UX2 A;  3ZKR A;  2QC1 B;  3ZDG A;  2Y7Y A;  3TLS A;  5AFJ A;  2XQ4 A;  2W8F A;  4DBM A;  4HFH A;  5HEU A;  2XZ5 A;  3U8M A;  3EI0 A;  4HFI A;  3SQ6 A;  2XQ5 A;  3TLT A;  3RI5 A;  2WZY A;  2Y56 A;  3WTJ A;  4XHE A;  5J5F A;  3WIP A;  5L4H A;  2XQ3 A;  3SQ9 A;  3T4M A;  2MAW A;  4IL4 A;  4A98 A;  4ZK1 A;  1UV6 A;  5BP0 A;  4UM3 S;  3PMZ A;  5HCM A;  4TNV A;  4IRE A;  4QH5 A;  3UUB A;  4ILA A;  4ZJS A;  4UXU A;  1OED A;  5CO5 A;  3TLW A;  5AFM A;  4WV9 A;  4QH1 A;  5AIN A;  3UU3 A;  2Y57 A;  2WNJ A;  3SIO A;  4BFQ A;  4PIR A;  3WTL A;  4TNW A;  5JME A;  2KSR A;  5FJV A;  4EZ1 A;  5LG3 A;  2BG9 E;  5HEJ A;  2WNC A;  5IUX A;  3U8L A;  5BRX A;  2BG9 B;  1OED C;  2BYQ A;  2XYS A;  3WTN A;  2LM2 A;  3EAM A;  4AFG A;  3UU4 A;  2BJ0 A;  2PGZ A;  3RQU A;  2BR8 A;  2XZ6 A;  2BYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...