5L4EA

X-ray structure of the 2-22' locally-closed mutant of glic in complex with thiopental
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
source organism Gloeobacter
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 89
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l4eA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l4eA01
5HCJA 4WV9A 2XYTA 2ZJVA 5J5FA 4QH1A 2XNVA 5IUXA 3EI0A 4UM1A 2XQ4A 3T4MA 3UUBA 2XQ7A 1OEDA 5JMEA 2XQAA 2LLYA 4ZK4A 2Y57A 4HQPA 2WNJA 1OEDB 3EHZA 2BYNA 1UW6A 4UM3A 4UXUA 4NPPA 4Z90A 3JADA 4X5TA 5HEJA 2UZ6A 5L4EA 5TVCA 3SQ9A 5AFLA 3SH1A 5LXBA 2YOEA 3TLTA 2LKHA 2PGZA 4XHEA 3WTNA 3U8NA 2M6BA 2Y54A 3UU8A 2YMDA 3TLUA 4AFGA 4AFTA 2WZYA 5CO5A 2YN6A 4PIRA 4ALXA 4ZJTA 3UU5A 2XNTA 5AFJA 2W8FA 4UY2A 3SIOA 4LMJA 4IL9A 4F8HA 5BP0A 5LG3A 5L4HA 1OEDE 4LMKA 2XQ3A 3RHWA 3UQ4A 3UU6A 2QC1B 5KZUA 2C9TA 2VL0A 4UM3S 5CFBA 1OEDC 2WN9A 5HEHA 5HEGA 4DBMA 2XQ9A 4UM3P 5AFMB 2Y58A 4D01A 2BG9E 2WNLA 4BQTA 2BG9A 4HFDA 5BRXA 4ZRUA 3JAEA 2Y7YA 5L47A 2BG9C 1UV6A 3C79A 4QH5A 3ZKRA 3WTJA 3WTOA 4IREA 5SYOA 3ZDHA 3GUAA 2XQ6A 4TWFA 2WNCA 2XQ5A 2X00D 3U8JA 1UX2A 3ZDGA 2BYSA 2BYRA 4AFHA 2MAWA 2BYPA 3WTLA 4QH4A 3PMZA 4ILCA 2BG9B 3WIPA 3U8KA 3UU4A 4TNVA 4ILAA 2YKSA 3UU3A 5J0ZA 2BJ0A 4NZBA 2BR7A 3EAMA 3SQ6A 3TLWA 5FJVA 4ZJSA 3P4WA 3JAFA 3WTHA 2W8GA 5HEUA 2XYSA 2YMEA 4QACA 1I9BA 3P50A 4ILBA 5HCMA 4COFA 2Y56A 3U8MA 5AFKA 3PEOA 4XK9A 4TNWA 3RIFA 5AFHA 3C84A 2PH9A 4IL4A 2LM2A 4QAAA 2ZJUA 4TWHA 5J5HA 4TWDA 3RQUA 3TLSA 4ZZCA 2XZ6A 5BW2A 4EZ1A 5KE4A 5J5IA 4LMLA 4HFHA 3RIAA 5AINA 3RQWA 4QABA 5AFMA 4HFIA 3LSVA 4Z91A 3IGQA 2XQ8A 4FRRA 3WTIA 2XNUA 4A97A 5J5GA 4HFCA 2BR8A 3WTKA 5AFNA 3U8LA 2BYQA 4B5DA 2KSRA 3RI5A 2XZ5A 4ZK1A 4ZZBA 4HFEA 4BFQA 4ZR6A 4A98A 2X00A 3WTMA 5HEOA 2M6IA 2LKGA 3TLVA 3UQ7A 4HFBA
chains in the Genus database with same CATH superfamily
2V7JA 5FVKA 3HKBE 1NAFA 3K8PC 2QA7A 1YKEB 5L2LA 3JADA 4JLEA 5LXBA 4O4LE 3ZN1B 4Q25A 4H63H 4X1KE 2LSKA 2NR4A 5HAXA 3CVRA 3N9QA 4E7ZA 4DR3T 3FXEB 4DBRA 3PTRB 4IDPA 4DV4T 5LMUT 4JYAT 2JMKA 3AEEA 3JAEA 3PJAA 2C5JA 5AQJB 3CQCB 4KP3C 1G8XA 3GUAA 2DI4A 3AE8A 2BYRA 2IHR1 2L8KA 5ABGA 4NXNT 2V7KA 4HE8A 2WWVA 3CQXC 5HXEA 4JI7T 1D1BA 1MMAA 2MTQA 2EHOB 2B76A 5KXJA 1NWMX 2ZM8A 3AA7B 5IHYA 3LK3B 3A5XA 2ZJUA 2CCQA 4LMLA 3C50A 3AAEB 1T98A 1T7SA 4WBNE 1QUUA 3N9MA 2HN1A 2JPFA 4YSXA 3C64A 1HG5A 4B5DA 3GMIA 1KEYA 5LOVE 2WAUA 2X9YA 3WTMA 3FZHB 5HCJA 2DLRA 2ZJVA 5DQVA 4QXCB 1YQ3A 3O1HA 3AAIA 3HA4A 4X64T 4LFBT 3VR8A 3ZYLA 2CA5A 2VKJA 3TLUA 4PIRA 3FZKB 2XAQB 1U4QA 4AKLA 5LG3A 3FBLA 1D0XA 3UQ4A 3KV9A 5H6QB 4EXTA 2HHHT 4UELA 2XTLA 4BQTA 5L3DB 4HFDA 5FMNA 3B57A 4ZI3D 3RKGA 3RYCE 3C79A 4A5XA 2LSGA 5SYOA 2XM1A 2XQ6A 3Q5XA 5LA6E 2WDQA 5EK4A 2BYPA 2KXPB 4CQIA 4FJOA 4KMCA 1MMNA 2UXNB 3ZCIA 3VKGA 3N9OA 3QOFA 4GKKT 2X51A 3H37A 5JDHA 2VL8A 4PFPA 3P4PA 1IZNB 4ERRA 2V6XA 4HWDA 3EDUA 4XZCA 5ABFB 2E8IA 4ZZCA 2NW7A 1B7TA 3E08A 3VHLA 2IC9A 1UX5A 3ABVA 4I43B 4ZZBA 1U5PA 2V7IA 3T4MA 4YJ3E 4GK5E 3AE9A 1HCIA 3UUXB 4XBFB 3FZFB 4DUZT 4Z90A 3D0TA 3TKLB 2ZLYA 2YOEA 2X0HA 2PGZA 3U8NA 3GA8A 2B1EA 4UV8B 4CXYA 2UUBT 2CHOA 4UY2A 4AKIA 4NXMT 3ANWB 3RHWA 2QC1B 3WI3A 4G2AA 4DBMA 5F3JA 4EZHA 2L9QA 2MOZA 4C91A 4CZZB 4QH5A 2KMFA 4PJMA 4BA9A 3WTLA 4U7YA 1IJ6A 5AQHB 4X20E 5JDFA 2BR7A 5JDNA 3P4WA 3RKOA 3IA3A 3RC3A 4EEDA 5JRCA 5AQFB 3RRWA 2CHNA 3P50A 4AQYT 1WYBA 2OLTA 4IE6A 4CI3B 5J5HA 1QSDA 4JI2T 5FXZA 3RQUA 4LF5T 4O2AE 4PAGA 1FEWA 2CLYB 3JC6C 4GIWA 2ODUA 2A72A 4KX6A 2JQQA 2ACXA 2K5BB 1W9RA 4J2CA 4HFEA 5LYJE 2X00A 2JRKA 5HEOA 2W4XA 3CQGB 3PURA 2NOXA 4TZ4C 2VKOA 4LF7T 2BYNA 3EHZA 4AQFA 4PNIA 1D0ZA 5L4EA 3SH1A 3OYXA 5ABHA 1WR6A 3V5UA 3L39A 3PDYA 4DR1T 2YK0A 3SWHA 3UU5A 3PUGA 4AKHA 4LMJA 4X1YE 5EZYE 2C9TA 1XWMA 4BJNA 5HEGA 4CXWA 3CKDA 3ONLC 2BG9E 2WNLA 2LHNA 2CE7A 1N36T 4ZRUA 3CWZB 2A9UA 4HWIB 2X67A 2W0GA 3CMLA 2BBJA 3GN5A 3T8OA 2NP9A 3PMZA 3U8KA 2VKDA 2YKSA 4QXHB 3UU3A 4NZBA 3EAMA 4AISA 4MBQA 4PJNA 3PU8A 1FMWA 3G06A 1W09A 5AFKA 4XK9A 4IIJE 5AQLB 4TWHA 1HNZT 2LOSA 2CWOA 2YDSA 2X0YA 3O1IA 3RIAA 3RQWA 1W0BA 5AFMA 3ZT6A 5JH7E 2VVSA 3LBXA 4ZXLA 4YXDA 5L3BB 2W66A 2KSRA 2H3RA 2BBHA 3QUJA 2K9AA 2M6IA 1LVKA 3MJXA 3AXJB 4V1Av 3PUXF 4NUUA 2XNVA 3A7MA 4HN9A 3N2OA 4P0AA 2N2NA 4UXUA 4DV3T 1YD8G 3MKDA 3UU8A 4ALXA 2YN6A 3C98B 3BQKA 4DR5T 1ZP0A 3WAJA 4YSYA 4JI0T 4YLHA 3AAAB 5KMGP 1US7B 2ZM2A 2XQ9A 1IBLT 2VURA 2Y7YA 5L47A 2BG9C 3NWIA 5AQNB 1BR0A 2XQ5A 5DJQC 4TN7B 4JV5T 4YHJA 4HFVA 1T8BA 2A3DA 1YKHB 2XYSA 4K0KT 3LDQB 1UUSA 5IYZE 5JDQA 3K1SA 3KDSE 4L5GA 1HNWT 2PTFA 5TAOA 1CHUA 5HWYA 3H3AA 3ZLIA 4C90A 4U33A 4E7SA 3LG7A 3CX6B 2OA5A 5FY7A 5DABA 4OK0A 4AQFC 2H89A 4UIGA 4UR9A 2XYTA 3CK6A 2Y6XA 2LSJA 2X0LB 2HN2A 4JI4T 1KNRA 3UUBA 3ZJ2A 1WYCA 4H9NC 5AFLA 3UULA 3TLTA 5L3GB 1HX8A 1FIOA 2WB5A 4ZOLE 4WBOA 4IT4A 4AIUA 1MNEA 2VASA 3QB5A 3T1HT 3AEDA 4UXNB 4PK6A 4UVAB 3HL6A 3ZMTB 3WAKA 4X65T 1EZ3A 2Z6EA 1KNZA 2MBGA 4DUYT 4EIWA 2P9BA 3PJAJ 2Y8DA 5JDGA 3WTOA 3AEBA 4U31A 4AFHA 4DR7T 3RGLA 3KVAA 1T72A 4ZJSA 2PBIA 3WTHA 5BR8T 4IE5A 4UVBB 1CUNA 3OBVE 1XDOA 3CX8B 3ZMUB 4DO0A 3RIFA 2QVAA 2N1GA 5L3EB 4IL4A 2LM2A 3AVRA 1UCUA 2FBWA 4MLKA 2NW8A 4AQGA 2ZM0A 1S94A 3LSVA 3J9X1 3PE0A 3KINB 3WTIA 2XNUA 3EVYA 2J4GA 2ES0A 4JI6T 4ZI7E 3QNUA 4HTEA 2E5LT 3AA6B 4TX5A 2LT3A 4PJJA 3RF1A 2W67A 1OEDA 2AXDS 2WNJA 5C3JA 3JCFA 2UZ6A 2IAKA 5LNKA 4JI8T 1VOMA 4AFGA 3OYZA 4DV0T 4CN1A 2I6HA 2X68A 3IBPA 2XNTA 1XMOT 2L3LA 3IF8B 4ZS2A 5C8YE 4QKNA 4UM3P 2FJEA 4YTMA 4TV9E 4Z8XA 1R8IA 5BRXA 1MIYA 1UV6A 3KBUA 2DCFA 4LF9T 2XAJB 3HR0A 4AXPA 1MMDA 5C2TA 2NW9A 2EHOA 2QGSA 1MIVA 3PUYF 4IE0A 2LOPA 5ETWA 4DVDA 4O4HE 5HEUA 5F5WA 2W61A 3C4ZA 2XASB 1G73A 5HYAA 5M4YA 4JI3T 5AFHA 3C84A 4O2BE 3F2EA 2WP9A 1VCTA 4UF0B 4HWCA 2AE9A 4JBWF 5AQSB 2WBLA 2IMLA 2XAFB 5ABEA 3O4XE 2XPKA 1UX4A 4WNKA 5FYMA 2BYQA 2VK9A 2X9WA 5CA0E 3T1YT 3LK2B 2VB6A 5F8PA 2XAHB 1XZYA 1IBKT 2IC6A 2EHOD 4WV9A 3EABA 3L8RA 1MMGA 2FJBA 2CM0A 4ZI3C 1IJ5A 3PUSA 5HEJA 5LJMA 2I0MA 4WYVA 1HG2A 4ILUA 1SHZC 2ACZA 3OKQA 5AQUB 2C0SA 3AA1B 3ZMZB 3PUWF 4EOZB 1JNZA 3ZN0B 3Q9DA 2H7VC 4ASKA 3A8YC 2WDVA 3C4XA 2K3WA 5JR9A 4YJ2E 2WNCA 5AQGB 5CGMA 3MK7C 3MXZA 2X00D 3U8JA 2YU1A 4QH4A 5FP3A 3UFEA 4KHZF 3KFWX 1WLXA 1BR1A 2QRXA 2YMEA 3ZSSA 3RH3A 5JQGE 3PEOA 5FXVA 5AQOB 3NZPA 3RIUC 2VQFT 4TWDA 3TLSA 3MZKB 5BW2A 2UXCT 2E9XB 2XSAA 5LHGB 2H88A 4EV6A 3EUHA 4P09A 2UXBT 5KDMC 2BR8A 3B5MA 4JI5T 3U8LA 1L0VA 5H6RB 3RI5A 1IBMT 2DWGA 2XJ7A 2V26A 3AECA 3CPZA 3ZEFB 3FB2A 4CI1B 4WW0A 3EI0A 1OXZA 4B6XA 4QX7B 2UXDT 5JMEA 3RYHE 4H9PC 2ZMAA 4HGAA 2NWBA 2M6BA 1SA0E 4CN4A 3AEFA 3SFDA 2F4VT 2IIUA 4ISTA 3I9YA 3SIOA 4ZS3A 4ZI2C 2XHEB 2JJ9A 3PUQA 2HPJA 2VL0A 2ZM6T 4DR6T 4U7IA 1E1HB 4DV6T 2PJQA 3AXJA 4TV8E 4H63V 3HKEE 1M62A 5FVLA 3RRCA 2XY8B 3ZKRA 2V5DA 3ZYKA 2X9HA 2NTXA 5JRCB 2BVMA 4YSZA 2UUAT 4UV9B 2CXFA 4CXXA 4DV5T 2G0UA 2CXLA 3SS1A 5FY0A 3HKDE 4QACA 5HCMA 3K3OA 3NBXX 3KVBA 2PH9A 1ZV4X 2Q9QA 5KE4A 1Y64B 3N2KE 3PU3A 1HX1B 4IE4A 2XZEA 3W15B 4DV7T 4JEHB 4L0RA 4TUYE 2NTYA 1Y01A 3GN5B 4M1PA 1VRBA 4BFQA 2YINA 3M65A 3ZC0A 2E9XC 2JQ9A 2D0UA 2BKNA 4YTPA 3OPCA 2XQAA 3C4WA 5FL0A 1ZOYA 4IE7A 5EK3A 4ANJA 5AQVB 4ZJTA 3PUZF 1Z0PA 2KT9A 1XNQT 5EK2A 3F31A 2FJAA 1H7CA 4NIQA 4UM3S 2M67A 2WM9A 4IGUA 4ADZA 3O1JA 3Q5DA 3AE4A 2HH7A 1KFYA 2YEVC 3OJAA 1KK7A 3MA9A 3V5SA 4AI6A 2UUCT 4L9IA 3OTOT 4IDNA 4DV1T 2K24A 4ILCA 4LFAT 3ETUA 3E0ZA 5HXCA 3TLWA 1KNPA 4JEUB 4B3TT 4P1NA 1UGOA 2J47A 5ABFA 4X66T 2CBIA 1NENA 2WZHA 2VWAA 3AA0B 4HFIA 2W00A 3AE6A 5KX5E 2V6YA 4B3ST 5AFNA 2LM9A 5J2TE 3QC9A 2C5KT 1HFAA 3IHRA 3LJCA 3L3PA 4I55E 3AE1A 4MALA 4HQPA 5HXHA 5E0OA 3LFMA 5BMVE 3P4SA 2DL1A 4H9SE 3UT5E 5AQTB 2IDOB 3PUVF 3NVOA 1ZKEA 4ZI2D 4QX8B 5AFMB 1ZHCA 2DHRA 1X79A 2D9DA 4X62T 2CWYA 4PJLA 2PFVA 1UX2A 3E22E 2CPTA 5CJ5A 2BG9B 5LBQB 3H3MA 1FJGT 4ILAA 4PK5A 4ZEYA 3N9LA 4B3MT 4I50E 2LRKA 1E2AA 3U3IA 2W8GA 2N9DA 2BS4A 4COFA 3UFGA 3QB5K 1DU2A 2I59A 2XM2A 3ZCJA 2XZ6A 5LHIB 3ONXA 4FI5A 2X66A 5DQWA 3PV0F 3VRAA 4DIDB 3ZJ1A 2WQYA 1D1CA 2VKHA 5L3CB 1J1JA 3HKCE 4U2ZA 4YFSA 5LGNB 2J62A 2OV9A 4LFCT 2D5UA 5JDMA 3DTOA 4A98A 5FXXA 1SUMB 3UQ7A 1V9DA 4KUMB 4GYSA 1D1AA 2V7LA 2XSBA 2XQ7A 1YW0A 1N34T 4ZK4A 4DMVA 2FUPA 3AEAA 5LG4A 2CRBA 4NPPA 3BQLA 2KZ7B 2LKHA 4ISSA 3KV6A 2YMDA 3I0QA 5LGUB 3AE2A 4IL9A 3SFEA 5BP0A 5FXWA 2E9XD 1Z8UA 4LMKA 3UTKA 3I9WA 3IEEA 3J7Yq 2XUEA 4IDQA 2WMNA 3K3NA 1I6ZA 2CBJA 4U74A 2LHRA 5JR9B 1AJ3A 2KLQA 4JUYA 3ETVA 4KBMB 4JI1T 3ZDHA 3B13A 3RYIE 3AE3A 4U72A 2MAWA 3JC6D 4KI0F 2BDEA 4MFRA 3U78A 5FNVE 3QK6A 3P4RA 1LRZA 3Q5WA 2HPLA 1I9BA 4MHCA 3RLFF 1UURA 3VRBA 3ZC1A 3ZT7A 4QHOA 3ZT5A 4ZHQE 5LGTB 4FRRA 5J5GA 2V1DB 4IDZA 4HFCA 2YU2A 4HKAA 2XAGB 3L09A 1LVFA 1HTJF 3SOLA 4HWHA 3HI2A 3ZPOA 1M7KA 2J1DG 2MPKA 3Q5EA 1I94T 3AE5A 1FMVA 4I0UA 4QH1A 2XQ4A 3N2GE 2Y57A 3P8CD 4X5TA 5TVCA 4H9RC 1J5WA 2RA1A 4O8SA 2W63A 4UF0A 1MNDA 5AFJA 1WCRA 2R6GF 4F8HA 5KZUA 2XQ3A 4U2YA 3R6NA 1HF8A 2WMOA 2SPCA 2Y58A 1NEKA 1YQ4A 2BG9A 5HXRA 2WS3A 4HEAA 5AFUL 3DJBA 1QLBA 1X9BA 2LRLA 2UU9T 4I4TE 2WSSV 4EYUA 2LSYA 3N5LA 4EEBA 2KWHA 2YDQA 3WIPA 3EDVA 2BJ0A 3SQ6A 1S35A 3JAFA 1BR2A 2Q9QC 5ADXL 2YDRA 4XAXB 4ILBA 1UK5A 2A2FX 2V8SV 4CI2B 3ZSTA 2IW5B 4QAAA 3AVSA 2Q9QB 4OYKA 4K0UA 4YHHT 4X1IE 4EZ1A 5HWXA 4HFHA 5AQMB 3ANWA 1LKXA 3KV5A 4DR2T 1BR4A 3ZMVB 5LBMA 2ODVA 2Y48B 4GOUA 2XZ5A 2K48A 3PUAA 4ZR6A 1YXRA 2D2SA 4AKRB 1SE7A 2WDRA 3P4QA 3KBTA 4UM1A 2E2AA 4EAHA 3S4UA 2FJDA 5IWAT 4UVCB 1OWAA 4BJMA 4UM3A 2JQHA 3GWHA 4YTNA 2VQET 4LF8T 2WCAA 3AEGA 3AE7A 4AKGA 2VVNA 2BS2A 5AQRB 3ESLA 1E7PA 2WZIA 5L4HA 4KHPT 1OEDE 3UU6A 5LHHB 2WU5A 4P0BA 5CFBA 5FL1A 3LBXB 4U3CA 2LE8A 1WRDA 1W0AA 2UXXB 1D0YA 4IREA 2BZBA 3ZDGA 2KNDA 2CXDA 3R84B 2JIWA 1HNXT 2BKOA 1XDPA 3ZMSB 2H7OA 5FY1A 3Q2MA 4A56A 3K3QC 3U8MA 2Y56A 3RIUA 2JQKA 4CN6A 2XQYA 4QXBB 5HXSA 5AINA 3O9XA 2CMRA 1GQEA 2DWKA 2W62A 4YT0A 3IGQA 1IAPA 3NZQA 4LF6T 4NUVA 4HWFA 3VU7H 4UEMA 5LB7B 2D0TA 3NRXA 4H9QC 1WR0A 3VR9A 5JR9C 2BKPA 3TLVA 3WTKA 1HR0T 5CB4E 5J5FA 4GYRA 4IHJE 3BQIA 3FXDB 3X1DA 2LLYA 1OEDB 5L3FB 1UW6A 3ONJA 4G63A 5AQKB 3WTNA 2Y54A 4AFTA 3FHNA 5CO5A 4IDOA 1J5ET 4EZ4A 4H9OC 2W8FA 2V5CA 2WWUA 4PW8A 3NRYA 5JDLA 2WN9A 4N78D 2RPAA 4D01A 2W2UA 1MIWA 4OYJA 3F57A 4OHFA 5LXTE 2C5IT 4PFOA 3WTJA 1VCSA 4GK0E 3UUNA 4DMWA 2BYSA 2E5VA 4DNDA 1ZEEA 3UU4A 3AB3B 5FJVA 4WZXA 4EYYR 3VKHA 3C51A 2QYWA 2PG8A 4O4IE 2X9XA 4LF4T 5LMNT 1N32T 3P7IA 3FBZA 3RX6A 5LCYA 2LEHA 4GKJT 4DR4T 2WU2A 3SRZA 5J5IA 3CX7B 3NKZA 2RP4A 5AQPB 2CEAA 2EHOC 5FKYA 5A1LA 5AQQB 4ZK1A 2V7MA 2BVLA 2DNXA 2JMHA 5LP6E 4DV2T 5GONE 5JVDE 5IUXA 3ZYMA 4B3RT 3KV4A 4OX9T 3MACA 1JNRA 2CLYC 3M3ZB 3I1AA 2BS3A 3SQ9A 2IUBA 4XHEA 3RYFE 5LJNA 4BAYB 2WZYA 3CIRA 2GK9A 5J2UE 3UUMA 2Q9QD 3N9NA 3RPUA 1OEDC 5HEHA 2V6YB 1O3XA 3N9PA 2KWIB 5J1GA 2LSIA 3I0OA 3RC8A 4TWFA 4F6RC 4EB6E 4TNVA 1XMQT 2KINB 3OVUA 5JTGA 5J0ZA 1XNRT 5AQIB 4EGWA 3FZMB 4TNWA 1KF6A 3LK42 4O4JE 2WY2A 5CA1E 2E9XA 4QABA 3BK9A 5JREA 3FZLB 4Z91A 2XQ8A 4A97A 4QWNB 1WFDA 3DP7A 4PK4A 2MYSA 4DBQA 1N33T 2LJLA 2LKGA 4YY3T 4OFZA 4HFBA 1HS7A
chains in the Genus database with same CATH topology
5HCJA 4WV9A 2XYTA 2ZJVA 5J5FA 4QH1A 2XNVA 5IUXA 3EI0A 4UM1A 2XQ4A 3T4MA 3UUBA 2XQ7A 1OEDA 5JMEA 2XQAA 2LLYA 4ZK4A 2Y57A 4HQPA 2WNJA 1OEDB 3EHZA 2BYNA 1UW6A 4UM3A 4UXUA 4NPPA 4Z90A 3JADA 4X5TA 5HEJA 2UZ6A 5L4EA 5TVCA 3SQ9A 5AFLA 3SH1A 5LXBA 2YOEA 3TLTA 2LKHA 2PGZA 4XHEA 3WTNA 3U8NA 2M6BA 2Y54A 3UU8A 2YMDA 3TLUA 4AFGA 4AFTA 2WZYA 5CO5A 2YN6A 4PIRA 4ALXA 4ZJTA 3UU5A 2XNTA 5AFJA 2W8FA 4UY2A 3SIOA 4LMJA 4IL9A 4F8HA 5BP0A 5LG3A 5L4HA 1OEDE 4LMKA 2XQ3A 3RHWA 3UQ4A 3UU6A 2QC1B 5KZUA 2C9TA 2VL0A 4UM3S 5CFBA 1OEDC 2WN9A 5HEHA 5HEGA 4DBMA 2XQ9A 4UM3P 5AFMB 2Y58A 4D01A 2BG9E 2WNLA 4BQTA 2BG9A 4HFDA 5BRXA 4ZRUA 3JAEA 2Y7YA 5L47A 2BG9C 1UV6A 3C79A 4QH5A 3ZKRA 3WTJA 3WTOA 4IREA 5SYOA 3ZDHA 3GUAA 2XQ6A 4TWFA 2WNCA 2XQ5A 2X00D 3U8JA 1UX2A 3ZDGA 2BYSA 2BYRA 4AFHA 2MAWA 2BYPA 3WTLA 4QH4A 3PMZA 4ILCA 2BG9B 3WIPA 3U8KA 3UU4A 4TNVA 4ILAA 2YKSA 3UU3A 5J0ZA 2BJ0A 4NZBA 2BR7A 3EAMA 3SQ6A 3TLWA 5FJVA 4ZJSA 3P4WA 3JAFA 3WTHA 2W8GA 5HEUA 2XYSA 2YMEA 4QACA 1I9BA 3P50A 4ILBA 5HCMA 4COFA 2Y56A 3U8MA 5AFKA 3PEOA 4XK9A 4TNWA 3RIFA 5AFHA 3C84A 2PH9A 4IL4A 2LM2A 4QAAA 2ZJUA 4TWHA 5J5HA 4TWDA 3RQUA 3TLSA 4ZZCA 2XZ6A 5BW2A 4EZ1A 5KE4A 5J5IA 4LMLA 4HFHA 3RIAA 5AINA 3RQWA 4QABA 5AFMA 4HFIA 3LSVA 4Z91A 3IGQA 2XQ8A 4FRRA 3WTIA 2XNUA 4A97A 5J5GA 4HFCA 2BR8A 3WTKA 5AFNA 3U8LA 2BYQA 4B5DA 2KSRA 3RI5A 2XZ5A 4ZK1A 4ZZBA 4HFEA 4BFQA 4ZR6A 4A98A 2X00A 3WTMA 5HEOA 2M6IA 2LKGA 3TLVA 3UQ7A 4HFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HCJ A;  4WV9 A;  2XYT A;  2ZJV A;  5J5F A;  4QH1 A;  2XNV A;  5IUX A;  3EI0 A;  4UM1 A;  2XQ4 A;  3T4M A;  3UUB A;  2XQ7 A;  1OED A;  5JME A;  2XQA A;  2LLY A;  4ZK4 A;  2Y57 A;  4HQP A;  2WNJ A;  1OED B;  3EHZ A;  2BYN A;  1UW6 A;  4UM3 A;  4UXU A;  4NPP A;  4Z90 A;  3JAD A;  4X5T A;  5HEJ A;  2UZ6 A;  5L4E A;  5TVC A;  3SQ9 A;  5AFL A;  3SH1 A;  5LXB A;  2YOE A;  3TLT A;  2LKH A;  2PGZ A;  4XHE A;  3WTN A;  3U8N A;  2M6B A;  2Y54 A;  3UU8 A;  2YMD A;  3TLU A;  4AFG A;  4AFT A;  2WZY A;  5CO5 A;  2YN6 A;  4PIR A;  4ALX A;  4ZJT A;  3UU5 A;  2XNT A;  5AFJ A;  2W8F A;  4UY2 A;  3SIO A;  4LMJ A;  4IL9 A;  4F8H A;  5BP0 A;  5LG3 A;  5L4H A;  1OED E;  4LMK A;  2XQ3 A;  3RHW A;  3UQ4 A;  3UU6 A;  2QC1 B;  5KZU A;  2C9T A;  2VL0 A;  4UM3 S;  5CFB A;  1OED C;  2WN9 A;  5HEH A;  5HEG A;  4DBM A;  2XQ9 A;  4UM3 P;  5AFM B;  2Y58 A;  4D01 A;  2BG9 E;  2WNL A;  4BQT A;  2BG9 A;  4HFD A;  5BRX A;  4ZRU A;  3JAE A;  2Y7Y A;  5L47 A;  2BG9 C;  1UV6 A;  3C79 A;  4QH5 A;  3ZKR A;  3WTJ A;  3WTO A;  4IRE A;  5SYO A;  3ZDH A;  3GUA A;  2XQ6 A;  4TWF A;  2WNC A;  2XQ5 A;  2X00 D;  3U8J A;  1UX2 A;  3ZDG A;  2BYS A;  2BYR A;  4AFH A;  2MAW A;  2BYP A;  3WTL A;  4QH4 A;  3PMZ A;  4ILC A;  2BG9 B;  3WIP A;  3U8K A;  3UU4 A;  4TNV A;  4ILA A;  2YKS A;  3UU3 A;  5J0Z A;  2BJ0 A;  4NZB A;  2BR7 A;  3EAM A;  3SQ6 A;  3TLW A;  5FJV A;  4ZJS A;  3P4W A;  3JAF A;  3WTH A;  2W8G A;  5HEU A;  2XYS A;  2YME A;  4QAC A;  1I9B A;  3P50 A;  4ILB A;  5HCM A;  4COF A;  2Y56 A;  3U8M A;  5AFK A;  3PEO A;  4XK9 A;  4TNW A;  3RIF A;  5AFH A;  3C84 A;  2PH9 A;  4IL4 A;  2LM2 A;  4QAA A;  2ZJU A;  4TWH A;  5J5H A;  4TWD A;  3RQU A;  3TLS A;  4ZZC A;  2XZ6 A;  5BW2 A;  4EZ1 A;  5KE4 A;  5J5I A;  4LML A;  4HFH A;  3RIA A;  5AIN A;  3RQW A;  4QAB A;  5AFM A;  4HFI A;  3LSV A;  4Z91 A;  3IGQ A;  2XQ8 A;  4FRR A;  3WTI A;  2XNU A;  4A97 A;  5J5G A;  4HFC A;  2BR8 A;  3WTK A;  5AFN A;  3U8L A;  2BYQ A;  4B5D A;  2KSR A;  3RI5 A;  2XZ5 A;  4ZK1 A;  4ZZB A;  4HFE A;  4BFQ A;  4ZR6 A;  4A98 A;  2X00 A;  3WTM A;  5HEO A;  2M6I A;  2LKG A;  3TLV A;  3UQ7 A;  4HFB A; 
#chains in the Genus database with same CATH topology
 2V7J A;  5FVK A;  3HKB E;  1NAF A;  3K8P C;  2QA7 A;  1YKE B;  5L2L A;  3JAD A;  4JLE A;  5LXB A;  4O4L E;  3ZN1 B;  4Q25 A;  4H63 H;  4X1K E;  2LSK A;  2NR4 A;  5HAX A;  3CVR A;  3N9Q A;  4E7Z A;  4DR3 T;  3FXE B;  4DBR A;  3PTR B;  4IDP A;  4DV4 T;  5LMU T;  4JYA T;  2JMK A;  3AEE A;  3JAE A;  3PJA A;  2C5J A;  5AQJ B;  3CQC B;  4KP3 C;  1G8X A;  3GUA A;  2DI4 A;  3AE8 A;  2BYR A;  2IHR 1;  2L8K A;  5ABG A;  4NXN T;  2V7K A;  4HE8 A;  2WWV A;  3CQX C;  5HXE A;  4JI7 T;  1D1B A;  1MMA A;  2MTQ A;  2EHO B;  2B76 A;  5KXJ A;  1NWM X;  2ZM8 A;  3AA7 B;  5IHY A;  3LK3 B;  3A5X A;  2ZJU A;  2CCQ A;  4LML A;  3C50 A;  3AAE B;  1T98 A;  1T7S A;  4WBN E;  1QUU A;  3N9M A;  2HN1 A;  2JPF A;  4YSX A;  3C64 A;  1HG5 A;  4B5D A;  3GMI A;  1KEY A;  5LOV E;  2WAU A;  2X9Y A;  3WTM A;  3FZH B;  5HCJ A;  2DLR A;  2ZJV A;  5DQV A;  4QXC B;  1YQ3 A;  3O1H A;  3AAI A;  3HA4 A;  4X64 T;  4LFB T;  3VR8 A;  3ZYL A;  2CA5 A;  2VKJ A;  3TLU A;  4PIR A;  3FZK B;  2XAQ B;  1U4Q A;  4AKL A;  5LG3 A;  3FBL A;  1D0X A;  3UQ4 A;  3KV9 A;  5H6Q B;  4EXT A;  2HHH T;  4UEL A;  2XTL A;  4BQT A;  5L3D B;  4HFD A;  5FMN A;  3B57 A;  4ZI3 D;  3RKG A;  3RYC E;  3C79 A;  4A5X A;  2LSG A;  5SYO A;  2XM1 A;  2XQ6 A;  3Q5X A;  5LA6 E;  2WDQ A;  5EK4 A;  2BYP A;  2KXP B;  4CQI A;  4FJO A;  4KMC A;  1MMN A;  2UXN B;  3ZCI A;  3VKG A;  3N9O A;  3QOF A;  4GKK T;  2X51 A;  3H37 A;  5JDH A;  2VL8 A;  4PFP A;  3P4P A;  1IZN B;  4ERR A;  2V6X A;  4HWD A;  3EDU A;  4XZC A;  5ABF B;  2E8I A;  4ZZC A;  2NW7 A;  1B7T A;  3E08 A;  3VHL A;  2IC9 A;  1UX5 A;  3ABV A;  4I43 B;  4ZZB A;  1U5P A;  2V7I A;  3T4M A;  4YJ3 E;  4GK5 E;  3AE9 A;  1HCI A;  3UUX B;  4XBF B;  3FZF B;  4DUZ T;  4Z90 A;  3D0T A;  3TKL B;  2ZLY A;  2YOE A;  2X0H A;  2PGZ A;  3U8N A;  3GA8 A;  2B1E A;  4UV8 B;  4CXY A;  2UUB T;  2CHO A;  4UY2 A;  4AKI A;  4NXM T;  3ANW B;  3RHW A;  2QC1 B;  3WI3 A;  4G2A A;  4DBM A;  5F3J A;  4EZH A;  2L9Q A;  2MOZ A;  4C91 A;  4CZZ B;  4QH5 A;  2KMF A;  4PJM A;  4BA9 A;  3WTL A;  4U7Y A;  1IJ6 A;  5AQH B;  4X20 E;  5JDF A;  2BR7 A;  5JDN A;  3P4W A;  3RKO A;  3IA3 A;  3RC3 A;  4EED A;  5JRC A;  5AQF B;  3RRW A;  2CHN A;  3P50 A;  4AQY T;  1WYB A;  2OLT A;  4IE6 A;  4CI3 B;  5J5H A;  1QSD A;  4JI2 T;  5FXZ A;  3RQU A;  4LF5 T;  4O2A E;  4PAG A;  1FEW A;  2CLY B;  3JC6 C;  4GIW A;  2ODU A;  2A72 A;  4KX6 A;  2JQQ A;  2ACX A;  2K5B B;  1W9R A;  4J2C A;  4HFE A;  5LYJ E;  2X00 A;  2JRK A;  5HEO A;  2W4X A;  3CQG B;  3PUR A;  2NOX A;  4TZ4 C;  2VKO A;  4LF7 T;  2BYN A;  3EHZ A;  4AQF A;  4PNI A;  1D0Z A;  5L4E A;  3SH1 A;  3OYX A;  5ABH A;  1WR6 A;  3V5U A;  3L39 A;  3PDY A;  4DR1 T;  2YK0 A;  3SWH A;  3UU5 A;  3PUG A;  4AKH A;  4LMJ A;  4X1Y E;  5EZY E;  2C9T A;  1XWM A;  4BJN A;  5HEG A;  4CXW A;  3CKD A;  3ONL C;  2BG9 E;  2WNL A;  2LHN A;  2CE7 A;  1N36 T;  4ZRU A;  3CWZ B;  2A9U A;  4HWI B;  2X67 A;  2W0G A;  3CML A;  2BBJ A;  3GN5 A;  3T8O A;  2NP9 A;  3PMZ A;  3U8K A;  2VKD A;  2YKS A;  4QXH B;  3UU3 A;  4NZB A;  3EAM A;  4AIS A;  4MBQ A;  4PJN A;  3PU8 A;  1FMW A;  3G06 A;  1W09 A;  5AFK A;  4XK9 A;  4IIJ E;  5AQL B;  4TWH A;  1HNZ T;  2LOS A;  2CWO A;  2YDS A;  2X0Y A;  3O1I A;  3RIA A;  3RQW A;  1W0B A;  5AFM A;  3ZT6 A;  5JH7 E;  2VVS A;  3LBX A;  4ZXL A;  4YXD A;  5L3B B;  2W66 A;  2KSR A;  2H3R A;  2BBH A;  3QUJ A;  2K9A A;  2M6I A;  1LVK A;  3MJX A;  3AXJ B;  4V1A v;  3PUX F;  4NUU A;  2XNV A;  3A7M A;  4HN9 A;  3N2O A;  4P0A A;  2N2N A;  4UXU A;  4DV3 T;  1YD8 G;  3MKD A;  3UU8 A;  4ALX A;  2YN6 A;  3C98 B;  3BQK A;  4DR5 T;  1ZP0 A;  3WAJ A;  4YSY A;  4JI0 T;  4YLH A;  3AAA B;  5KMG P;  1US7 B;  2ZM2 A;  2XQ9 A;  1IBL T;  2VUR A;  2Y7Y A;  5L47 A;  2BG9 C;  3NWI A;  5AQN B;  1BR0 A;  2XQ5 A;  5DJQ C;  4TN7 B;  4JV5 T;  4YHJ A;  4HFV A;  1T8B A;  2A3D A;  1YKH B;  2XYS A;  4K0K T;  3LDQ B;  1UUS A;  5IYZ E;  5JDQ A;  3K1S A;  3KDS E;  4L5G A;  1HNW T;  2PTF A;  5TAO A;  1CHU A;  5HWY A;  3H3A A;  3ZLI A;  4C90 A;  4U33 A;  4E7S A;  3LG7 A;  3CX6 B;  2OA5 A;  5FY7 A;  5DAB A;  4OK0 A;  4AQF C;  2H89 A;  4UIG A;  4UR9 A;  2XYT A;  3CK6 A;  2Y6X A;  2LSJ A;  2X0L B;  2HN2 A;  4JI4 T;  1KNR A;  3UUB A;  3ZJ2 A;  1WYC A;  4H9N C;  5AFL A;  3UUL A;  3TLT A;  5L3G B;  1HX8 A;  1FIO A;  2WB5 A;  4ZOL E;  4WBO A;  4IT4 A;  4AIU A;  1MNE A;  2VAS A;  3QB5 A;  3T1H T;  3AED A;  4UXN B;  4PK6 A;  4UVA B;  3HL6 A;  3ZMT B;  3WAK A;  4X65 T;  1EZ3 A;  2Z6E A;  1KNZ A;  2MBG A;  4DUY T;  4EIW A;  2P9B A;  3PJA J;  2Y8D A;  5JDG A;  3WTO A;  3AEB A;  4U31 A;  4AFH A;  4DR7 T;  3RGL A;  3KVA A;  1T72 A;  4ZJS A;  2PBI A;  3WTH A;  5BR8 T;  4IE5 A;  4UVB B;  1CUN A;  3OBV E;  1XDO A;  3CX8 B;  3ZMU B;  4DO0 A;  3RIF A;  2QVA A;  2N1G A;  5L3E B;  4IL4 A;  2LM2 A;  3AVR A;  1UCU A;  2FBW A;  4MLK A;  2NW8 A;  4AQG A;  2ZM0 A;  1S94 A;  3LSV A;  3J9X 1;  3PE0 A;  3KIN B;  3WTI A;  2XNU A;  3EVY A;  2J4G A;  2ES0 A;  4JI6 T;  4ZI7 E;  3QNU A;  4HTE A;  2E5L T;  3AA6 B;  4TX5 A;  2LT3 A;  4PJJ A;  3RF1 A;  2W67 A;  1OED A;  2AXD S;  2WNJ A;  5C3J A;  3JCF A;  2UZ6 A;  2IAK A;  5LNK A;  4JI8 T;  1VOM A;  4AFG A;  3OYZ A;  4DV0 T;  4CN1 A;  2I6H A;  2X68 A;  3IBP A;  2XNT A;  1XMO T;  2L3L A;  3IF8 B;  4ZS2 A;  5C8Y E;  4QKN A;  4UM3 P;  2FJE A;  4YTM A;  4TV9 E;  4Z8X A;  1R8I A;  5BRX A;  1MIY A;  1UV6 A;  3KBU A;  2DCF A;  4LF9 T;  2XAJ B;  3HR0 A;  4AXP A;  1MMD A;  5C2T A;  2NW9 A;  2EHO A;  2QGS A;  1MIV A;  3PUY F;  4IE0 A;  2LOP A;  5ETW A;  4DVD A;  4O4H E;  5HEU A;  5F5W A;  2W61 A;  3C4Z A;  2XAS B;  1G73 A;  5HYA A;  5M4Y A;  4JI3 T;  5AFH A;  3C84 A;  4O2B E;  3F2E A;  2WP9 A;  1VCT A;  4UF0 B;  4HWC A;  2AE9 A;  4JBW F;  5AQS B;  2WBL A;  2IML A;  2XAF B;  5ABE A;  3O4X E;  2XPK A;  1UX4 A;  4WNK A;  5FYM A;  2BYQ A;  2VK9 A;  2X9W A;  5CA0 E;  3T1Y T;  3LK2 B;  2VB6 A;  5F8P A;  2XAH B;  1XZY A;  1IBK T;  2IC6 A;  2EHO D;  4WV9 A;  3EAB A;  3L8R A;  1MMG A;  2FJB A;  2CM0 A;  4ZI3 C;  1IJ5 A;  3PUS A;  5HEJ A;  5LJM A;  2I0M A;  4WYV A;  1HG2 A;  4ILU A;  1SHZ C;  2ACZ A;  3OKQ A;  5AQU B;  2C0S A;  3AA1 B;  3ZMZ B;  3PUW F;  4EOZ B;  1JNZ A;  3ZN0 B;  3Q9D A;  2H7V C;  4ASK A;  3A8Y C;  2WDV A;  3C4X A;  2K3W A;  5JR9 A;  4YJ2 E;  2WNC A;  5AQG B;  5CGM A;  3MK7 C;  3MXZ A;  2X00 D;  3U8J A;  2YU1 A;  4QH4 A;  5FP3 A;  3UFE A;  4KHZ F;  3KFW X;  1WLX A;  1BR1 A;  2QRX A;  2YME A;  3ZSS A;  3RH3 A;  5JQG E;  3PEO A;  5FXV A;  5AQO B;  3NZP A;  3RIU C;  2VQF T;  4TWD A;  3TLS A;  3MZK B;  5BW2 A;  2UXC T;  2E9X B;  2XSA A;  5LHG B;  2H88 A;  4EV6 A;  3EUH A;  4P09 A;  2UXB T;  5KDM C;  2BR8 A;  3B5M A;  4JI5 T;  3U8L A;  1L0V A;  5H6R B;  3RI5 A;  1IBM T;  2DWG A;  2XJ7 A;  2V26 A;  3AEC A;  3CPZ A;  3ZEF B;  3FB2 A;  4CI1 B;  4WW0 A;  3EI0 A;  1OXZ A;  4B6X A;  4QX7 B;  2UXD T;  5JME A;  3RYH E;  4H9P C;  2ZMA A;  4HGA A;  2NWB A;  2M6B A;  1SA0 E;  4CN4 A;  3AEF A;  3SFD A;  2F4V T;  2IIU A;  4IST A;  3I9Y A;  3SIO A;  4ZS3 A;  4ZI2 C;  2XHE B;  2JJ9 A;  3PUQ A;  2HPJ A;  2VL0 A;  2ZM6 T;  4DR6 T;  4U7I A;  1E1H B;  4DV6 T;  2PJQ A;  3AXJ A;  4TV8 E;  4H63 V;  3HKE E;  1M62 A;  5FVL A;  3RRC A;  2XY8 B;  3ZKR A;  2V5D A;  3ZYK A;  2X9H A;  2NTX A;  5JRC B;  2BVM A;  4YSZ A;  2UUA T;  4UV9 B;  2CXF A;  4CXX A;  4DV5 T;  2G0U A;  2CXL A;  3SS1 A;  5FY0 A;  3HKD E;  4QAC A;  5HCM A;  3K3O A;  3NBX X;  3KVB A;  2PH9 A;  1ZV4 X;  2Q9Q A;  5KE4 A;  1Y64 B;  3N2K E;  3PU3 A;  1HX1 B;  4IE4 A;  2XZE A;  3W15 B;  4DV7 T;  4JEH B;  4L0R A;  4TUY E;  2NTY A;  1Y01 A;  3GN5 B;  4M1P A;  1VRB A;  4BFQ A;  2YIN A;  3M65 A;  3ZC0 A;  2E9X C;  2JQ9 A;  2D0U A;  2BKN A;  4YTP A;  3OPC A;  2XQA A;  3C4W A;  5FL0 A;  1ZOY A;  4IE7 A;  5EK3 A;  4ANJ A;  5AQV B;  4ZJT A;  3PUZ F;  1Z0P A;  2KT9 A;  1XNQ T;  5EK2 A;  3F31 A;  2FJA A;  1H7C A;  4NIQ A;  4UM3 S;  2M67 A;  2WM9 A;  4IGU A;  4ADZ A;  3O1J A;  3Q5D A;  3AE4 A;  2HH7 A;  1KFY A;  2YEV C;  3OJA A;  1KK7 A;  3MA9 A;  3V5S A;  4AI6 A;  2UUC T;  4L9I A;  3OTO T;  4IDN A;  4DV1 T;  2K24 A;  4ILC A;  4LFA T;  3ETU A;  3E0Z A;  5HXC A;  3TLW A;  1KNP A;  4JEU B;  4B3T T;  4P1N A;  1UGO A;  2J47 A;  5ABF A;  4X66 T;  2CBI A;  1NEN A;  2WZH A;  2VWA A;  3AA0 B;  4HFI A;  2W00 A;  3AE6 A;  5KX5 E;  2V6Y A;  4B3S T;  5AFN A;  2LM9 A;  5J2T E;  3QC9 A;  2C5K T;  1HFA A;  3IHR A;  3LJC A;  3L3P A;  4I55 E;  3AE1 A;  4MAL A;  4HQP A;  5HXH A;  5E0O A;  3LFM A;  5BMV E;  3P4S A;  2DL1 A;  4H9S E;  3UT5 E;  5AQT B;  2IDO B;  3PUV F;  3NVO A;  1ZKE A;  4ZI2 D;  4QX8 B;  5AFM B;  1ZHC A;  2DHR A;  1X79 A;  2D9D A;  4X62 T;  2CWY A;  4PJL A;  2PFV A;  1UX2 A;  3E22 E;  2CPT A;  5CJ5 A;  2BG9 B;  5LBQ B;  3H3M A;  1FJG T;  4ILA A;  4PK5 A;  4ZEY A;  3N9L A;  4B3M T;  4I50 E;  2LRK A;  1E2A A;  3U3I A;  2W8G A;  2N9D A;  2BS4 A;  4COF A;  3UFG A;  3QB5 K;  1DU2 A;  2I59 A;  2XM2 A;  3ZCJ A;  2XZ6 A;  5LHI B;  3ONX A;  4FI5 A;  2X66 A;  5DQW A;  3PV0 F;  3VRA A;  4DID B;  3ZJ1 A;  2WQY A;  1D1C A;  2VKH A;  5L3C B;  1J1J A;  3HKC E;  4U2Z A;  4YFS A;  5LGN B;  2J62 A;  2OV9 A;  4LFC T;  2D5U A;  5JDM A;  3DTO A;  4A98 A;  5FXX A;  1SUM B;  3UQ7 A;  1V9D A;  4KUM B;  4GYS A;  1D1A A;  2V7L A;  2XSB A;  2XQ7 A;  1YW0 A;  1N34 T;  4ZK4 A;  4DMV A;  2FUP A;  3AEA A;  5LG4 A;  2CRB A;  4NPP A;  3BQL A;  2KZ7 B;  2LKH A;  4ISS A;  3KV6 A;  2YMD A;  3I0Q A;  5LGU B;  3AE2 A;  4IL9 A;  3SFE A;  5BP0 A;  5FXW A;  2E9X D;  1Z8U A;  4LMK A;  3UTK A;  3I9W A;  3IEE A;  3J7Y q;  2XUE A;  4IDQ A;  2WMN A;  3K3N A;  1I6Z A;  2CBJ A;  4U74 A;  2LHR A;  5JR9 B;  1AJ3 A;  2KLQ A;  4JUY A;  3ETV A;  4KBM B;  4JI1 T;  3ZDH A;  3B13 A;  3RYI E;  3AE3 A;  4U72 A;  2MAW A;  3JC6 D;  4KI0 F;  2BDE A;  4MFR A;  3U78 A;  5FNV E;  3QK6 A;  3P4R A;  1LRZ A;  3Q5W A;  2HPL A;  1I9B A;  4MHC A;  3RLF F;  1UUR A;  3VRB A;  3ZC1 A;  3ZT7 A;  4QHO A;  3ZT5 A;  4ZHQ E;  5LGT B;  4FRR A;  5J5G A;  2V1D B;  4IDZ A;  4HFC A;  2YU2 A;  4HKA A;  2XAG B;  3L09 A;  1LVF A;  1HTJ F;  3SOL A;  4HWH A;  3HI2 A;  3ZPO A;  1M7K A;  2J1D G;  2MPK A;  3Q5E A;  1I94 T;  3AE5 A;  1FMV A;  4I0U A;  4QH1 A;  2XQ4 A;  3N2G E;  2Y57 A;  3P8C D;  4X5T A;  5TVC A;  4H9R C;  1J5W A;  2RA1 A;  4O8S A;  2W63 A;  4UF0 A;  1MND A;  5AFJ A;  1WCR A;  2R6G F;  4F8H A;  5KZU A;  2XQ3 A;  4U2Y A;  3R6N A;  1HF8 A;  2WMO A;  2SPC A;  2Y58 A;  1NEK A;  1YQ4 A;  2BG9 A;  5HXR A;  2WS3 A;  4HEA A;  5AFU L;  3DJB A;  1QLB A;  1X9B A;  2LRL A;  2UU9 T;  4I4T E;  2WSS V;  4EYU A;  2LSY A;  3N5L A;  4EEB A;  2KWH A;  2YDQ A;  3WIP A;  3EDV A;  2BJ0 A;  3SQ6 A;  1S35 A;  3JAF A;  1BR2 A;  2Q9Q C;  5ADX L;  2YDR A;  4XAX B;  4ILB A;  1UK5 A;  2A2F X;  2V8S V;  4CI2 B;  3ZST A;  2IW5 B;  4QAA A;  3AVS A;  2Q9Q B;  4OYK A;  4K0U A;  4YHH T;  4X1I E;  4EZ1 A;  5HWX A;  4HFH A;  5AQM B;  3ANW A;  1LKX A;  3KV5 A;  4DR2 T;  1BR4 A;  3ZMV B;  5LBM A;  2ODV A;  2Y48 B;  4GOU A;  2XZ5 A;  2K48 A;  3PUA A;  4ZR6 A;  1YXR A;  2D2S A;  4AKR B;  1SE7 A;  2WDR A;  3P4Q A;  3KBT A;  4UM1 A;  2E2A A;  4EAH A;  3S4U A;  2FJD A;  5IWA T;  4UVC B;  1OWA A;  4BJM A;  4UM3 A;  2JQH A;  3GWH A;  4YTN A;  2VQE T;  4LF8 T;  2WCA A;  3AEG A;  3AE7 A;  4AKG A;  2VVN A;  2BS2 A;  5AQR B;  3ESL A;  1E7P A;  2WZI A;  5L4H A;  4KHP T;  1OED E;  3UU6 A;  5LHH B;  2WU5 A;  4P0B A;  5CFB A;  5FL1 A;  3LBX B;  4U3C A;  2LE8 A;  1WRD A;  1W0A A;  2UXX B;  1D0Y A;  4IRE A;  2BZB A;  3ZDG A;  2KND A;  2CXD A;  3R84 B;  2JIW A;  1HNX T;  2BKO A;  1XDP A;  3ZMS B;  2H7O A;  5FY1 A;  3Q2M A;  4A56 A;  3K3Q C;  3U8M A;  2Y56 A;  3RIU A;  2JQK A;  4CN6 A;  2XQY A;  4QXB B;  5HXS A;  5AIN A;  3O9X A;  2CMR A;  1GQE A;  2DWK A;  2W62 A;  4YT0 A;  3IGQ A;  1IAP A;  3NZQ A;  4LF6 T;  4NUV A;  4HWF A;  3VU7 H;  4UEM A;  5LB7 B;  2D0T A;  3NRX A;  4H9Q C;  1WR0 A;  3VR9 A;  5JR9 C;  2BKP A;  3TLV A;  3WTK A;  1HR0 T;  5CB4 E;  5J5F A;  4GYR A;  4IHJ E;  3BQI A;  3FXD B;  3X1D A;  2LLY A;  1OED B;  5L3F B;  1UW6 A;  3ONJ A;  4G63 A;  5AQK B;  3WTN A;  2Y54 A;  4AFT A;  3FHN A;  5CO5 A;  4IDO A;  1J5E T;  4EZ4 A;  4H9O C;  2W8F A;  2V5C A;  2WWU A;  4PW8 A;  3NRY A;  5JDL A;  2WN9 A;  4N78 D;  2RPA A;  4D01 A;  2W2U A;  1MIW A;  4OYJ A;  3F57 A;  4OHF A;  5LXT E;  2C5I T;  4PFO A;  3WTJ A;  1VCS A;  4GK0 E;  3UUN A;  4DMW A;  2BYS A;  2E5V A;  4DND A;  1ZEE A;  3UU4 A;  3AB3 B;  5FJV A;  4WZX A;  4EYY R;  3VKH A;  3C51 A;  2QYW A;  2PG8 A;  4O4I E;  2X9X A;  4LF4 T;  5LMN T;  1N32 T;  3P7I A;  3FBZ A;  3RX6 A;  5LCY A;  2LEH A;  4GKJ T;  4DR4 T;  2WU2 A;  3SRZ A;  5J5I A;  3CX7 B;  3NKZ A;  2RP4 A;  5AQP B;  2CEA A;  2EHO C;  5FKY A;  5A1L A;  5AQQ B;  4ZK1 A;  2V7M A;  2BVL A;  2DNX A;  2JMH A;  5LP6 E;  4DV2 T;  5GON E;  5JVD E;  5IUX A;  3ZYM A;  4B3R T;  3KV4 A;  4OX9 T;  3MAC A;  1JNR A;  2CLY C;  3M3Z B;  3I1A A;  2BS3 A;  3SQ9 A;  2IUB A;  4XHE A;  3RYF E;  5LJN A;  4BAY B;  2WZY A;  3CIR A;  2GK9 A;  5J2U E;  3UUM A;  2Q9Q D;  3N9N A;  3RPU A;  1OED C;  5HEH A;  2V6Y B;  1O3X A;  3N9P A;  2KWI B;  5J1G A;  2LSI A;  3I0O A;  3RC8 A;  4TWF A;  4F6R C;  4EB6 E;  4TNV A;  1XMQ T;  2KIN B;  3OVU A;  5JTG A;  5J0Z A;  1XNR T;  5AQI B;  4EGW A;  3FZM B;  4TNW A;  1KF6 A;  3LK4 2;  4O4J E;  2WY2 A;  5CA1 E;  2E9X A;  4QAB A;  3BK9 A;  5JRE A;  3FZL B;  4Z91 A;  2XQ8 A;  4A97 A;  4QWN B;  1WFD A;  3DP7 A;  4PK4 A;  2MYS A;  4DBQ A;  1N33 T;  2LJL A;  2LKG A;  4YY3 T;  4OFZ A;  4HFB A;  1HS7 A; 
#chains in the Genus database with same CATH homology
 5HCJ A;  4WV9 A;  2XYT A;  2ZJV A;  5J5F A;  4QH1 A;  2XNV A;  5IUX A;  3EI0 A;  4UM1 A;  2XQ4 A;  3T4M A;  3UUB A;  2XQ7 A;  1OED A;  5JME A;  2XQA A;  2LLY A;  4ZK4 A;  2Y57 A;  4HQP A;  2WNJ A;  1OED B;  3EHZ A;  2BYN A;  1UW6 A;  4UM3 A;  4UXU A;  4NPP A;  4Z90 A;  3JAD A;  4X5T A;  5HEJ A;  2UZ6 A;  5L4E A;  5TVC A;  3SQ9 A;  5AFL A;  3SH1 A;  5LXB A;  2YOE A;  3TLT A;  2LKH A;  2PGZ A;  4XHE A;  3WTN A;  3U8N A;  2M6B A;  2Y54 A;  3UU8 A;  2YMD A;  3TLU A;  4AFG A;  4AFT A;  2WZY A;  5CO5 A;  2YN6 A;  4PIR A;  4ALX A;  4ZJT A;  3UU5 A;  2XNT A;  5AFJ A;  2W8F A;  4UY2 A;  3SIO A;  4LMJ A;  4IL9 A;  4F8H A;  5BP0 A;  5LG3 A;  5L4H A;  1OED E;  4LMK A;  2XQ3 A;  3RHW A;  3UQ4 A;  3UU6 A;  2QC1 B;  5KZU A;  2C9T A;  2VL0 A;  4UM3 S;  5CFB A;  1OED C;  2WN9 A;  5HEH A;  5HEG A;  4DBM A;  2XQ9 A;  4UM3 P;  5AFM B;  2Y58 A;  4D01 A;  2BG9 E;  2WNL A;  4BQT A;  2BG9 A;  4HFD A;  5BRX A;  4ZRU A;  3JAE A;  2Y7Y A;  5L47 A;  2BG9 C;  1UV6 A;  3C79 A;  4QH5 A;  3ZKR A;  3WTJ A;  3WTO A;  4IRE A;  5SYO A;  3ZDH A;  3GUA A;  2XQ6 A;  4TWF A;  2WNC A;  2XQ5 A;  2X00 D;  3U8J A;  1UX2 A;  3ZDG A;  2BYS A;  2BYR A;  4AFH A;  2MAW A;  2BYP A;  3WTL A;  4QH4 A;  3PMZ A;  4ILC A;  2BG9 B;  3WIP A;  3U8K A;  3UU4 A;  4TNV A;  4ILA A;  2YKS A;  3UU3 A;  5J0Z A;  2BJ0 A;  4NZB A;  2BR7 A;  3EAM A;  3SQ6 A;  3TLW A;  5FJV A;  4ZJS A;  3P4W A;  3JAF A;  3WTH A;  2W8G A;  5HEU A;  2XYS A;  2YME A;  4QAC A;  1I9B A;  3P50 A;  4ILB A;  5HCM A;  4COF A;  2Y56 A;  3U8M A;  5AFK A;  3PEO A;  4XK9 A;  4TNW A;  3RIF A;  5AFH A;  3C84 A;  2PH9 A;  4IL4 A;  2LM2 A;  4QAA A;  2ZJU A;  4TWH A;  5J5H A;  4TWD A;  3RQU A;  3TLS A;  4ZZC A;  2XZ6 A;  5BW2 A;  4EZ1 A;  5KE4 A;  5J5I A;  4LML A;  4HFH A;  3RIA A;  5AIN A;  3RQW A;  4QAB A;  5AFM A;  4HFI A;  3LSV A;  4Z91 A;  3IGQ A;  2XQ8 A;  4FRR A;  3WTI A;  2XNU A;  4A97 A;  5J5G A;  4HFC A;  2BR8 A;  3WTK A;  5AFN A;  3U8L A;  2BYQ A;  4B5D A;  2KSR A;  3RI5 A;  2XZ5 A;  4ZK1 A;  4ZZB A;  4HFE A;  4BFQ A;  4ZR6 A;  4A98 A;  2X00 A;  3WTM A;  5HEO A;  2M6I A;  2LKG A;  3TLV A;  3UQ7 A;  4HFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...