5L4EA

X-ray structure of the 2-22' locally-closed mutant of glic in complex with thiopental
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Proton-gated ion channel
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
source organism Gloeobacter
total genus 89
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l4eA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l4eA01
3P50A 2WNJA 4QH4A 2BYSA 2X00D 2XYSA 3C79A 2PH9A 2WNLA 4HFEA 3WTJA 2XQ4A 3PMZA 5KE4A 4ZZBA 2VL0A 2XNTA 2BR7A 5HCJA 2KSRA 2WZYA 4HQPA 5AFHA 3IGQA 4ZJSA 3WTKA 3UU5A 4AFHA 4X5TA 3U8JA 3U8LA 2Y56A 4UM3A 4UY2A 1OEDA 3EI0A 3ZDHA 3SQ9A 4UXUA 2XZ6A 4LMKA 4A97A 3RQUA 3EHZA 4TNVA 2C9TA 2ZJUA 3ZDGA 1I9BA 5FJVA 3RI5A 4ZK1A 5BRXA 5J5HA 1UV6A 4ILBA 4HFCA 2BYPA 3TLWA 3UUBA 3WTIA 2XQ6A 4NPPA 5J5GA 2XQ7A 2BG9C 3TLTA 3UQ7A 4FRRA 3UU3A 2XNVA 3UU6A 3SQ6A 5AFKA 2XQ8A 2BG9A 2XZ5A 4QAAA 3TLUA 5AFMB 3T4MA 5BP0A 2XYTA 5HEUA 4EZ1A 3LSVA 5HEHA 3EAMA 2LKGA 4IL4A 3RIFA 2XNUA 2YMEA 3U8NA 2UZ6A 3U8KA 4ALXA 1UW6A 2WN9A 2Y54A 2PGZA 2XQ3A 2YKSA 3ZKRA 5IUXA 1UX2A 2BYRA 5AFJA 3TLSA 2BYQA 4QABA 2LLYA 5CFBA 3RHWA 5L4EA 3P4WA 1OEDB 2W8GA 5L4HA 2Y7YA 2BYNA 2XQ9A 3JADA 2Y57A 4XHEA 3WTOA 4D01A 3WTMA 5J5FA 3RIAA 2XQAA 4COFA 5CO5A 2M6BA 3JAEA 4ZK4A 3UU4A 2XQ5A 4BQTA 4ILCA 2QC1B 3PEOA 4HFBA 4UM1A 4F8HA 3SIOA 4IREA 4XK9A 2YOEA 3WTNA 3JAFA 4LMJA 3WTHA 5HCMA 4TWHA 3SH1A 5LXBA 3GUAA 4TWFA 5HEJA 4Z90A 5AFMA 3RQWA 5HEGA 4WV9A 4PIRA 4ILAA 5LG3A 4ZJTA 5BW2A 5SYOA 4A98A 4DBMA 5J0ZA 5TVCA 5AFNA 2BJ0A 2YMDA 5J5IA 4HFHA 4AFTA 5AINA 2LM2A 3C84A 1OEDE 4IL9A 4QH5A 4HFDA 4UM3P 4HFIA 4QH1A 2WNCA 4AFGA 2YN6A 2M6IA 4LMLA 4NZBA 1OEDC 3U8MA 2W8FA 5AFLA 2Y58A 4ZRUA 3WTLA 4TNWA 5L47A 2BR8A 4UM3S 4BFQA 4ZZCA 3TLVA 3WIPA 3UU8A 5JMEA 4Z91A 2LKHA 2X00A 4QACA 2MAWA 5KZUA 2ZJVA 4B5DA 2BG9B 4ZR6A 2BG9E 3UQ4A 5HEOA 4TWDA
chains in the Genus database with same CATH superfamily
2IW5B 3N9QA 4EEBA 4U3CA 5EZYE 2XQ4A 2CEAA 4X5TA 2UU9T 4LF4T 1HS7A 4TNVA 3A5XA 5H6QB 4HWIB 5F8PA 4DR1T 1I9BA 4WW0A 4UVAB 3AE4A 4YT0A 2A3DA 3CWZB 3TLUA 1HNWT 2D5UA 3OYXA 3ZYMA 3AE3A 4TUYE 3ZMTB 4O2AE 2XQ3A 2LSGA 4QXHB 4HFVA 3CKDA 2BYQA 2W8GA 1T7SA 4YTMA 2HPJA 2M6BA 3P4RA 4IREA 4EGWA 1SUMB 2X0YA 5AQMB 5HCMA 5LXBA 2OA5A 4Z90A 3LJCA 4WV9A 2WP9A 4BJNA 2X51A 5JDHA 4P0BA 5JRCB 4H9OC 3MKDA 4IL9A 2LSJA 2V8SV 2NTXA 5AFLA 4YY3T 5HYAA 2BS2A 4ZS2A 3CQXC 5L47A 3NRXA 5AQIB 3I1AA 1ZP0A 3B57A 2BG9B 3AA7B 2BYSA 3OJAA 2V6XA 2X9WA 3AB3B 2VL0A 3PUZF 5AQVB 2KSRA 1YD8G 1HNXT 3WAJA 1MIVA 4OX9T 4UXUA 2BKNA 2CWYA 3CX7B 3Q9DA 5IHYA 4HFCA 4GK5E 3BQKA 1FJGT 2BS3A 4AQFC 3RH3A 2CRBA 4AKGA 2XNVA 4QAAA 1W0BA 1ZHCA 1IJ6A 2J47A 1EZ3A 4DR6T 4X1KE 4CI2B 5GONE 1QUUA 3ZKRA 5DQWA 4UR9A 4IGUA 5AQLB 4YXDA 1WR6A 2P9BA 3TKLB 3M65A 4TWHA 3R84B 4A56A 4TWFA 3RYHE 5HEGA 4PIRA 4ILAA 3ZT5A 2LT3A 3AA0B 1XWMA 4HWCA 2BJ0A 2WMOA 4ADZA 2UXBT 2NP9A 1W09A 3AEDA 1FEWA 1US7B 4ZXLA 2CXFA 2JQQA 4UVCB 3WTLA 1H7CA 3S4UA 4M1PA 4NUVA 2CHOA 4DR5T 2NWBA 4AKIA 4ZEYA 3IHRA 4WBOA 5L3EB 3SFDA 2XZEA 4K0UA 3KBUA 4JI8T 2WU5A 3RQUA 2ZJUA 2UXNB 2E8IA 4QX7B 2IHR1 2XQ6A 3AVSA 3RYCE 4U72A 5J5GA 3UQ7A 2BG9C 3N2OA 3SFEA 3H3MA 5FNVE 5IWAT 4EIWA 4H63V 1N32T 2QA7A 4CQIA 3SWHA 1D0ZA 3PUSA 3J9X1 2YKSA 3U3IA 3NWIA 3W15B 1HR0T 4L9IA 4YLHA 2Q9QA 2CM0A 4ZI2C 1X79A 3P4WA 3UT5E 3WTMA 4GK0E 4DO0A 5JQGE 3N9MA 1G73A 4WNKA 4CXXA 2X67A 5LGNB 3CQGB 3JC6D 3Q5DA 3P4PA 2DCFA 5TVCA 3UTKA 1QLBA 3AEGA 1BR0A 2V26A 2YU1A 4P0AA 2YN6A 1NEKA 2UXCT 4JBWF 3L8RA 4KHPT 4BFQA 2FJEA 2BDEA 5CA1E 3O1IA 5L3GB 4AKRB 3ESLA 4MFRA 4WBNE 4HFEA 4TWDA 4B3MT 3QB5A 4PFPA 2YINA 3G06A 4KMCA 2AXDS 2HN2A 4O4IE 5LNKA 3HR0A 4EAHA 1LVFA 5LB7B 3K8PC 4YJ3E 3U8LA 5L3DB 4GOUA 2ZLYA 2ES0A 4IE5A 5C3JA 3T1YT 2ZM0A 2B1EA 4DUYT 3SS1A 3KVAA 4FRRA 2A2FX 2PFVA 2V6YA 3T4MA 2XYTA 1BR4A 3QK6A 2NW9A 4KX6A 3U8NA 4YHHT 2VKOA 1U4QA 2WN9A 1Z8UA 1E2AA 5ETWA 1Y64B 4PFOA 2VQFT 2XQYA 3SRZA 2RP4A 4QABA 3LFMA 5L4EA 3AXJA 1OEDB 4X20E 2DL1A 3JADA 2Y57A 2VURA 3JAEA 5LP6E 1M7KA 3HKBE 3VKGA 4QXBB 4XBFB 3SH1A 3X1DA 5AQJB 5AFMA 3OYZA 2XHEB 2L8KA 3O9XA 4X64T 3RIUA 2XTLA 2WS3A 3P4QA 2C5KT 4HFIA 3B13A 2VB6A 2LHRA 5LGTB 4KUMB 3RC8A 4ZZCA 1T72A 2E5LT 4KP3C 2V7MA 1UX5A 4DV7T 2PH9A 5JDMA 5FVKA 2OLTA 5AQQB 3RKGA 4NIQA 2LJLA 3ONJA 1XMQT 1UUSA 1XDPA 4MHCA 3ZT7A 3SQ9A 3EDUA 2XZ6A 2C9TA 4U2ZA 3RI5A 5BRXA 2RPAA 3TLWA 3UUNA 3UUBA 5IYZE 2UUAT 4DV2T 3IF8B 5CJ5A 4DV4T 3N9PA 4CXYA 4QX8B 2NOXA 4L5GA 5BMVE 5HXRA 4UELA 3UFEA 1N33T 3C4XA 2WAUA 1WRDA 1UCUA 1UX2A 2YDQA 3KV9A 2VKDA 1MMGA 2V7JA 2PJQA 3Q2MA 3FBZA 5LCYA 3JAFA 3AE5A 4MBQA 4PJNA 2PBIA 4GIWA 4ZJTA 2CHNA 2YU2A 2XAGB 3RKOA 2X9YA 5J5IA 1LKXA 4HFDA 2XM2A 2IUBA 4QH1A 3CQCB 1OEDC 3PUQA 3GN5A 3BQIA 3RF1A 5JMEA 3ZN0B 5L2LA 3ZLIA 1WYBA 4DV5T 2E5VA 2WNJA 3K3OA 3KVBA 5KE4A 4JI3T 3RYFE 4DR7T 4I50E 4HQPA 4X62T 2WMNA 2WM9A 2Q9QB 3ZEFB 3ZYKA 2EHOD 1SE7A 4O2BE 3ZC1A 5FJVA 5EK3A 4K0KT 2K48A 5AFKA 3CVRA 2JQHA 3WI3A 2NR4A 4QHOA 4JI7T 2GK9A 4YSXA 3GMIA 4CN4A 2LRLA 4YFSA 2UXXB 3DTOA 5CFBA 2DHRA 3WAKA 2PG8A 1YXRA 4XK9A 2N2NA 3FBLA 4IT4A 4ZI3C 1AJ3A 3AEBA 3PUWF 2R6GF 5BW2A 4AQGA 3AA1B 4IIJE 3O1JA 1OEDE 1ZOYA 2DWGA 2YEVC 2KXPB 2W8FA 1D1AA 2WSSV 5M4YA 3FB2A 3PV0F 4ZRUA 2IAKA 3AE2A 5FY0A 3UU8A 4U33A 4C91A 2MAWA 4DNDA 3UFGA 2V6YB 1D1BA 2CXLA 4LFCT 3ZPOA 3WTKA 3OBVE 3ZN1B 3FXDB 2N9DA 2Y56A 3HA4A 1OEDA 3EI0A 4H9SE 5HAXA 3AVRA 4DVDA 3AXJB 3CMLA 2WDVA 3VRBA 2K24A 1CUNA 2W62A 4DR2T 3KDSE 4ANJA 2W4XA 1N34T 2BBJA 3BK9A 5F3JA 4IDPA 5AFMB 4E7ZA 4B6XA 5HEHA 4IDOA 2J1DG 4QWNB 3EABA 2XSAA 2Q9QC 5AFJA 5LG4A 4IE6A 3AECA 4XHEA 2Y8DA 3AE8A 2OV9A 4KBMB 4ZK4A 3UU4A 4O8SA 4HFBA 4YHJA 4F8HA 1R8IA 5ABFA 2F4VT 3WTHA 4U7IA 3NBXX 2JMKA 3RPUA 4JI4T 2IIUA 5LA6E 5JVDE 5KXJA 4HN9A 3BQLA 4A98A 4EXTA 1HF8A 3MACA 1HCIA 2V1DB 3C84A 4ZHQE 2X0LB 2W67A 2M6IA 3J7Yq 2CA5A 2W66A 2DLRA 3MJXA 4X1YE 2KLQA 4JLEA 4UM3S 1BR2A 2VWAA 2MPKA 1D0XA 3PURA 3O1HA 4ASKA 3U8JA 3ZMVB 2NTYA 1YQ3A 2HH7A 2SPCA 3SOLA 4CI1B 4U7YA 5H6RB 3C51A 3P7IA 1MNEA 2JIWA 5JDFA 4ILBA 2BYPA 2H3RA 5FMNA 4X1IE 3UU6A 2FUPA 3HKCE 3PUXF 2VVNA 1WFDA 5HEUA 4CZZB 3EAMA 3PU3A 4ALXA 4HEAA 3GN5B 4ERRA 3FXEB 4ISTA 4NXMT 2WZIA 3V5UA 2LEHA 3WTNA 3ZC0A 2KNDA 1VOMA 4IE4A 3OTOT 3OVUA 2BKOA 4QXCB 4DMVA 3KINB 3RIUC 3CX8B 5FKYA 3Q5WA 2XUEA 3AAIA 3C4WA 3PJAJ 2YMDA 3C64A 2UUBT 5FY1A 4X66T 3C98B 3AA6B 1UGOA 3NZQA 4FJOA 5AFUL 4PAGA 5FL0A 3KV4A 3H37A 1SA0E 4HWFA 3ZMUB 4PK6A 4CN1A 2WWVA 5AQSB 1JNRA 5AQNB 4J2CA 4TX5A 4CN6A 5ABEA 4EZHA 4ZZBA 2IDOB 3CX6B 2A72A 4JEHB 2BKPA 2CLYB 1J5ET 5HWYA 4AIUA 4ISSA 3RC3A 2KT9A 4IDQA 5AQPB 2W2UA 3L3PA 3ZSTA 3GA8A 5LJNA 2NW7A 4NPPA 3AEEA 2H89A 3I0QA 1W9RA 2XZ5A 4IHJE 4YSYA 2XASB 4DBQA 5AQTB 2VQET 5LGUB 2E9XD 4DV6T 1MIYA 2QGSA 5JTGA 2KZ7B 1HFAA 4H9NC 3HI2A 1O3XA 2XQ9A 2BYNA 2Y7YA 3RIAA 3Q5EA 2HN1A 3U78A 4ILCA 4PNIA 3JC6C 1S94A 1KF6A 3T1HT 4JYAT 3L09A 2ZM8A 5LG3A 1XMOT 3LDQB 3QB5K 3ONXA 1HG2A 2IC9A 3FZKB 5JREA 5FXZA 4OFZA 3KV5A 4UEMA 2J4GA 4NZBA 2H88A 2D0TA 2LSYA 1IBKT 2Y48B 4JV5T 1MNDA 4TV8E 2WZHA 5J2UE 3AE6A 1MMNA 2XYSA 2WNLA 1KNPA 4EEDA 2JJ9A 2YDSA 4AKLA 3RRCA 2YK0A 1N36T 1BR1A 4UM3A 4DBRA 4LMKA 3EHZA 3AAEB 4I0UA 2RA1A 2ZM2A 4JI0T 3LK3B 5LHIB 1HG5A 4ZK1A 3ABVA 1JNZA 2A9UA 5ABFB 4X65T 4N78D 4DUZT 4LF6T 3RLFF 2Z6EA 4O4HE 4EZ1A 3RIFA 3U8KA 1G8XA 2Y54A 5AQOB 4JUYA 5LBQB 2CLYC 3HL6A 4H63H 2LRKA 3PTRB 3RX6A 2XQAA 1E1HB 4PK4A 2UUCT 2JMHA 1XNQT 3UUXB 1CHUA 3SIOA 2I59A 3A8YC 4JI6T 3NRYA 1W0AA 4U2YA 3EVYA 5HXEA 1D1CA 2EHOB 5KDMC 5AINA 3MZKB 1HX1B 4QH5A 2C0SA 3JCFA 3N2GE 1KEYA 3O4XE 2LKHA 3N2KE 1MMAA 2V7LA 2PTFA 3ZMSB 2V5CA 4Z8XA 3ZMZB 3PMZA 2WU2A 4DV0T 4DR3T 1I94T 2JQKA 1UURA 3CK6A 3ZDGA 5HWXA 3LG7A 3UUMA 5J5HA 1B7TA 3C4ZA 2CBIA 2WQYA 2D2SA 4KI0F 2XAJB 2QRXA 4NUUA 1OXZA 2ACXA 1D0YA 2LSKA 2K9AA 4P1NA 3A7MA 4V1Av 5F5WA 3LSVA 2UZ6A 4EYUA 4U31A 3VR9A 1IJ5A 4XZCA 3M3ZB 2AE9A 1HTJF 5DABA 2LLYA 2X0HA 2BS4A 1VCTA 1YKHB 2V5DA 4E7SA 3HKDE 4COFA 2FJBA 2QC1B 2CE7A 3T8OA 4AKHA 4HWDA 4LMJA 4AXPA 3L39A 2YDRA 1XZYA 5L3FB 5LXTE 1S35A 2CBJA 4G63A 3RQWA 4GYRA 1NWMX 2KWHA 4I55E 5KMGP 4H9RC 3AE1A 4HE8A 2E2AA 4OYKA 1WR0A 3OPCA 1UX4A 3RYIE 3R6NA 2LM9A 3I9WA 3K3QC 2K3WA 1YW0A 2XAHB 4B5DA 2QYWA 2IC6A 4BA9A 1XDOA 1WYCA 2VL8A 2MOZA 3GWHA 2XNTA 2EHOC 2DI4A 5AFHA 3IGQA 3FZHB 5FXXA 3LBXA 3E08A 3V5SA 2BVMA 5FYMA 3TLTA 2HPLA 5ABHA 2Q9QD 3AE9A 5LHGB 3LK42 3PUVF 4IL4A 5KX5E 2PGZA 4HTEA 3TLSA 3VU7H 4EOZB 2KMFA 3CIRA 4JI5T 5FVLA 4CXWA 3NVOA 4B3ST 1QSDA 2H7VC 1T98A 4YSZA 2V7IA 3C50A 3I0OA 2V7KA 2C5IT 4PJJA 3FZMB 2WDRA 3E22E 1FIOA 5J1GA 4WZXA 2ZM6T 5AFNA 4AFTA 2LM2A 3F57A 3QC9A 2J62A 4UF0A 3QUJA 3DP7A 4IDZA 3B5MA 2B76A 1FMWA 5FXVA 2I6HA 2LE8A 4HKAA 4MALA 4QH4A 2X00D 3C79A 4C90A 3PE0A 3ZCIA 5C2TA 3UULA 2FJAA 2CXDA 3PDYA 1V9DA 3ANWA 4ZOLE 5FXWA 3ZDHA 4A97A 3PUGA 4IE0A 5AQKB 5HXHA 4ILUA 2HHHT 1YQ4A 2LSIA 3PUYF 2FJDA 2LOSA 3OKQA 2XY8B 5JDNA 5DQVA 2EHOA 4O4LE 5ABGA 2XNUA 2X9XA 3PJAA 4YTPA 2VVSA 3LK2B 5DJQC 2W61A 2D9DA 3PU8A 3N9OA 2QVAA 3RHWA 2JQ9A 3K3NA 5JDGA 4OYJA 5L3CB 1J1JA 4ZI2D 3EDVA 4H9QC 1Y01A 2X68A 1KFYA 2MBGA 3QOFA 5HEJA 1WLXA 3ZSSA 2H7OA 5SYOA 5JDLA 5LMNT 4DBMA 5J0ZA 4F6RC 5ADXL 1UK5A 1HX8A 5TAOA 4AQYT 2WBLA 2LOPA 3E0ZA 3VR8A 2XPKA 4U74A 4DV3T 4TNWA 5CGMA 3TLVA 4Z91A 5FL1A 3UQ4A 5HEOA 5JR9B 3P50A 4LFAT 2E9XB 4DV1T 1HNZT 1SHZC 4UV9B 1IZNB 2WY2A 5HCJA 4ZJSA 4OK0A 3UU5A 2K5BB 2G0UA 4UY2A 4KHZF 4H9PC 1ZV4X 5AQGB 4YJ2E 2CPTA 2ZMAA 4IE7A 3RRWA 3KBTA 4HGAA 3WTIA 3N9NA 5HXSA 2XQ7A 4ZI7E 3ONLC 4AQFA 2XQ8A 3VHLA 1L0VA 2CCQA 4GKJT 3IA3A 3KV6A 2JPFA 1WCRA 5IUXA 2NW8A 4ZS3A 2KINB 3N5LA 1MMDA 4TV9E 4DIDB 2X9HA 2CMRA 1YKEB 2VKHA 2XAFB 4LF7T 5J5FA 3QNUA 5E0OA 4I43B 5LMUT 2XQ5A 2L9QA 5CA0E 2L3LA 3GUAA 4CI3B 3FHNA 2DWKA 2WWUA 3IEEA 4Q25A 2ODUA 4G2AA 3ETUA 4HFHA 4JEUB 1E7PA 2BVLA 3LBXB 3U8MA 4PJMA 4GYSA 3K1SA 2BR8A 1VRBA 4LF8T 5CB4E 2N1GA 2X00A 4QACA 5KZUA 3N9LA 5JH7E 2ZJVA 1FMVA 2WDQA 4O4JE 4ZR6A 2BG9E 5BR8T 3MXZA 3Q5XA 5EK4A 3AAAB 1DU2A 3H3AA 3WTJA 4HWHA 5C8YE 1GQEA 2WZYA 4MLKA 3NZPA 5JRCA 4AFHA 2X66A 5EK2A 1KK7A 4BAYB 4XAXB 2ODVA 4DMWA 3VRAA 3NKZA 4B3TT 1IBLT 2LHNA 2XAQB 1NENA 3HKEE 4EZ4A 1VCSA 5JR9C 3SQ6A 4FI5A 4NXNT 2BG9A 2E9XC 2CWOA 5HXCA 4PK5A 2FBWA 4I4TE 3EUHA 4QKNA 2W00A 3ZT6A 3I9YA 2BYRA 2I0MA 4UF0B 5FY7A 3FZLB 4JI2T 3RGLA 1J5WA 5LHHB 4BQTA 5LOVE 3ETVA 4UM1A 4L0RA 2YOEA 4UXNB 4LF9T 2M67A 4PJLA 5LJMA 3AEFA 3MA9A 2VASA 3ANWB 1LVKA 5AQFB 1U5PA 4AI6A 1LRZA 4UV8B 4EB6E 2Y58A 2XJ7A 1ZEEA 3KFWX 5L3BB 1XNRT 4PW8A 3VKHA 3WIPA 4A5XA 2C5JA 3F2EA 5J2TE 1OWAA 4TN7B 1KNRA 1IAPA 4WYVA 2BR7A 4B3RT 3D0TA 1T8BA 2UXDT 1MIWA 2DNXA 3ZJ2A 1NAFA 4UVBB 4IDNA 5AQRB 2W0GA 1UV6A 1Z0PA 5LBMA 2Y6XA 4EYYR 3DJBA 3UU3A 4UIGA 4DR4T 4JI1T 4EV6A 5AQUB 4TZ4C 5BP0A 3MK7C 3ZJ1A 5A1LA 2LKGA 2YMEA 1X9BA 1UW6A 5FP3A 4GKKT 3AE7A 3ZYLA 1ZKEA 2D0UA 1KNZA 5L4HA 4D01A 3WTOA 2JRKA 3F31A 5CO5A 1M62A 4BJMA 2MTQA 3PEOA 5JR9A 2BZBA 5LYJE 3CPZA 2E9XA 4P09A 4AISA 3FZFB 3AEAA 5JDQA 2MYSA 3P8CD 5AQHB 1I6ZA 4OHFA 3PUAA 2XM1A 2W63A 1IBMT 4YTNA 3P4SA 3IBPA 2WB5A 2KWIB 4ZI3D 2XSBA 4LF5T 2WCAA 4UM3P 2ACZA 2WNCA 4AFGA 4LFBT 4LMLA 2BBHA 2VK9A 2IMLA 2VKJA 3ZCJA
chains in the Genus database with same CATH topology
3P50A 2WNJA 4QH4A 2BYSA 2X00D 2XYSA 3C79A 2PH9A 2WNLA 4HFEA 3WTJA 2XQ4A 3PMZA 5KE4A 4ZZBA 2VL0A 2XNTA 2BR7A 5HCJA 2KSRA 2WZYA 4HQPA 5AFHA 3IGQA 4ZJSA 3WTKA 3UU5A 4AFHA 4X5TA 3U8JA 3U8LA 2Y56A 4UM3A 4UY2A 1OEDA 3EI0A 3ZDHA 3SQ9A 4UXUA 2XZ6A 4LMKA 4A97A 3RQUA 3EHZA 4TNVA 2C9TA 2ZJUA 3ZDGA 1I9BA 5FJVA 3RI5A 4ZK1A 5BRXA 5J5HA 1UV6A 4ILBA 4HFCA 2BYPA 3TLWA 3UUBA 3WTIA 2XQ6A 4NPPA 5J5GA 2XQ7A 2BG9C 3TLTA 3UQ7A 4FRRA 3UU3A 2XNVA 3UU6A 3SQ6A 5AFKA 2XQ8A 2BG9A 2XZ5A 4QAAA 3TLUA 5AFMB 3T4MA 5BP0A 2XYTA 5HEUA 4EZ1A 3LSVA 5HEHA 3EAMA 2LKGA 4IL4A 3RIFA 2XNUA 2YMEA 3U8NA 2UZ6A 3U8KA 4ALXA 1UW6A 2WN9A 2Y54A 2PGZA 2XQ3A 2YKSA 3ZKRA 5IUXA 1UX2A 2BYRA 5AFJA 3TLSA 2BYQA 4QABA 2LLYA 5CFBA 3RHWA 5L4EA 3P4WA 1OEDB 2W8GA 5L4HA 2Y7YA 2BYNA 2XQ9A 3JADA 2Y57A 4XHEA 3WTOA 4D01A 3WTMA 5J5FA 3RIAA 2XQAA 4COFA 5CO5A 2M6BA 3JAEA 4ZK4A 3UU4A 2XQ5A 4BQTA 4ILCA 2QC1B 3PEOA 4HFBA 4UM1A 4F8HA 3SIOA 4IREA 4XK9A 2YOEA 3WTNA 3JAFA 4LMJA 3WTHA 5HCMA 4TWHA 3SH1A 5LXBA 3GUAA 4TWFA 5HEJA 4Z90A 5AFMA 3RQWA 5HEGA 4WV9A 4PIRA 4ILAA 5LG3A 4ZJTA 5BW2A 5SYOA 4A98A 4DBMA 5J0ZA 5TVCA 5AFNA 2BJ0A 2YMDA 5J5IA 4HFHA 4AFTA 5AINA 2LM2A 3C84A 1OEDE 4IL9A 4QH5A 4HFDA 4UM3P 4HFIA 4QH1A 2WNCA 4AFGA 2YN6A 2M6IA 4LMLA 4NZBA 1OEDC 3U8MA 2W8FA 5AFLA 2Y58A 4ZRUA 3WTLA 4TNWA 5L47A 2BR8A 4UM3S 4BFQA 4ZZCA 3TLVA 3WIPA 3UU8A 5JMEA 4Z91A 2LKHA 2X00A 4QACA 2MAWA 5KZUA 2ZJVA 4B5DA 2BG9B 4ZR6A 2BG9E 3UQ4A 5HEOA 4TWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P50 A;  2WNJ A;  4QH4 A;  2BYS A;  2X00 D;  2XYS A;  3C79 A;  2PH9 A;  2WNL A;  4HFE A;  3WTJ A;  2XQ4 A;  3PMZ A;  5KE4 A;  4ZZB A;  2VL0 A;  2XNT A;  2BR7 A;  5HCJ A;  2KSR A;  2WZY A;  4HQP A;  5AFH A;  3IGQ A;  4ZJS A;  3WTK A;  3UU5 A;  4AFH A;  4X5T A;  3U8J A;  3U8L A;  2Y56 A;  4UM3 A;  4UY2 A;  1OED A;  3EI0 A;  3ZDH A;  3SQ9 A;  4UXU A;  2XZ6 A;  4LMK A;  4A97 A;  3RQU A;  3EHZ A;  4TNV A;  2C9T A;  2ZJU A;  3ZDG A;  1I9B A;  5FJV A;  3RI5 A;  4ZK1 A;  5BRX A;  5J5H A;  1UV6 A;  4ILB A;  4HFC A;  2BYP A;  3TLW A;  3UUB A;  3WTI A;  2XQ6 A;  4NPP A;  5J5G A;  2XQ7 A;  2BG9 C;  3TLT A;  3UQ7 A;  4FRR A;  3UU3 A;  2XNV A;  3UU6 A;  3SQ6 A;  5AFK A;  2XQ8 A;  2BG9 A;  2XZ5 A;  4QAA A;  3TLU A;  5AFM B;  3T4M A;  5BP0 A;  2XYT A;  5HEU A;  4EZ1 A;  3LSV A;  5HEH A;  3EAM A;  2LKG A;  4IL4 A;  3RIF A;  2XNU A;  2YME A;  3U8N A;  2UZ6 A;  3U8K A;  4ALX A;  1UW6 A;  2WN9 A;  2Y54 A;  2PGZ A;  2XQ3 A;  2YKS A;  3ZKR A;  5IUX A;  1UX2 A;  2BYR A;  5AFJ A;  3TLS A;  2BYQ A;  4QAB A;  2LLY A;  5CFB A;  3RHW A;  5L4E A;  3P4W A;  1OED B;  2W8G A;  5L4H A;  2Y7Y A;  2BYN A;  2XQ9 A;  3JAD A;  2Y57 A;  4XHE A;  3WTO A;  4D01 A;  3WTM A;  5J5F A;  3RIA A;  2XQA A;  4COF A;  5CO5 A;  2M6B A;  3JAE A;  4ZK4 A;  3UU4 A;  2XQ5 A;  4BQT A;  4ILC A;  2QC1 B;  3PEO A;  4HFB A;  4UM1 A;  4F8H A;  3SIO A;  4IRE A;  4XK9 A;  2YOE A;  3WTN A;  3JAF A;  4LMJ A;  3WTH A;  5HCM A;  4TWH A;  3SH1 A;  5LXB A;  3GUA A;  4TWF A;  5HEJ A;  4Z90 A;  5AFM A;  3RQW A;  5HEG A;  4WV9 A;  4PIR A;  4ILA A;  5LG3 A;  4ZJT A;  5BW2 A;  5SYO A;  4A98 A;  4DBM A;  5J0Z A;  5TVC A;  5AFN A;  2BJ0 A;  2YMD A;  5J5I A;  4HFH A;  4AFT A;  5AIN A;  2LM2 A;  3C84 A;  1OED E;  4IL9 A;  4QH5 A;  4HFD A;  4UM3 P;  4HFI A;  4QH1 A;  2WNC A;  4AFG A;  2YN6 A;  2M6I A;  4LML A;  4NZB A;  1OED C;  3U8M A;  2W8F A;  5AFL A;  2Y58 A;  4ZRU A;  3WTL A;  4TNW A;  5L47 A;  2BR8 A;  4UM3 S;  4BFQ A;  4ZZC A;  3TLV A;  3WIP A;  3UU8 A;  5JME A;  4Z91 A;  2LKH A;  2X00 A;  4QAC A;  2MAW A;  5KZU A;  2ZJV A;  4B5D A;  2BG9 B;  4ZR6 A;  2BG9 E;  3UQ4 A;  5HEO A;  4TWD A; 
#chains in the Genus database with same CATH topology
 2IW5 B;  3N9Q A;  4EEB A;  4U3C A;  5EZY E;  2XQ4 A;  2CEA A;  4X5T A;  2UU9 T;  4LF4 T;  1HS7 A;  4TNV A;  3A5X A;  5H6Q B;  4HWI B;  5F8P A;  4DR1 T;  1I9B A;  4WW0 A;  4UVA B;  3AE4 A;  4YT0 A;  2A3D A;  3CWZ B;  3TLU A;  1HNW T;  2D5U A;  3OYX A;  3ZYM A;  3AE3 A;  4TUY E;  3ZMT B;  4O2A E;  2XQ3 A;  2LSG A;  4QXH B;  4HFV A;  3CKD A;  2BYQ A;  2W8G A;  1T7S A;  4YTM A;  2HPJ A;  2M6B A;  3P4R A;  4IRE A;  4EGW A;  1SUM B;  2X0Y A;  5AQM B;  5HCM A;  5LXB A;  2OA5 A;  4Z90 A;  3LJC A;  4WV9 A;  2WP9 A;  4BJN A;  2X51 A;  5JDH A;  4P0B A;  5JRC B;  4H9O C;  3MKD A;  4IL9 A;  2LSJ A;  2V8S V;  2NTX A;  5AFL A;  4YY3 T;  5HYA A;  2BS2 A;  4ZS2 A;  3CQX C;  5L47 A;  3NRX A;  5AQI B;  3I1A A;  1ZP0 A;  3B57 A;  2BG9 B;  3AA7 B;  2BYS A;  3OJA A;  2V6X A;  2X9W A;  3AB3 B;  2VL0 A;  3PUZ F;  5AQV B;  2KSR A;  1YD8 G;  1HNX T;  3WAJ A;  1MIV A;  4OX9 T;  4UXU A;  2BKN A;  2CWY A;  3CX7 B;  3Q9D A;  5IHY A;  4HFC A;  4GK5 E;  3BQK A;  1FJG T;  2BS3 A;  4AQF C;  3RH3 A;  2CRB A;  4AKG A;  2XNV A;  4QAA A;  1W0B A;  1ZHC A;  1IJ6 A;  2J47 A;  1EZ3 A;  4DR6 T;  4X1K E;  4CI2 B;  5GON E;  1QUU A;  3ZKR A;  5DQW A;  4UR9 A;  4IGU A;  5AQL B;  4YXD A;  1WR6 A;  2P9B A;  3TKL B;  3M65 A;  4TWH A;  3R84 B;  4A56 A;  4TWF A;  3RYH E;  5HEG A;  4PIR A;  4ILA A;  3ZT5 A;  2LT3 A;  3AA0 B;  1XWM A;  4HWC A;  2BJ0 A;  2WMO A;  4ADZ A;  2UXB T;  2NP9 A;  1W09 A;  3AED A;  1FEW A;  1US7 B;  4ZXL A;  2CXF A;  2JQQ A;  4UVC B;  3WTL A;  1H7C A;  3S4U A;  4M1P A;  4NUV A;  2CHO A;  4DR5 T;  2NWB A;  4AKI A;  4ZEY A;  3IHR A;  4WBO A;  5L3E B;  3SFD A;  2XZE A;  4K0U A;  3KBU A;  4JI8 T;  2WU5 A;  3RQU A;  2ZJU A;  2UXN B;  2E8I A;  4QX7 B;  2IHR 1;  2XQ6 A;  3AVS A;  3RYC E;  4U72 A;  5J5G A;  3UQ7 A;  2BG9 C;  3N2O A;  3SFE A;  3H3M A;  5FNV E;  5IWA T;  4EIW A;  4H63 V;  1N32 T;  2QA7 A;  4CQI A;  3SWH A;  1D0Z A;  3PUS A;  3J9X 1;  2YKS A;  3U3I A;  3NWI A;  3W15 B;  1HR0 T;  4L9I A;  4YLH A;  2Q9Q A;  2CM0 A;  4ZI2 C;  1X79 A;  3P4W A;  3UT5 E;  3WTM A;  4GK0 E;  4DO0 A;  5JQG E;  3N9M A;  1G73 A;  4WNK A;  4CXX A;  2X67 A;  5LGN B;  3CQG B;  3JC6 D;  3Q5D A;  3P4P A;  2DCF A;  5TVC A;  3UTK A;  1QLB A;  3AEG A;  1BR0 A;  2V26 A;  2YU1 A;  4P0A A;  2YN6 A;  1NEK A;  2UXC T;  4JBW F;  3L8R A;  4KHP T;  4BFQ A;  2FJE A;  2BDE A;  5CA1 E;  3O1I A;  5L3G B;  4AKR B;  3ESL A;  4MFR A;  4WBN E;  4HFE A;  4TWD A;  4B3M T;  3QB5 A;  4PFP A;  2YIN A;  3G06 A;  4KMC A;  2AXD S;  2HN2 A;  4O4I E;  5LNK A;  3HR0 A;  4EAH A;  1LVF A;  5LB7 B;  3K8P C;  4YJ3 E;  3U8L A;  5L3D B;  4GOU A;  2ZLY A;  2ES0 A;  4IE5 A;  5C3J A;  3T1Y T;  2ZM0 A;  2B1E A;  4DUY T;  3SS1 A;  3KVA A;  4FRR A;  2A2F X;  2PFV A;  2V6Y A;  3T4M A;  2XYT A;  1BR4 A;  3QK6 A;  2NW9 A;  4KX6 A;  3U8N A;  4YHH T;  2VKO A;  1U4Q A;  2WN9 A;  1Z8U A;  1E2A A;  5ETW A;  1Y64 B;  4PFO A;  2VQF T;  2XQY A;  3SRZ A;  2RP4 A;  4QAB A;  3LFM A;  5L4E A;  3AXJ A;  1OED B;  4X20 E;  2DL1 A;  3JAD A;  2Y57 A;  2VUR A;  3JAE A;  5LP6 E;  1M7K A;  3HKB E;  3VKG A;  4QXB B;  4XBF B;  3SH1 A;  3X1D A;  5AQJ B;  5AFM A;  3OYZ A;  2XHE B;  2L8K A;  3O9X A;  4X64 T;  3RIU A;  2XTL A;  2WS3 A;  3P4Q A;  2C5K T;  4HFI A;  3B13 A;  2VB6 A;  2LHR A;  5LGT B;  4KUM B;  3RC8 A;  4ZZC A;  1T72 A;  2E5L T;  4KP3 C;  2V7M A;  1UX5 A;  4DV7 T;  2PH9 A;  5JDM A;  5FVK A;  2OLT A;  5AQQ B;  3RKG A;  4NIQ A;  2LJL A;  3ONJ A;  1XMQ T;  1UUS A;  1XDP A;  4MHC A;  3ZT7 A;  3SQ9 A;  3EDU A;  2XZ6 A;  2C9T A;  4U2Z A;  3RI5 A;  5BRX A;  2RPA A;  3TLW A;  3UUN A;  3UUB A;  5IYZ E;  2UUA T;  4DV2 T;  3IF8 B;  5CJ5 A;  4DV4 T;  3N9P A;  4CXY A;  4QX8 B;  2NOX A;  4L5G A;  5BMV E;  5HXR A;  4UEL A;  3UFE A;  1N33 T;  3C4X A;  2WAU A;  1WRD A;  1UCU A;  1UX2 A;  2YDQ A;  3KV9 A;  2VKD A;  1MMG A;  2V7J A;  2PJQ A;  3Q2M A;  3FBZ A;  5LCY A;  3JAF A;  3AE5 A;  4MBQ A;  4PJN A;  2PBI A;  4GIW A;  4ZJT A;  2CHN A;  2YU2 A;  2XAG B;  3RKO A;  2X9Y A;  5J5I A;  1LKX A;  4HFD A;  2XM2 A;  2IUB A;  4QH1 A;  3CQC B;  1OED C;  3PUQ A;  3GN5 A;  3BQI A;  3RF1 A;  5JME A;  3ZN0 B;  5L2L A;  3ZLI A;  1WYB A;  4DV5 T;  2E5V A;  2WNJ A;  3K3O A;  3KVB A;  5KE4 A;  4JI3 T;  3RYF E;  4DR7 T;  4I50 E;  4HQP A;  4X62 T;  2WMN A;  2WM9 A;  2Q9Q B;  3ZEF B;  3ZYK A;  2EHO D;  1SE7 A;  4O2B E;  3ZC1 A;  5FJV A;  5EK3 A;  4K0K T;  2K48 A;  5AFK A;  3CVR A;  2JQH A;  3WI3 A;  2NR4 A;  4QHO A;  4JI7 T;  2GK9 A;  4YSX A;  3GMI A;  4CN4 A;  2LRL A;  4YFS A;  2UXX B;  3DTO A;  5CFB A;  2DHR A;  3WAK A;  2PG8 A;  1YXR A;  4XK9 A;  2N2N A;  3FBL A;  4IT4 A;  4ZI3 C;  1AJ3 A;  3AEB A;  3PUW F;  2R6G F;  5BW2 A;  4AQG A;  3AA1 B;  4IIJ E;  3O1J A;  1OED E;  1ZOY A;  2DWG A;  2YEV C;  2KXP B;  2W8F A;  1D1A A;  2WSS V;  5M4Y A;  3FB2 A;  3PV0 F;  4ZRU A;  2IAK A;  3AE2 A;  5FY0 A;  3UU8 A;  4U33 A;  4C91 A;  2MAW A;  4DND A;  3UFG A;  2V6Y B;  1D1B A;  2CXL A;  4LFC T;  3ZPO A;  3WTK A;  3OBV E;  3ZN1 B;  3FXD B;  2N9D A;  2Y56 A;  3HA4 A;  1OED A;  3EI0 A;  4H9S E;  5HAX A;  3AVR A;  4DVD A;  3AXJ B;  3CML A;  2WDV A;  3VRB A;  2K24 A;  1CUN A;  2W62 A;  4DR2 T;  3KDS E;  4ANJ A;  2W4X A;  1N34 T;  2BBJ A;  3BK9 A;  5F3J A;  4IDP A;  5AFM B;  4E7Z A;  4B6X A;  5HEH A;  4IDO A;  2J1D G;  4QWN B;  3EAB A;  2XSA A;  2Q9Q C;  5AFJ A;  5LG4 A;  4IE6 A;  3AEC A;  4XHE A;  2Y8D A;  3AE8 A;  2OV9 A;  4KBM B;  4ZK4 A;  3UU4 A;  4O8S A;  4HFB A;  4YHJ A;  4F8H A;  1R8I A;  5ABF A;  2F4V T;  3WTH A;  4U7I A;  3NBX X;  2JMK A;  3RPU A;  4JI4 T;  2IIU A;  5LA6 E;  5JVD E;  5KXJ A;  4HN9 A;  3BQL A;  4A98 A;  4EXT A;  1HF8 A;  3MAC A;  1HCI A;  2V1D B;  3C84 A;  4ZHQ E;  2X0L B;  2W67 A;  2M6I A;  3J7Y q;  2CA5 A;  2W66 A;  2DLR A;  3MJX A;  4X1Y E;  2KLQ A;  4JLE A;  4UM3 S;  1BR2 A;  2VWA A;  2MPK A;  1D0X A;  3PUR A;  3O1H A;  4ASK A;  3U8J A;  3ZMV B;  2NTY A;  1YQ3 A;  2HH7 A;  2SPC A;  3SOL A;  4CI1 B;  4U7Y A;  5H6R B;  3C51 A;  3P7I A;  1MNE A;  2JIW A;  5JDF A;  4ILB A;  2BYP A;  2H3R A;  5FMN A;  4X1I E;  3UU6 A;  2FUP A;  3HKC E;  3PUX F;  2VVN A;  1WFD A;  5HEU A;  4CZZ B;  3EAM A;  3PU3 A;  4ALX A;  4HEA A;  3GN5 B;  4ERR A;  3FXE B;  4IST A;  4NXM T;  2WZI A;  3V5U A;  2LEH A;  3WTN A;  3ZC0 A;  2KND A;  1VOM A;  4IE4 A;  3OTO T;  3OVU A;  2BKO A;  4QXC B;  4DMV A;  3KIN B;  3RIU C;  3CX8 B;  5FKY A;  3Q5W A;  2XUE A;  3AAI A;  3C4W A;  3PJA J;  2YMD A;  3C64 A;  2UUB T;  5FY1 A;  4X66 T;  3C98 B;  3AA6 B;  1UGO A;  3NZQ A;  4FJO A;  5AFU L;  4PAG A;  5FL0 A;  3KV4 A;  3H37 A;  1SA0 E;  4HWF A;  3ZMU B;  4PK6 A;  4CN1 A;  2WWV A;  5AQS B;  1JNR A;  5AQN B;  4J2C A;  4TX5 A;  4CN6 A;  5ABE A;  4EZH A;  4ZZB A;  2IDO B;  3CX6 B;  2A72 A;  4JEH B;  2BKP A;  2CLY B;  1J5E T;  5HWY A;  4AIU A;  4ISS A;  3RC3 A;  2KT9 A;  4IDQ A;  5AQP B;  2W2U A;  3L3P A;  3ZST A;  3GA8 A;  5LJN A;  2NW7 A;  4NPP A;  3AEE A;  2H89 A;  3I0Q A;  1W9R A;  2XZ5 A;  4IHJ E;  4YSY A;  2XAS B;  4DBQ A;  5AQT B;  2VQE T;  5LGU B;  2E9X D;  4DV6 T;  1MIY A;  2QGS A;  5JTG A;  2KZ7 B;  1HFA A;  4H9N C;  3HI2 A;  1O3X A;  2XQ9 A;  2BYN A;  2Y7Y A;  3RIA A;  3Q5E A;  2HN1 A;  3U78 A;  4ILC A;  4PNI A;  3JC6 C;  1S94 A;  1KF6 A;  3T1H T;  4JYA T;  3L09 A;  2ZM8 A;  5LG3 A;  1XMO T;  3LDQ B;  3QB5 K;  3ONX A;  1HG2 A;  2IC9 A;  3FZK B;  5JRE A;  5FXZ A;  4OFZ A;  3KV5 A;  4UEM A;  2J4G A;  4NZB A;  2H88 A;  2D0T A;  2LSY A;  1IBK T;  2Y48 B;  4JV5 T;  1MND A;  4TV8 E;  2WZH A;  5J2U E;  3AE6 A;  1MMN A;  2XYS A;  2WNL A;  1KNP A;  4EED A;  2JJ9 A;  2YDS A;  4AKL A;  3RRC A;  2YK0 A;  1N36 T;  1BR1 A;  4UM3 A;  4DBR A;  4LMK A;  3EHZ A;  3AAE B;  4I0U A;  2RA1 A;  2ZM2 A;  4JI0 T;  3LK3 B;  5LHI B;  1HG5 A;  4ZK1 A;  3ABV A;  1JNZ A;  2A9U A;  5ABF B;  4X65 T;  4N78 D;  4DUZ T;  4LF6 T;  3RLF F;  2Z6E A;  4O4H E;  4EZ1 A;  3RIF A;  3U8K A;  1G8X A;  2Y54 A;  5AQO B;  4JUY A;  5LBQ B;  2CLY C;  3HL6 A;  4H63 H;  2LRK A;  3PTR B;  3RX6 A;  2XQA A;  1E1H B;  4PK4 A;  2UUC T;  2JMH A;  1XNQ T;  3UUX B;  1CHU A;  3SIO A;  2I59 A;  3A8Y C;  4JI6 T;  3NRY A;  1W0A A;  4U2Y A;  3EVY A;  5HXE A;  1D1C A;  2EHO B;  5KDM C;  5AIN A;  3MZK B;  1HX1 B;  4QH5 A;  2C0S A;  3JCF A;  3N2G E;  1KEY A;  3O4X E;  2LKH A;  3N2K E;  1MMA A;  2V7L A;  2PTF A;  3ZMS B;  2V5C A;  4Z8X A;  3ZMZ B;  3PMZ A;  2WU2 A;  4DV0 T;  4DR3 T;  1I94 T;  2JQK A;  1UUR A;  3CK6 A;  3ZDG A;  5HWX A;  3LG7 A;  3UUM A;  5J5H A;  1B7T A;  3C4Z A;  2CBI A;  2WQY A;  2D2S A;  4KI0 F;  2XAJ B;  2QRX A;  4NUU A;  1OXZ A;  2ACX A;  1D0Y A;  2LSK A;  2K9A A;  4P1N A;  3A7M A;  4V1A v;  5F5W A;  3LSV A;  2UZ6 A;  4EYU A;  4U31 A;  3VR9 A;  1IJ5 A;  4XZC A;  3M3Z B;  2AE9 A;  1HTJ F;  5DAB A;  2LLY A;  2X0H A;  2BS4 A;  1VCT A;  1YKH B;  2V5D A;  4E7S A;  3HKD E;  4COF A;  2FJB A;  2QC1 B;  2CE7 A;  3T8O A;  4AKH A;  4HWD A;  4LMJ A;  4AXP A;  3L39 A;  2YDR A;  1XZY A;  5L3F B;  5LXT E;  1S35 A;  2CBJ A;  4G63 A;  3RQW A;  4GYR A;  1NWM X;  2KWH A;  4I55 E;  5KMG P;  4H9R C;  3AE1 A;  4HE8 A;  2E2A A;  4OYK A;  1WR0 A;  3OPC A;  1UX4 A;  3RYI E;  3R6N A;  2LM9 A;  3I9W A;  3K3Q C;  2K3W A;  1YW0 A;  2XAH B;  4B5D A;  2QYW A;  2IC6 A;  4BA9 A;  1XDO A;  1WYC A;  2VL8 A;  2MOZ A;  3GWH A;  2XNT A;  2EHO C;  2DI4 A;  5AFH A;  3IGQ A;  3FZH B;  5FXX A;  3LBX A;  3E08 A;  3V5S A;  2BVM A;  5FYM A;  3TLT A;  2HPL A;  5ABH A;  2Q9Q D;  3AE9 A;  5LHG B;  3LK4 2;  3PUV F;  4IL4 A;  5KX5 E;  2PGZ A;  4HTE A;  3TLS A;  3VU7 H;  4EOZ B;  2KMF A;  3CIR A;  4JI5 T;  5FVL A;  4CXW A;  3NVO A;  4B3S T;  1QSD A;  2H7V C;  1T98 A;  4YSZ A;  2V7I A;  3C50 A;  3I0O A;  2V7K A;  2C5I T;  4PJJ A;  3FZM B;  2WDR A;  3E22 E;  1FIO A;  5J1G A;  4WZX A;  2ZM6 T;  5AFN A;  4AFT A;  2LM2 A;  3F57 A;  3QC9 A;  2J62 A;  4UF0 A;  3QUJ A;  3DP7 A;  4IDZ A;  3B5M A;  2B76 A;  1FMW A;  5FXV A;  2I6H A;  2LE8 A;  4HKA A;  4MAL A;  4QH4 A;  2X00 D;  3C79 A;  4C90 A;  3PE0 A;  3ZCI A;  5C2T A;  3UUL A;  2FJA A;  2CXD A;  3PDY A;  1V9D A;  3ANW A;  4ZOL E;  5FXW A;  3ZDH A;  4A97 A;  3PUG A;  4IE0 A;  5AQK B;  5HXH A;  4ILU A;  2HHH T;  1YQ4 A;  2LSI A;  3PUY F;  2FJD A;  2LOS A;  3OKQ A;  2XY8 B;  5JDN A;  5DQV A;  2EHO A;  4O4L E;  5ABG A;  2XNU A;  2X9X A;  3PJA A;  4YTP A;  2VVS A;  3LK2 B;  5DJQ C;  2W61 A;  2D9D A;  3PU8 A;  3N9O A;  2QVA A;  3RHW A;  2JQ9 A;  3K3N A;  5JDG A;  4OYJ A;  5L3C B;  1J1J A;  4ZI2 D;  3EDV A;  4H9Q C;  1Y01 A;  2X68 A;  1KFY A;  2MBG A;  3QOF A;  5HEJ A;  1WLX A;  3ZSS A;  2H7O A;  5SYO A;  5JDL A;  5LMN T;  4DBM A;  5J0Z A;  4F6R C;  5ADX L;  1UK5 A;  1HX8 A;  5TAO A;  4AQY T;  2WBL A;  2LOP A;  3E0Z A;  3VR8 A;  2XPK A;  4U74 A;  4DV3 T;  4TNW A;  5CGM A;  3TLV A;  4Z91 A;  5FL1 A;  3UQ4 A;  5HEO A;  5JR9 B;  3P50 A;  4LFA T;  2E9X B;  4DV1 T;  1HNZ T;  1SHZ C;  4UV9 B;  1IZN B;  2WY2 A;  5HCJ A;  4ZJS A;  4OK0 A;  3UU5 A;  2K5B B;  2G0U A;  4UY2 A;  4KHZ F;  4H9P C;  1ZV4 X;  5AQG B;  4YJ2 E;  2CPT A;  2ZMA A;  4IE7 A;  3RRW A;  3KBT A;  4HGA A;  3WTI A;  3N9N A;  5HXS A;  2XQ7 A;  4ZI7 E;  3ONL C;  4AQF A;  2XQ8 A;  3VHL A;  1L0V A;  2CCQ A;  4GKJ T;  3IA3 A;  3KV6 A;  2JPF A;  1WCR A;  5IUX A;  2NW8 A;  4ZS3 A;  2KIN B;  3N5L A;  1MMD A;  4TV9 E;  4DID B;  2X9H A;  2CMR A;  1YKE B;  2VKH A;  2XAF B;  4LF7 T;  5J5F A;  3QNU A;  5E0O A;  4I43 B;  5LMU T;  2XQ5 A;  2L9Q A;  5CA0 E;  2L3L A;  3GUA A;  4CI3 B;  3FHN A;  2DWK A;  2WWU A;  3IEE A;  4Q25 A;  2ODU A;  4G2A A;  3ETU A;  4HFH A;  4JEU B;  1E7P A;  2BVL A;  3LBX B;  3U8M A;  4PJM A;  4GYS A;  3K1S A;  2BR8 A;  1VRB A;  4LF8 T;  5CB4 E;  2N1G A;  2X00 A;  4QAC A;  5KZU A;  3N9L A;  5JH7 E;  2ZJV A;  1FMV A;  2WDQ A;  4O4J E;  4ZR6 A;  2BG9 E;  5BR8 T;  3MXZ A;  3Q5X A;  5EK4 A;  3AAA B;  1DU2 A;  3H3A A;  3WTJ A;  4HWH A;  5C8Y E;  1GQE A;  2WZY A;  4MLK A;  3NZP A;  5JRC A;  4AFH A;  2X66 A;  5EK2 A;  1KK7 A;  4BAY B;  4XAX B;  2ODV A;  4DMW A;  3VRA A;  3NKZ A;  4B3T T;  1IBL T;  2LHN A;  2XAQ B;  1NEN A;  3HKE E;  4EZ4 A;  1VCS A;  5JR9 C;  3SQ6 A;  4FI5 A;  4NXN T;  2BG9 A;  2E9X C;  2CWO A;  5HXC A;  4PK5 A;  2FBW A;  4I4T E;  3EUH A;  4QKN A;  2W00 A;  3ZT6 A;  3I9Y A;  2BYR A;  2I0M A;  4UF0 B;  5FY7 A;  3FZL B;  4JI2 T;  3RGL A;  1J5W A;  5LHH B;  4BQT A;  5LOV E;  3ETV A;  4UM1 A;  4L0R A;  2YOE A;  4UXN B;  4LF9 T;  2M67 A;  4PJL A;  5LJM A;  3AEF A;  3MA9 A;  2VAS A;  3ANW B;  1LVK A;  5AQF B;  1U5P A;  4AI6 A;  1LRZ A;  4UV8 B;  4EB6 E;  2Y58 A;  2XJ7 A;  1ZEE A;  3KFW X;  5L3B B;  1XNR T;  4PW8 A;  3VKH A;  3WIP A;  4A5X A;  2C5J A;  3F2E A;  5J2T E;  1OWA A;  4TN7 B;  1KNR A;  1IAP A;  4WYV A;  2BR7 A;  4B3R T;  3D0T A;  1T8B A;  2UXD T;  1MIW A;  2DNX A;  3ZJ2 A;  1NAF A;  4UVB B;  4IDN A;  5AQR B;  2W0G A;  1UV6 A;  1Z0P A;  5LBM A;  2Y6X A;  4EYY R;  3DJB A;  3UU3 A;  4UIG A;  4DR4 T;  4JI1 T;  4EV6 A;  5AQU B;  4TZ4 C;  5BP0 A;  3MK7 C;  3ZJ1 A;  5A1L A;  2LKG A;  2YME A;  1X9B A;  1UW6 A;  5FP3 A;  4GKK T;  3AE7 A;  3ZYL A;  1ZKE A;  2D0U A;  1KNZ A;  5L4H A;  4D01 A;  3WTO A;  2JRK A;  3F31 A;  5CO5 A;  1M62 A;  4BJM A;  2MTQ A;  3PEO A;  5JR9 A;  2BZB A;  5LYJ E;  3CPZ A;  2E9X A;  4P09 A;  4AIS A;  3FZF B;  3AEA A;  5JDQ A;  2MYS A;  3P8C D;  5AQH B;  1I6Z A;  4OHF A;  3PUA A;  2XM1 A;  2W63 A;  1IBM T;  4YTN A;  3P4S A;  3IBP A;  2WB5 A;  2KWI B;  4ZI3 D;  2XSB A;  4LF5 T;  2WCA A;  4UM3 P;  2ACZ A;  2WNC A;  4AFG A;  4LFB T;  4LML A;  2BBH A;  2VK9 A;  2IML A;  2VKJ A;  3ZCJ A; 
#chains in the Genus database with same CATH homology
 3P50 A;  2WNJ A;  4QH4 A;  2BYS A;  2X00 D;  2XYS A;  3C79 A;  2PH9 A;  2WNL A;  4HFE A;  3WTJ A;  2XQ4 A;  3PMZ A;  5KE4 A;  4ZZB A;  2VL0 A;  2XNT A;  2BR7 A;  5HCJ A;  2KSR A;  2WZY A;  4HQP A;  5AFH A;  3IGQ A;  4ZJS A;  3WTK A;  3UU5 A;  4AFH A;  4X5T A;  3U8J A;  3U8L A;  2Y56 A;  4UM3 A;  4UY2 A;  1OED A;  3EI0 A;  3ZDH A;  3SQ9 A;  4UXU A;  2XZ6 A;  4LMK A;  4A97 A;  3RQU A;  3EHZ A;  4TNV A;  2C9T A;  2ZJU A;  3ZDG A;  1I9B A;  5FJV A;  3RI5 A;  4ZK1 A;  5BRX A;  5J5H A;  1UV6 A;  4ILB A;  4HFC A;  2BYP A;  3TLW A;  3UUB A;  3WTI A;  2XQ6 A;  4NPP A;  5J5G A;  2XQ7 A;  2BG9 C;  3TLT A;  3UQ7 A;  4FRR A;  3UU3 A;  2XNV A;  3UU6 A;  3SQ6 A;  5AFK A;  2XQ8 A;  2BG9 A;  2XZ5 A;  4QAA A;  3TLU A;  5AFM B;  3T4M A;  5BP0 A;  2XYT A;  5HEU A;  4EZ1 A;  3LSV A;  5HEH A;  3EAM A;  2LKG A;  4IL4 A;  3RIF A;  2XNU A;  2YME A;  3U8N A;  2UZ6 A;  3U8K A;  4ALX A;  1UW6 A;  2WN9 A;  2Y54 A;  2PGZ A;  2XQ3 A;  2YKS A;  3ZKR A;  5IUX A;  1UX2 A;  2BYR A;  5AFJ A;  3TLS A;  2BYQ A;  4QAB A;  2LLY A;  5CFB A;  3RHW A;  5L4E A;  3P4W A;  1OED B;  2W8G A;  5L4H A;  2Y7Y A;  2BYN A;  2XQ9 A;  3JAD A;  2Y57 A;  4XHE A;  3WTO A;  4D01 A;  3WTM A;  5J5F A;  3RIA A;  2XQA A;  4COF A;  5CO5 A;  2M6B A;  3JAE A;  4ZK4 A;  3UU4 A;  2XQ5 A;  4BQT A;  4ILC A;  2QC1 B;  3PEO A;  4HFB A;  4UM1 A;  4F8H A;  3SIO A;  4IRE A;  4XK9 A;  2YOE A;  3WTN A;  3JAF A;  4LMJ A;  3WTH A;  5HCM A;  4TWH A;  3SH1 A;  5LXB A;  3GUA A;  4TWF A;  5HEJ A;  4Z90 A;  5AFM A;  3RQW A;  5HEG A;  4WV9 A;  4PIR A;  4ILA A;  5LG3 A;  4ZJT A;  5BW2 A;  5SYO A;  4A98 A;  4DBM A;  5J0Z A;  5TVC A;  5AFN A;  2BJ0 A;  2YMD A;  5J5I A;  4HFH A;  4AFT A;  5AIN A;  2LM2 A;  3C84 A;  1OED E;  4IL9 A;  4QH5 A;  4HFD A;  4UM3 P;  4HFI A;  4QH1 A;  2WNC A;  4AFG A;  2YN6 A;  2M6I A;  4LML A;  4NZB A;  1OED C;  3U8M A;  2W8F A;  5AFL A;  2Y58 A;  4ZRU A;  3WTL A;  4TNW A;  5L47 A;  2BR8 A;  4UM3 S;  4BFQ A;  4ZZC A;  3TLV A;  3WIP A;  3UU8 A;  5JME A;  4Z91 A;  2LKH A;  2X00 A;  4QAC A;  2MAW A;  5KZU A;  2ZJV A;  4B5D A;  2BG9 B;  4ZR6 A;  2BG9 E;  3UQ4 A;  5HEO A;  4TWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...