5L4EA

X-ray structure of the 2-22' locally-closed mutant of glic in complex with thiopental
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
molecule tags Transport protein
source organism Gloeobacter
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
total genus 89
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l4eA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l4eA01
2Y54A 3P50A 2BG9A 4ZJTA 2QC1B 4ZRUA 5LG3A 4ZZBA 3WTHA 3EHZA 2VL0A 2XQ7A 5AFKA 5AFJA 5KE4A 3U8JA 4HFHA 4QAAA 5L4EA 3SIOA 3U8NA 4FRRA 2PH9A 3TLVA 5HCJA 2LKGA 3RQWA 2XQAA 3JAFA 4TWFA 2BR7A 4ILAA 1OEDE 5BRXA 2XQ9A 4TWHA 3IGQA 5KZUA 3TLTA 4ILBA 4IL4A 3ZDHA 3WTJA 3U8LA 3UU5A 4HFIA 5CFBA 5HEGA 3C84A 3PEOA 3ZKRA 2X00D 3RQUA 5SYOA 3TLSA 4ZZCA 3T4MA 2WNCA 5HEOA 4UY2A 5TVCA 5L4HA 4A98A 1UV6A 2BR8A 2Y57A 4HQPA 5AFMB 4TNWA 3C79A 2BYNA 5AINA 2YN6A 3UU4A 4HFCA 2C9TA 4ILCA 5J5FA 1UX2A 4IL9A 2YKSA 3JADA 4LMKA 1UW6A 4AFGA 3UU8A 3JAEA 3UQ7A 2XQ5A 2M6IA 4UM1A 3WTKA 4UM3P 4B5DA 2XQ3A 5J5GA 5LXBA 4QACA 2BYQA 3WTIA 4ALXA 5HEHA 3EAMA 4BQTA 2ZJVA 4ZJSA 3SQ9A 2MAWA 5L47A 4UM3S 3P4WA 4HFDA 2W8FA 2Y56A 5AFHA 5AFLA 3TLUA 5IUXA 2BG9C 2LM2A 2LLYA 4X5TA 4A97A 4LMLA 2YMEA 2KSRA 5HEJA 4XHEA 3WTMA 2XQ6A 4AFHA 4QH5A 2XYTA 4HFBA 5J5IA 3U8MA 3WTLA 3RI5A 2BG9B 2WNJA 4Z91A 4QABA 5CO5A 2XZ5A 4ZK4A 3UU3A 2BJ0A 2BYPA 4QH1A 2XNVA 3RIFA 2XNTA 1OEDC 2LKHA 2BG9E 4UXUA 2PGZA 2WNLA 1OEDB 4IREA 2Y7YA 2ZJUA 4LMJA 2YMDA 2UZ6A 4UM3A 5AFNA 2XNUA 2BYSA 4NZBA 4COFA 3UU6A 2X00A 4QH4A 3LSVA 2WZYA 4ZR6A 4WV9A 5FJVA 1I9BA 3WTNA 2M6BA 4PIRA 3SH1A 2YOEA 4D01A 5BP0A 2WN9A 2XZ6A 3UUBA 4Z90A 4ZK1A 5BW2A 2W8GA 3TLWA 2Y58A 3EI0A 5AFMA 4EZ1A 5HCMA 3RIAA 4BFQA 2XQ8A 3WIPA 2XYSA 1OEDA 4TNVA 4F8HA 5J0ZA 3PMZA 4XK9A 2XQ4A 3SQ6A 4AFTA 3UQ4A 5HEUA 4DBMA 3U8KA 3GUAA 3RHWA 4HFEA 5JMEA 4TWDA 5J5HA 3WTOA 3ZDGA 4NPPA 2BYRA
chains in the Genus database with same CATH superfamily
2WDVA 3P50A 2BG9A 4PFPA 2XQ7A 2E8IA 4KP3C 2C0SA 4U7YA 4OFZA 5H6RB 4HWIB 4QHOA 1N32T 3U8LA 2HHHT 5JDFA 5AFUL 4HTEA 4N78D 5FP3A 5LB7B 4GYRA 2UU9T 5JR9C 2Y6XA 2LSIA 2LRKA 2YKSA 3PUQA 2JPFA 2A3DA 2XPKA 3I9YA 2ZM6T 3WTIA 5JDQA 3ZMTB 1UGOA 3T1YT 4U7IA 4AQYT 4X1YE 2BZBA 3TLUA 4U2YA 3AA1B 4I43B 4QH5A 4P1NA 5LHIB 2D0UA 4IDPA 5HAXA 4J2CA 1SHZC 2YINA 4IREA 3AE9A 4JI4T 3LSVA 2FBWA 3ONJA 4ZR6A 5FJVA 3WTNA 4PIRA 2W0GA 3EVYA 2WCAA 2RPAA 2Y58A 1U5PA 3P7IA 2ZLYA 4HWCA 4ZXLA 4EZ4A 4NIQA 2A72A 3ESLA 4DV3T 4PJNA 2V6XA 5FXVA 1ZOYA 1V9DA 3NBXX 4UF0A 2WU2A 2AE9A 4IL4A 4FJOA 1M62A 4YFSA 2XM1A 4LF7T 1KEYA 3CQGB 2V7LA 4A98A 2WWVA 4ZHQE 3LBXA 2ZM8A 1N36T 1KNZA 4UVAB 4GK5E 5HXSA 1XMQT 2WS3A 2FJBA 4HWHA 4ANJA 3PDYA 2BYQA 3EAMA 5F8PA 4CN4A 5ETWA 1UCUA 2VVNA 1MNEA 5JRCA 5IUXA 4PK4A 5AQOB 2KZ7B 2P9BA 5CGMA 5EK4A 2XYTA 4HFBA 2K3WA 4JV5T 2XZ5A 4HE8A 3N9PA 2X9WA 1HF8A 1MNDA 2WZHA 2LKHA 5LMUT 4LF6T 3P4SA 1IBMT 2NR4A 3RGLA 4DV5T 4PW8A 3HKDE 5ABFB 3AVRA 2W63A 3LBXB 3GWHA 3RH3A 4PK5A 3ZJ1A 3SS1A 5FXZA 2M6BA 3SWHA 2X66A 2RA1A 4H63H 3R84B 2HN1A 5LGNB 2W4XA 2E5LT 3QB5A 3AA7B 4TNVA 3VR8A 1FIOA 1W0BA 3SQ6A 3OYZA 4CN6A 3CQCB 5JDMA 4HFEA 5J5HA 2BYRA 3P4QA 2YDSA 4UVCB 4EOZB 2PFVA 4KX6A 3AE2A 3ZN1B 3KVBA 2CE7A 2XTLA 4ILBA 3P8CD 2NW7A 3RKOA 1WYBA 2V6YA 4TUYE 3PJAA 2ES0A 4EAHA 5EK3A 4QKNA 1IAPA 4ILUA 3UT5E 2WB5A 4AISA 1XMOT 1FMVA 3UU8A 4TZ4C 4B5DA 5AQGB 4DR2T 4FI5A 2ZJVA 2QVAA 3PJAJ 4BAYB 5FYMA 3VKGA 1N33T 3SFDA 4O8SA 4DV0T 4ZK4A 3CPZA 3C51A 2DLRA 2WWUA 3AECA 1FMWA 4IDOA 3KDSE 3PV0F 3DTOA 5BP0A 2YOEA 2K48A 2J62A 1IBLT 3H3AA 3LG7A 3O9XA 5JVDE 3U8KA 3GUAA 4K0KT 2CWOA 3HKBE 4IDQA 4ZJTA 2X9XA 2PG8A 3WTHA 3EHZA 4EYYR 1XWMA 2ODUA 2OV9A 2Z6EA 5L2LA 3Q5DA 2V7MA 3RIUA 2D9DA 2IMLA 3FXDB 2XY8B 1BR1A 4CXWA 2VVSA 2BBJA 5ABEA 2L8KA 4HFCA 4HWDA 2BDEA 4UM1A 2W2UA 2I0MA 3LDQB 3ZSSA 5LMNT 4CI1B 1T98A 2LHNA 4DMVA 4U3CA 3Q9DA 2X67A 3Q5EA 1KFYA 3ZMSB 4YY3T 4IE0A 4AFHA 5C2TA 1YKEB 4PJJA 5H6QB 4TV8E 3U78A 2BJ0A 4YSXA 1E7PA 3DP7A 4YTPA 3E0ZA 5HXHA 4LMJA 4JI7T 5FKYA 3MJXA 2QRXA 4GIWA 4I4TE 4JI0T 4EIWA 2XZ6A 5KXJA 2C5JA 2EHOC 3RYHE 5M4YA 3RC3A 2CMRA 5IHYA 4DR3T 3PUAA 3PUSA 4XK9A 3UQ4A 1QUUA 1QLBA 3KINB 3AE7A 5FY7A 3Q2MA 4O4LE 4UF0B 3A7MA 2WDRA 2BKOA 3U8JA 3QK6A 4PNIA 3N9MA 3SIOA 3KV9A 2UXNB 2IC6A 1Z0PA 4TWHA 2VQFT 2BS4A 3PTRB 3AEAA 5FXXA 5J2TE 2LE8A 2X0YA 2YEVC 4IDZA 5L3CB 2CXDA 4HQPA 2Y57A 3RC8A 4TNWA 4U31A 5A1LA 3ZC0A 1AJ3A 3BQIA 5F3JA 3FHNA 4I55E 5LXBA 4AI6A 4YTMA 1Y01A 1NAFA 1UUSA 1T8BA 2XAGB 3SQ9A 5AQPB 3CX7B 1D0ZA 2BBHA 1MMGA 2KXPB 2EHOB 3JC6C 5JTGA 3I1AA 2CM0A 3O1HA 3HKCE 3ZEFB 4P0AA 4Z91A 4TX5A 3RIFA 4DR6T 4AXPA 3T1HT 2ZJUA 5LGUB 1I6ZA 3O1IA 5ABHA 3IBPA 4COFA 2X00A 1CUNA 2WZYA 3HR0A 3TLWA 3MA9A 3FBLA 3OKQA 4AKRB 2OA5A 5LGTB 4DIDB 4AFTA 1WYCA 3HL6A 4UV9B 5JMEA 3I0QA 4IT4A 2Y54A 5L3EB 4TN7B 1XNRT 3FBZA 1S35A 2LSJA 4TWFA 2XAHB 3B57A 1IBKT 5HEGA 3UFEA 2WNCA 3UUXB 5HEOA 2LEHA 5JREA 2LM9A 4YT0A 5KX5E 2BYNA 2LOSA 2C9TA 1UX4A 4DV2T 5J5FA 1LVKA 4A5XA 2VL8A 2K5BB 3AEFA 1G73A 3C4XA 1NWMX 5AQRB 3VKHA 1Y64B 2LLYA 5HEJA 3NRYA 1UK5A 4BJNA 4JI8T 1D1CA 4YHJA 2LSGA 3PUYF 4UXNB 2WNJA 3UU3A 4QH1A 2J47A 4PK6A 3H37A 2I6HA 4H9OC 2V5DA 2X0LB 1WCRA 3EDUA 2IHR1 3C4ZA 5AQTB 2BKPA 2CA5A 4WW0A 2R6GF 2N1GA 2LJLA 4HFVA 2V26A 1UURA 3ZN0B 2QYWA 4F6RC 3PU3A 4KI0F 1ZKEA 3A8YC 4DV4T 4O2AE 5HCMA 3UFGA 4ASKA 4DO0A 1LKXA 1XZYA 4NPPA 4IDNA 5FVLA 3FZMB 3GA8A 3VR9A 4YHHT 2DWKA 2CHOA 3C64A 2RP4A 3OVUA 4IE4A 3MACA 4ILAA 2WMNA 2E9XB 2XSBA 2YDQA 5J1GA 3PURA 2JJ9A 1L0VA 3RRWA 4JI1T 5LCYA 4GKKT 3OTOT 1M7KA 1O3XA 4AKLA 3RRCA 4NUUA 4TV9E 4UM3P 1ZEEA 3AE3A 1WRDA 3HKEE 4AQFC 3FZFB 3ZCJA 2WY2A 2IUBA 5L3BB 4EB6E 2G0UA 5AQSB 2XAQB 4DV7T 2XNVA 2DL1A 3KFWX 3ZT7A 3LK42 4U74A 3ZJ2A 3ZMVB 3K3NA 4JUYA 5AFNA 2OLTA 5HWXA 2CCQA 4JYAT 3MK7C 1HG2A 2CHNA 4D01A 4ZK1A 2WZIA 1KNRA 2I59A 2CLYB 5ABGA 5HYAA 2VK9A 4YJ3E 2VKHA 3O1JA 4EZ1A 2Q9QA 2VASA 1WLXA 1OEDA 4F8HA 2YK0A 2CEAA 1MMNA 1HCIA 3WI3A 5AQKB 2XZEA 3MKDA 2CBIA 4PFOA 5FL1A 4ZEYA 1ZP0A 2QC1B 2ACXA 3OBVE 3G06A 3AAEB 4JI2T 4CZZB 3FZKB 4C90A 5HCJA 2NTYA 4E7SA 2LKGA 5DQWA 1OEDE 4IE6A 2ACZA 2MTQA 4M1PA 3ZDHA 2FUPA 3C84A 3V5UA 3CX6B 3RQUA 4CN1A 1SA0E 3C98B 5TVCA 3ETVA 4KHZF 4V1Av 4AKHA 3DJBA 2UXBT 1E1HB 4ILCA 2JQ9A 3JAEA 2IW5B 4DUYT 5LG4A 1SE7A 4ALXA 2W66A 4AQGA 2XHEB 3MXZA 4CQIA 3EDVA 2VB6A 3ZT6A 4XHEA 1ZHCA 3ZLIA 5JQGE 2KLQA 4X1IE 2WQYA 2WNLA 1Z8UA 2FJDA 1I94T 3KV4A 4UM3A 4ZI2C 4NXMT 2BYSA 3RX6A 3F31A 4H63V 4I50E 2D0TA 4WV9A 4ISTA 3I0OA 3UUBA 2W8GA 2H7OA 5LP6E 2WDQA 3FZHB 3O4XE 3U3IA 3OYXA 4A56A 3IF8B 3RF1A 2WM9A 3WTOA 1S94A 1OEDB 4H9RC 4IGUA 4NUVA 5CJ5A 3RYCE 4ZRUA 1HTJF 4PJLA 2IAKA 3CMLA 3IEEA 5LA6E 2BS2A 4K0UA 2BR7A 3JAFA 5BRXA 5HXRA 3RPUA 4XZCA 5LHGB 2WAUA 3LK3B 4HFIA 4UVBB 5CFBA 4UELA 4LFBT 3ZKRA 3TLSA 4P0BA 3ZYLA 5JR9B 3T8OA 4G63A 3FXEB 1OXZA 3Q5WA 1W0AA 2W61A 4L9IA 4JEHB 2UUBT 3AE5A 5EZYE 3KV6A 2MAWA 2XM2A 3AA6B 2LOPA 4IHJE 4H9SE 3HI2A 5DABA 3UUNA 1HNXT 5FL0A 1BR0A 4EXTA 2VKDA 1JNZA 1D0XA 1QSDA 1OEDC 1X79A 4H9QC 3CWZB 2C5IT 2XJ7A 2L9QA 3B13A 5AQNB 2VURA 2K24A 1J5ET 2NW9A 4U33A 3UU6A 3CK6A 4HN9A 4HKAA 3KV5A 1X9BA 5DJQC 1HNZT 3EABA 3IHRA 2A2FX 5BR8T 4KUMB 3E08A 3L39A 3RYFE 2W00A 2MYSA 3AAIA 5AQQB 2W67A 5E0OA 4TWDA 3RLFF 5AQVB 3CX8B 2FJAA 4ZI3D 4AKGA 3TKLB 5JRCB 2XQAA 1NENA 2V6YB 3IGQA 1KK7A 4YSZA 3TLTA 3E22E 3ANWB 2IIUA 3N9QA 5CA1E 2ODVA 3AEDA 3PUGA 1BR4A 4ZZCA 4EZHA 4L0RA 2XAFB 2N9DA 4X64T 4XAXB 2DCFA 3C79A 4IL9A 4LMKA 2WP9A 4NXNT 3WTKA 1ZV4X 4YSYA 2WMOA 3GN5A 1VCTA 2DHRA 5L47A 4UM3S 2JQHA 1HS7A 4WBNE 3PUZF 2V7JA 2LSKA 2MPKA 2W62A 3RI5A 3ABVA 4WNKA 2V7KA 2Y7YA 2XNUA 1HG5A 2JRKA 1FJGT 4OYJA 3QB5K 3ZCIA 3S4UA 4ZI3C 4DBQA 1J1JA 3WIPA 2D5UA 3SFEA 4YJ2E 4IE5A 4U2ZA 1D1BA 3AEBA 3UTKA 4C91A 2H88A 5LG3A 3P4PA 1U4QA 5EK2A 3AXJA 3U8NA 3TLVA 4DR5T 4HGAA 4GYSA 3RQWA 2LRLA 3RYIE 2XQ9A 2C5KT 3CQXC 3AA0B 3N2KE 3ZMZB 3F2EA 3LJCA 4ZOLE 5CB4E 1B7TA 1N34T 4UV8B 2BS3A 4L5GA 2BR8A 1WFDA 4DR7T 3J7Yq 2BVLA 3JADA 4MBQA 3J9X1 3L3PA 4ZI2D 3AEEA 5HWYA 2N2NA 3AEGA 1D1AA 5AQIB 2V1DB 4HFDA 3WAJA 2YMEA 5IWAT 5LOVE 3ZT5A 3JC6D 2KWHA 4QABA 2XNTA 2D2SA 2L3LA 3P4RA 1EZ3A 3AE4A 5AQUB 4H9NC 4YXDA 4LF8T 2YU2A 4JLEA 4EV6A 2WN9A 4LF4T 2H89A 1MIWA 1LVFA 2Y8DA 1E2AA 3EI0A 3OJAA 1OWAA 3QUJA 2VQET 4JBWF 5L3DB 3ZDGA 4G2AA 4ZZBA 2VL0A 5KE4A 5HXEA 4MHCA 4OX9T 1LRZA 4ZS2A 3ZYKA 2VKJA 5LJMA 3KBTA 2WU5A 4EGWA 5KZUA 2UUAT 4EEBA 1DU2A 4DUZT 4O4IE 2H7VC 2UXDT 3ETUA 2BVMA 3T4MA 4O4HE 4UY2A 2E9XA 3AE8A 5FVKA 2A9UA 5LHHB 4AIUA 4AFGA 1WR0A 4QACA 3JCFA 4E7ZA 1R8IA 4HWFA 3K8PC 4EEDA 3NZQA 5AFHA 3A5XA 4P09A 4X5TA 4LMLA 4WYVA 1MIVA 1IJ6A 4LF5T 5J5IA 2KWIB 1VCSA 3NZPA 3ZYMA 3L8RA 2IDOB 4QWNB 5FMNA 2E9XC 5BMVE 1W9RA 3V5SA 4KBMB 4H9PC 2CRBA 3MZKB 1HNWT 1HX1B 1GQEA 2CLYC 3SH1A 5AQFB 5FY0A 2DNXA 4JI5T 3VRBA 1T72A 1T7SA 2XUEA 2XQ8A 2NOXA 5FXWA 1IJ5A 2NTXA 3K3QC 2XQ4A 3QC9A 4DV1T 2VWAA 2NWBA 3SOLA 4PJMA 4QX8B 5AQMB 4OK0A 1JNRA 4DR1T 1J5WA 5HXCA 3PE0A 2IC9A 4MLKA 4B3TT 3WTJA 3M3ZB 1US7B 1KNPA 3N9LA 3PEOA 2UUCT 2CBJA 3N2OA 2B1EA 5L4HA 1UV6A 1XDPA 3VHLA 2PJQA 4DMWA 3F57A 3NRXA 5CA0E 3GN5B 1UW6A 5L3GB 3GMIA 3LFMA 4MALA 2ZM2A 4DNDA 1YQ4A 5HEHA 1IZNB 3NVOA 3I9WA 5JDLA 2WBLA 3QOFA 5AFLA 1HR0T 2LM2A 4A97A 3D0TA 2KSRA 1YQ3A 3RIUC 2SPCA 5IYZE 5JDGA 4X62T 3QNUA 3N9OA 3AE1A 4X66T 2JQKA 1YXRA 5LJNA 4EYUA 4NZBA 1FEWA 4QH4A 4B3ST 5LBMA 4BA9A 2BKNA 1KF6A 3AB3B 3KBUA 5BW2A 2CWYA 4HEAA 4QXCB 5KMGP 2MOZA 5AQLB 3NWIA 2J4GA 3FZLB 5GONE 4ZI7E 2YDRA 5J0ZA 2JQQA 2EHOA 2J1DG 5F5WA 4UEMA 5JDHA 5AFKA 3UUMA 4HFHA 4QAAA 3ZPOA 3FB2A 4WZXA 4FRRA 2PH9A 2JMKA 4ERRA 2K9AA 2QA7A 5C8YE 4X65T 2X51A 1SUMB 1G8XA 1NEKA 3PUVF 3WAKA 2X00D 2LT3A 5SYOA 4LF9T 3N2GE 1YD8G 4CI3B 3ONLC 2XAJB 5AQJB 1HFAA 2YN6A 2AXDS 1UX2A 2HPLA 3C4WA 3AVSA 2XQ5A 5J5GA 2E5VA 4B3MT 4BQTA 1XNQT 2X9HA 5KDMC 3P4WA 2Y56A 4O2BE 5L3FB 3WTMA 2XQ6A 3NKZA 2DI4A 2V7IA 2Q9QD 4Q25A 4X20E 2XSAA 2H3RA 4UXUA 2PTFA 3CIRA 2X68A 2UZ6A 4GOUA 5TAOA 2KT9A 4OYKA 2CXLA 2KINB 3X1DA 1I9BA 2F4VT 3VU7H 1MMDA 4CXYA 5LYJE 4GKJT 3LK2B 4ISSA 4DV6T 2VKOA 2JIWA 5JDNA 3PMZA 3K1SA 4CXXA 5HEUA 3PUWF 4DVDA 4IE7A 4U72A 5JH7E 4JEUB 1D0YA 3IA3A 1CHUA 3AAAB 5FY1A 3UU5A 4PAGA 4X1KE 2NP9A 1H7CA 3UULA 2XASB 3BQLA 5AINA 3ZC1A 2Y48B 2KMFA 3ZMUB 3PUXF 1HX8A 2B76A 4YLHA 2NW8A 2W8FA 5J2UE 3U8MA 3WTLA 5C3JA 3M65A 3EUHA 2BG9E 2HN2A 2PGZA 2M67A 4AKIA 3SRZA 3BK9A 3CVRA 2X0HA 4KHPT 3HA4A 1WR6A 4GK0E 2V5CA 2WSSV 3VRAA 3PU8A 4DR4T 4B3RT 1UX5A 4CI2B 4DBRA 5AFMA 5ABFA 2LHRA 5ADXL 2ZMAA 4BFQA 1XDOA 2HPJA 5AQHB 2XYSA 2CXFA 4LFCT 3N5LA 3H3MA 2ZM0A 3RHWA 5DQVA 3C50A 4JI6T 2EHOD 4B6XA 1VOMA 5AFJA 2XQYA 5L4EA 4WBOA 3BQKA 1MMAA 2QGSA 2UXXB 1VRBA 3OPCA 4IIJE 3ZSTA 2E9XD 3ONXA 5LNKA 3B5MA 3K3OA 3AXJB 5JR9A 4BJMA 4XBFB 1YKHB 4AQFA 5AFMB 2LSYA 4ADZA 3CKDA 3UU4A 4QXHB 2E2AA 2CPTA 2KNDA 4OHFA 3RKGA 4JI3T 3UQ7A 2M6IA 2XQ3A 4UR9A 3R6NA 4UIGA 4ZJSA 2DWGA 2HH7A 3W15B 3Q5XA 3AE6A 1YW0A 2BG9C 5LBQB 2V8SV 4MFRA 4I0UA 2X9YA 2BG9B 5CO5A 4KMCA 2GK9A 2BYPA 4QXBB 3N9NA 1W09A 2YMDA 4LFAT 3KVAA 2PBIA 2MBGA 4YTNA 2UXCT 3ANWA 4Z90A 3L09A 5FNVE 4O4JE 2JMHA 1MIYA 2FJEA 1BR2A 3RIAA 2YU1A 2Q9QC 4QX7B 4DBMA 2Q9QB 4Z8XA 4ZS3A 5LXTE
chains in the Genus database with same CATH topology
2Y54A 3P50A 2BG9A 4ZJTA 2QC1B 4ZRUA 5LG3A 4ZZBA 3WTHA 3EHZA 2VL0A 2XQ7A 5AFKA 5AFJA 5KE4A 3U8JA 4HFHA 4QAAA 5L4EA 3SIOA 3U8NA 4FRRA 2PH9A 3TLVA 5HCJA 2LKGA 3RQWA 2XQAA 3JAFA 4TWFA 2BR7A 4ILAA 1OEDE 5BRXA 2XQ9A 4TWHA 3IGQA 5KZUA 3TLTA 4ILBA 4IL4A 3ZDHA 3WTJA 3U8LA 3UU5A 4HFIA 5CFBA 5HEGA 3C84A 3PEOA 3ZKRA 2X00D 3RQUA 5SYOA 3TLSA 4ZZCA 3T4MA 2WNCA 5HEOA 4UY2A 5TVCA 5L4HA 4A98A 1UV6A 2BR8A 2Y57A 4HQPA 5AFMB 4TNWA 3C79A 2BYNA 5AINA 2YN6A 3UU4A 4HFCA 2C9TA 4ILCA 5J5FA 1UX2A 4IL9A 2YKSA 3JADA 4LMKA 1UW6A 4AFGA 3UU8A 3JAEA 3UQ7A 2XQ5A 2M6IA 4UM1A 3WTKA 4UM3P 4B5DA 2XQ3A 5J5GA 5LXBA 4QACA 2BYQA 3WTIA 4ALXA 5HEHA 3EAMA 4BQTA 2ZJVA 4ZJSA 3SQ9A 2MAWA 5L47A 4UM3S 3P4WA 4HFDA 2W8FA 2Y56A 5AFHA 5AFLA 3TLUA 5IUXA 2BG9C 2LM2A 2LLYA 4X5TA 4A97A 4LMLA 2YMEA 2KSRA 5HEJA 4XHEA 3WTMA 2XQ6A 4AFHA 4QH5A 2XYTA 4HFBA 5J5IA 3U8MA 3WTLA 3RI5A 2BG9B 2WNJA 4Z91A 4QABA 5CO5A 2XZ5A 4ZK4A 3UU3A 2BJ0A 2BYPA 4QH1A 2XNVA 3RIFA 2XNTA 1OEDC 2LKHA 2BG9E 4UXUA 2PGZA 2WNLA 1OEDB 4IREA 2Y7YA 2ZJUA 4LMJA 2YMDA 2UZ6A 4UM3A 5AFNA 2XNUA 2BYSA 4NZBA 4COFA 3UU6A 2X00A 4QH4A 3LSVA 2WZYA 4ZR6A 4WV9A 5FJVA 1I9BA 3WTNA 2M6BA 4PIRA 3SH1A 2YOEA 4D01A 5BP0A 2WN9A 2XZ6A 3UUBA 4Z90A 4ZK1A 5BW2A 2W8GA 3TLWA 2Y58A 3EI0A 5AFMA 4EZ1A 5HCMA 3RIAA 4BFQA 2XQ8A 3WIPA 2XYSA 1OEDA 4TNVA 4F8HA 5J0ZA 3PMZA 4XK9A 2XQ4A 3SQ6A 4AFTA 3UQ4A 5HEUA 4DBMA 3U8KA 3GUAA 3RHWA 4HFEA 5JMEA 4TWDA 5J5HA 3WTOA 3ZDGA 4NPPA 2BYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y54 A;  3P50 A;  2BG9 A;  4ZJT A;  2QC1 B;  4ZRU A;  5LG3 A;  4ZZB A;  3WTH A;  3EHZ A;  2VL0 A;  2XQ7 A;  5AFK A;  5AFJ A;  5KE4 A;  3U8J A;  4HFH A;  4QAA A;  5L4E A;  3SIO A;  3U8N A;  4FRR A;  2PH9 A;  3TLV A;  5HCJ A;  2LKG A;  3RQW A;  2XQA A;  3JAF A;  4TWF A;  2BR7 A;  4ILA A;  1OED E;  5BRX A;  2XQ9 A;  4TWH A;  3IGQ A;  5KZU A;  3TLT A;  4ILB A;  4IL4 A;  3ZDH A;  3WTJ A;  3U8L A;  3UU5 A;  4HFI A;  5CFB A;  5HEG A;  3C84 A;  3PEO A;  3ZKR A;  2X00 D;  3RQU A;  5SYO A;  3TLS A;  4ZZC A;  3T4M A;  2WNC A;  5HEO A;  4UY2 A;  5TVC A;  5L4H A;  4A98 A;  1UV6 A;  2BR8 A;  2Y57 A;  4HQP A;  5AFM B;  4TNW A;  3C79 A;  2BYN A;  5AIN A;  2YN6 A;  3UU4 A;  4HFC A;  2C9T A;  4ILC A;  5J5F A;  1UX2 A;  4IL9 A;  2YKS A;  3JAD A;  4LMK A;  1UW6 A;  4AFG A;  3UU8 A;  3JAE A;  3UQ7 A;  2XQ5 A;  2M6I A;  4UM1 A;  3WTK A;  4UM3 P;  4B5D A;  2XQ3 A;  5J5G A;  5LXB A;  4QAC A;  2BYQ A;  3WTI A;  4ALX A;  5HEH A;  3EAM A;  4BQT A;  2ZJV A;  4ZJS A;  3SQ9 A;  2MAW A;  5L47 A;  4UM3 S;  3P4W A;  4HFD A;  2W8F A;  2Y56 A;  5AFH A;  5AFL A;  3TLU A;  5IUX A;  2BG9 C;  2LM2 A;  2LLY A;  4X5T A;  4A97 A;  4LML A;  2YME A;  2KSR A;  5HEJ A;  4XHE A;  3WTM A;  2XQ6 A;  4AFH A;  4QH5 A;  2XYT A;  4HFB A;  5J5I A;  3U8M A;  3WTL A;  3RI5 A;  2BG9 B;  2WNJ A;  4Z91 A;  4QAB A;  5CO5 A;  2XZ5 A;  4ZK4 A;  3UU3 A;  2BJ0 A;  2BYP A;  4QH1 A;  2XNV A;  3RIF A;  2XNT A;  1OED C;  2LKH A;  2BG9 E;  4UXU A;  2PGZ A;  2WNL A;  1OED B;  4IRE A;  2Y7Y A;  2ZJU A;  4LMJ A;  2YMD A;  2UZ6 A;  4UM3 A;  5AFN A;  2XNU A;  2BYS A;  4NZB A;  4COF A;  3UU6 A;  2X00 A;  4QH4 A;  3LSV A;  2WZY A;  4ZR6 A;  4WV9 A;  5FJV A;  1I9B A;  3WTN A;  2M6B A;  4PIR A;  3SH1 A;  2YOE A;  4D01 A;  5BP0 A;  2WN9 A;  2XZ6 A;  3UUB A;  4Z90 A;  4ZK1 A;  5BW2 A;  2W8G A;  3TLW A;  2Y58 A;  3EI0 A;  5AFM A;  4EZ1 A;  5HCM A;  3RIA A;  4BFQ A;  2XQ8 A;  3WIP A;  2XYS A;  1OED A;  4TNV A;  4F8H A;  5J0Z A;  3PMZ A;  4XK9 A;  2XQ4 A;  3SQ6 A;  4AFT A;  3UQ4 A;  5HEU A;  4DBM A;  3U8K A;  3GUA A;  3RHW A;  4HFE A;  5JME A;  4TWD A;  5J5H A;  3WTO A;  3ZDG A;  4NPP A;  2BYR A; 
#chains in the Genus database with same CATH topology
 2WDV A;  3P50 A;  2BG9 A;  4PFP A;  2XQ7 A;  2E8I A;  4KP3 C;  2C0S A;  4U7Y A;  4OFZ A;  5H6R B;  4HWI B;  4QHO A;  1N32 T;  3U8L A;  2HHH T;  5JDF A;  5AFU L;  4HTE A;  4N78 D;  5FP3 A;  5LB7 B;  4GYR A;  2UU9 T;  5JR9 C;  2Y6X A;  2LSI A;  2LRK A;  2YKS A;  3PUQ A;  2JPF A;  2A3D A;  2XPK A;  3I9Y A;  2ZM6 T;  3WTI A;  5JDQ A;  3ZMT B;  1UGO A;  3T1Y T;  4U7I A;  4AQY T;  4X1Y E;  2BZB A;  3TLU A;  4U2Y A;  3AA1 B;  4I43 B;  4QH5 A;  4P1N A;  5LHI B;  2D0U A;  4IDP A;  5HAX A;  4J2C A;  1SHZ C;  2YIN A;  4IRE A;  3AE9 A;  4JI4 T;  3LSV A;  2FBW A;  3ONJ A;  4ZR6 A;  5FJV A;  3WTN A;  4PIR A;  2W0G A;  3EVY A;  2WCA A;  2RPA A;  2Y58 A;  1U5P A;  3P7I A;  2ZLY A;  4HWC A;  4ZXL A;  4EZ4 A;  4NIQ A;  2A72 A;  3ESL A;  4DV3 T;  4PJN A;  2V6X A;  5FXV A;  1ZOY A;  1V9D A;  3NBX X;  4UF0 A;  2WU2 A;  2AE9 A;  4IL4 A;  4FJO A;  1M62 A;  4YFS A;  2XM1 A;  4LF7 T;  1KEY A;  3CQG B;  2V7L A;  4A98 A;  2WWV A;  4ZHQ E;  3LBX A;  2ZM8 A;  1N36 T;  1KNZ A;  4UVA B;  4GK5 E;  5HXS A;  1XMQ T;  2WS3 A;  2FJB A;  4HWH A;  4ANJ A;  3PDY A;  2BYQ A;  3EAM A;  5F8P A;  4CN4 A;  5ETW A;  1UCU A;  2VVN A;  1MNE A;  5JRC A;  5IUX A;  4PK4 A;  5AQO B;  2KZ7 B;  2P9B A;  5CGM A;  5EK4 A;  2XYT A;  4HFB A;  2K3W A;  4JV5 T;  2XZ5 A;  4HE8 A;  3N9P A;  2X9W A;  1HF8 A;  1MND A;  2WZH A;  2LKH A;  5LMU T;  4LF6 T;  3P4S A;  1IBM T;  2NR4 A;  3RGL A;  4DV5 T;  4PW8 A;  3HKD E;  5ABF B;  3AVR A;  2W63 A;  3LBX B;  3GWH A;  3RH3 A;  4PK5 A;  3ZJ1 A;  3SS1 A;  5FXZ A;  2M6B A;  3SWH A;  2X66 A;  2RA1 A;  4H63 H;  3R84 B;  2HN1 A;  5LGN B;  2W4X A;  2E5L T;  3QB5 A;  3AA7 B;  4TNV A;  3VR8 A;  1FIO A;  1W0B A;  3SQ6 A;  3OYZ A;  4CN6 A;  3CQC B;  5JDM A;  4HFE A;  5J5H A;  2BYR A;  3P4Q A;  2YDS A;  4UVC B;  4EOZ B;  2PFV A;  4KX6 A;  3AE2 A;  3ZN1 B;  3KVB A;  2CE7 A;  2XTL A;  4ILB A;  3P8C D;  2NW7 A;  3RKO A;  1WYB A;  2V6Y A;  4TUY E;  3PJA A;  2ES0 A;  4EAH A;  5EK3 A;  4QKN A;  1IAP A;  4ILU A;  3UT5 E;  2WB5 A;  4AIS A;  1XMO T;  1FMV A;  3UU8 A;  4TZ4 C;  4B5D A;  5AQG B;  4DR2 T;  4FI5 A;  2ZJV A;  2QVA A;  3PJA J;  4BAY B;  5FYM A;  3VKG A;  1N33 T;  3SFD A;  4O8S A;  4DV0 T;  4ZK4 A;  3CPZ A;  3C51 A;  2DLR A;  2WWU A;  3AEC A;  1FMW A;  4IDO A;  3KDS E;  3PV0 F;  3DTO A;  5BP0 A;  2YOE A;  2K48 A;  2J62 A;  1IBL T;  3H3A A;  3LG7 A;  3O9X A;  5JVD E;  3U8K A;  3GUA A;  4K0K T;  2CWO A;  3HKB E;  4IDQ A;  4ZJT A;  2X9X A;  2PG8 A;  3WTH A;  3EHZ A;  4EYY R;  1XWM A;  2ODU A;  2OV9 A;  2Z6E A;  5L2L A;  3Q5D A;  2V7M A;  3RIU A;  2D9D A;  2IML A;  3FXD B;  2XY8 B;  1BR1 A;  4CXW A;  2VVS A;  2BBJ A;  5ABE A;  2L8K A;  4HFC A;  4HWD A;  2BDE A;  4UM1 A;  2W2U A;  2I0M A;  3LDQ B;  3ZSS A;  5LMN T;  4CI1 B;  1T98 A;  2LHN A;  4DMV A;  4U3C A;  3Q9D A;  2X67 A;  3Q5E A;  1KFY A;  3ZMS B;  4YY3 T;  4IE0 A;  4AFH A;  5C2T A;  1YKE B;  4PJJ A;  5H6Q B;  4TV8 E;  3U78 A;  2BJ0 A;  4YSX A;  1E7P A;  3DP7 A;  4YTP A;  3E0Z A;  5HXH A;  4LMJ A;  4JI7 T;  5FKY A;  3MJX A;  2QRX A;  4GIW A;  4I4T E;  4JI0 T;  4EIW A;  2XZ6 A;  5KXJ A;  2C5J A;  2EHO C;  3RYH E;  5M4Y A;  3RC3 A;  2CMR A;  5IHY A;  4DR3 T;  3PUA A;  3PUS A;  4XK9 A;  3UQ4 A;  1QUU A;  1QLB A;  3KIN B;  3AE7 A;  5FY7 A;  3Q2M A;  4O4L E;  4UF0 B;  3A7M A;  2WDR A;  2BKO A;  3U8J A;  3QK6 A;  4PNI A;  3N9M A;  3SIO A;  3KV9 A;  2UXN B;  2IC6 A;  1Z0P A;  4TWH A;  2VQF T;  2BS4 A;  3PTR B;  3AEA A;  5FXX A;  5J2T E;  2LE8 A;  2X0Y A;  2YEV C;  4IDZ A;  5L3C B;  2CXD A;  4HQP A;  2Y57 A;  3RC8 A;  4TNW A;  4U31 A;  5A1L A;  3ZC0 A;  1AJ3 A;  3BQI A;  5F3J A;  3FHN A;  4I55 E;  5LXB A;  4AI6 A;  4YTM A;  1Y01 A;  1NAF A;  1UUS A;  1T8B A;  2XAG B;  3SQ9 A;  5AQP B;  3CX7 B;  1D0Z A;  2BBH A;  1MMG A;  2KXP B;  2EHO B;  3JC6 C;  5JTG A;  3I1A A;  2CM0 A;  3O1H A;  3HKC E;  3ZEF B;  4P0A A;  4Z91 A;  4TX5 A;  3RIF A;  4DR6 T;  4AXP A;  3T1H T;  2ZJU A;  5LGU B;  1I6Z A;  3O1I A;  5ABH A;  3IBP A;  4COF A;  2X00 A;  1CUN A;  2WZY A;  3HR0 A;  3TLW A;  3MA9 A;  3FBL A;  3OKQ A;  4AKR B;  2OA5 A;  5LGT B;  4DID B;  4AFT A;  1WYC A;  3HL6 A;  4UV9 B;  5JME A;  3I0Q A;  4IT4 A;  2Y54 A;  5L3E B;  4TN7 B;  1XNR T;  3FBZ A;  1S35 A;  2LSJ A;  4TWF A;  2XAH B;  3B57 A;  1IBK T;  5HEG A;  3UFE A;  2WNC A;  3UUX B;  5HEO A;  2LEH A;  5JRE A;  2LM9 A;  4YT0 A;  5KX5 E;  2BYN A;  2LOS A;  2C9T A;  1UX4 A;  4DV2 T;  5J5F A;  1LVK A;  4A5X A;  2VL8 A;  2K5B B;  3AEF A;  1G73 A;  3C4X A;  1NWM X;  5AQR B;  3VKH A;  1Y64 B;  2LLY A;  5HEJ A;  3NRY A;  1UK5 A;  4BJN A;  4JI8 T;  1D1C A;  4YHJ A;  2LSG A;  3PUY F;  4UXN B;  2WNJ A;  3UU3 A;  4QH1 A;  2J47 A;  4PK6 A;  3H37 A;  2I6H A;  4H9O C;  2V5D A;  2X0L B;  1WCR A;  3EDU A;  2IHR 1;  3C4Z A;  5AQT B;  2BKP A;  2CA5 A;  4WW0 A;  2R6G F;  2N1G A;  2LJL A;  4HFV A;  2V26 A;  1UUR A;  3ZN0 B;  2QYW A;  4F6R C;  3PU3 A;  4KI0 F;  1ZKE A;  3A8Y C;  4DV4 T;  4O2A E;  5HCM A;  3UFG A;  4ASK A;  4DO0 A;  1LKX A;  1XZY A;  4NPP A;  4IDN A;  5FVL A;  3FZM B;  3GA8 A;  3VR9 A;  4YHH T;  2DWK A;  2CHO A;  3C64 A;  2RP4 A;  3OVU A;  4IE4 A;  3MAC A;  4ILA A;  2WMN A;  2E9X B;  2XSB A;  2YDQ A;  5J1G A;  3PUR A;  2JJ9 A;  1L0V A;  3RRW A;  4JI1 T;  5LCY A;  4GKK T;  3OTO T;  1M7K A;  1O3X A;  4AKL A;  3RRC A;  4NUU A;  4TV9 E;  4UM3 P;  1ZEE A;  3AE3 A;  1WRD A;  3HKE E;  4AQF C;  3FZF B;  3ZCJ A;  2WY2 A;  2IUB A;  5L3B B;  4EB6 E;  2G0U A;  5AQS B;  2XAQ B;  4DV7 T;  2XNV A;  2DL1 A;  3KFW X;  3ZT7 A;  3LK4 2;  4U74 A;  3ZJ2 A;  3ZMV B;  3K3N A;  4JUY A;  5AFN A;  2OLT A;  5HWX A;  2CCQ A;  4JYA T;  3MK7 C;  1HG2 A;  2CHN A;  4D01 A;  4ZK1 A;  2WZI A;  1KNR A;  2I59 A;  2CLY B;  5ABG A;  5HYA A;  2VK9 A;  4YJ3 E;  2VKH A;  3O1J A;  4EZ1 A;  2Q9Q A;  2VAS A;  1WLX A;  1OED A;  4F8H A;  2YK0 A;  2CEA A;  1MMN A;  1HCI A;  3WI3 A;  5AQK B;  2XZE A;  3MKD A;  2CBI A;  4PFO A;  5FL1 A;  4ZEY A;  1ZP0 A;  2QC1 B;  2ACX A;  3OBV E;  3G06 A;  3AAE B;  4JI2 T;  4CZZ B;  3FZK B;  4C90 A;  5HCJ A;  2NTY A;  4E7S A;  2LKG A;  5DQW A;  1OED E;  4IE6 A;  2ACZ A;  2MTQ A;  4M1P A;  3ZDH A;  2FUP A;  3C84 A;  3V5U A;  3CX6 B;  3RQU A;  4CN1 A;  1SA0 E;  3C98 B;  5TVC A;  3ETV A;  4KHZ F;  4V1A v;  4AKH A;  3DJB A;  2UXB T;  1E1H B;  4ILC A;  2JQ9 A;  3JAE A;  2IW5 B;  4DUY T;  5LG4 A;  1SE7 A;  4ALX A;  2W66 A;  4AQG A;  2XHE B;  3MXZ A;  4CQI A;  3EDV A;  2VB6 A;  3ZT6 A;  4XHE A;  1ZHC A;  3ZLI A;  5JQG E;  2KLQ A;  4X1I E;  2WQY A;  2WNL A;  1Z8U A;  2FJD A;  1I94 T;  3KV4 A;  4UM3 A;  4ZI2 C;  4NXM T;  2BYS A;  3RX6 A;  3F31 A;  4H63 V;  4I50 E;  2D0T A;  4WV9 A;  4IST A;  3I0O A;  3UUB A;  2W8G A;  2H7O A;  5LP6 E;  2WDQ A;  3FZH B;  3O4X E;  3U3I A;  3OYX A;  4A56 A;  3IF8 B;  3RF1 A;  2WM9 A;  3WTO A;  1S94 A;  1OED B;  4H9R C;  4IGU A;  4NUV A;  5CJ5 A;  3RYC E;  4ZRU A;  1HTJ F;  4PJL A;  2IAK A;  3CML A;  3IEE A;  5LA6 E;  2BS2 A;  4K0U A;  2BR7 A;  3JAF A;  5BRX A;  5HXR A;  3RPU A;  4XZC A;  5LHG B;  2WAU A;  3LK3 B;  4HFI A;  4UVB B;  5CFB A;  4UEL A;  4LFB T;  3ZKR A;  3TLS A;  4P0B A;  3ZYL A;  5JR9 B;  3T8O A;  4G63 A;  3FXE B;  1OXZ A;  3Q5W A;  1W0A A;  2W61 A;  4L9I A;  4JEH B;  2UUB T;  3AE5 A;  5EZY E;  3KV6 A;  2MAW A;  2XM2 A;  3AA6 B;  2LOP A;  4IHJ E;  4H9S E;  3HI2 A;  5DAB A;  3UUN A;  1HNX T;  5FL0 A;  1BR0 A;  4EXT A;  2VKD A;  1JNZ A;  1D0X A;  1QSD A;  1OED C;  1X79 A;  4H9Q C;  3CWZ B;  2C5I T;  2XJ7 A;  2L9Q A;  3B13 A;  5AQN B;  2VUR A;  2K24 A;  1J5E T;  2NW9 A;  4U33 A;  3UU6 A;  3CK6 A;  4HN9 A;  4HKA A;  3KV5 A;  1X9B A;  5DJQ C;  1HNZ T;  3EAB A;  3IHR A;  2A2F X;  5BR8 T;  4KUM B;  3E08 A;  3L39 A;  3RYF E;  2W00 A;  2MYS A;  3AAI A;  5AQQ B;  2W67 A;  5E0O A;  4TWD A;  3RLF F;  5AQV B;  3CX8 B;  2FJA A;  4ZI3 D;  4AKG A;  3TKL B;  5JRC B;  2XQA A;  1NEN A;  2V6Y B;  3IGQ A;  1KK7 A;  4YSZ A;  3TLT A;  3E22 E;  3ANW B;  2IIU A;  3N9Q A;  5CA1 E;  2ODV A;  3AED A;  3PUG A;  1BR4 A;  4ZZC A;  4EZH A;  4L0R A;  2XAF B;  2N9D A;  4X64 T;  4XAX B;  2DCF A;  3C79 A;  4IL9 A;  4LMK A;  2WP9 A;  4NXN T;  3WTK A;  1ZV4 X;  4YSY A;  2WMO A;  3GN5 A;  1VCT A;  2DHR A;  5L47 A;  4UM3 S;  2JQH A;  1HS7 A;  4WBN E;  3PUZ F;  2V7J A;  2LSK A;  2MPK A;  2W62 A;  3RI5 A;  3ABV A;  4WNK A;  2V7K A;  2Y7Y A;  2XNU A;  1HG5 A;  2JRK A;  1FJG T;  4OYJ A;  3QB5 K;  3ZCI A;  3S4U A;  4ZI3 C;  4DBQ A;  1J1J A;  3WIP A;  2D5U A;  3SFE A;  4YJ2 E;  4IE5 A;  4U2Z A;  1D1B A;  3AEB A;  3UTK A;  4C91 A;  2H88 A;  5LG3 A;  3P4P A;  1U4Q A;  5EK2 A;  3AXJ A;  3U8N A;  3TLV A;  4DR5 T;  4HGA A;  4GYS A;  3RQW A;  2LRL A;  3RYI E;  2XQ9 A;  2C5K T;  3CQX C;  3AA0 B;  3N2K E;  3ZMZ B;  3F2E A;  3LJC A;  4ZOL E;  5CB4 E;  1B7T A;  1N34 T;  4UV8 B;  2BS3 A;  4L5G A;  2BR8 A;  1WFD A;  4DR7 T;  3J7Y q;  2BVL A;  3JAD A;  4MBQ A;  3J9X 1;  3L3P A;  4ZI2 D;  3AEE A;  5HWY A;  2N2N A;  3AEG A;  1D1A A;  5AQI B;  2V1D B;  4HFD A;  3WAJ A;  2YME A;  5IWA T;  5LOV E;  3ZT5 A;  3JC6 D;  2KWH A;  4QAB A;  2XNT A;  2D2S A;  2L3L A;  3P4R A;  1EZ3 A;  3AE4 A;  5AQU B;  4H9N C;  4YXD A;  4LF8 T;  2YU2 A;  4JLE A;  4EV6 A;  2WN9 A;  4LF4 T;  2H89 A;  1MIW A;  1LVF A;  2Y8D A;  1E2A A;  3EI0 A;  3OJA A;  1OWA A;  3QUJ A;  2VQE T;  4JBW F;  5L3D B;  3ZDG A;  4G2A A;  4ZZB A;  2VL0 A;  5KE4 A;  5HXE A;  4MHC A;  4OX9 T;  1LRZ A;  4ZS2 A;  3ZYK A;  2VKJ A;  5LJM A;  3KBT A;  2WU5 A;  4EGW A;  5KZU A;  2UUA T;  4EEB A;  1DU2 A;  4DUZ T;  4O4I E;  2H7V C;  2UXD T;  3ETU A;  2BVM A;  3T4M A;  4O4H E;  4UY2 A;  2E9X A;  3AE8 A;  5FVK A;  2A9U A;  5LHH B;  4AIU A;  4AFG A;  1WR0 A;  4QAC A;  3JCF A;  4E7Z A;  1R8I A;  4HWF A;  3K8P C;  4EED A;  3NZQ A;  5AFH A;  3A5X A;  4P09 A;  4X5T A;  4LML A;  4WYV A;  1MIV A;  1IJ6 A;  4LF5 T;  5J5I A;  2KWI B;  1VCS A;  3NZP A;  3ZYM A;  3L8R A;  2IDO B;  4QWN B;  5FMN A;  2E9X C;  5BMV E;  1W9R A;  3V5S A;  4KBM B;  4H9P C;  2CRB A;  3MZK B;  1HNW T;  1HX1 B;  1GQE A;  2CLY C;  3SH1 A;  5AQF B;  5FY0 A;  2DNX A;  4JI5 T;  3VRB A;  1T72 A;  1T7S A;  2XUE A;  2XQ8 A;  2NOX A;  5FXW A;  1IJ5 A;  2NTX A;  3K3Q C;  2XQ4 A;  3QC9 A;  4DV1 T;  2VWA A;  2NWB A;  3SOL A;  4PJM A;  4QX8 B;  5AQM B;  4OK0 A;  1JNR A;  4DR1 T;  1J5W A;  5HXC A;  3PE0 A;  2IC9 A;  4MLK A;  4B3T T;  3WTJ A;  3M3Z B;  1US7 B;  1KNP A;  3N9L A;  3PEO A;  2UUC T;  2CBJ A;  3N2O A;  2B1E A;  5L4H A;  1UV6 A;  1XDP A;  3VHL A;  2PJQ A;  4DMW A;  3F57 A;  3NRX A;  5CA0 E;  3GN5 B;  1UW6 A;  5L3G B;  3GMI A;  3LFM A;  4MAL A;  2ZM2 A;  4DND A;  1YQ4 A;  5HEH A;  1IZN B;  3NVO A;  3I9W A;  5JDL A;  2WBL A;  3QOF A;  5AFL A;  1HR0 T;  2LM2 A;  4A97 A;  3D0T A;  2KSR A;  1YQ3 A;  3RIU C;  2SPC A;  5IYZ E;  5JDG A;  4X62 T;  3QNU A;  3N9O A;  3AE1 A;  4X66 T;  2JQK A;  1YXR A;  5LJN A;  4EYU A;  4NZB A;  1FEW A;  4QH4 A;  4B3S T;  5LBM A;  4BA9 A;  2BKN A;  1KF6 A;  3AB3 B;  3KBU A;  5BW2 A;  2CWY A;  4HEA A;  4QXC B;  5KMG P;  2MOZ A;  5AQL B;  3NWI A;  2J4G A;  3FZL B;  5GON E;  4ZI7 E;  2YDR A;  5J0Z A;  2JQQ A;  2EHO A;  2J1D G;  5F5W A;  4UEM A;  5JDH A;  5AFK A;  3UUM A;  4HFH A;  4QAA A;  3ZPO A;  3FB2 A;  4WZX A;  4FRR A;  2PH9 A;  2JMK A;  4ERR A;  2K9A A;  2QA7 A;  5C8Y E;  4X65 T;  2X51 A;  1SUM B;  1G8X A;  1NEK A;  3PUV F;  3WAK A;  2X00 D;  2LT3 A;  5SYO A;  4LF9 T;  3N2G E;  1YD8 G;  4CI3 B;  3ONL C;  2XAJ B;  5AQJ B;  1HFA A;  2YN6 A;  2AXD S;  1UX2 A;  2HPL A;  3C4W A;  3AVS A;  2XQ5 A;  5J5G A;  2E5V A;  4B3M T;  4BQT A;  1XNQ T;  2X9H A;  5KDM C;  3P4W A;  2Y56 A;  4O2B E;  5L3F B;  3WTM A;  2XQ6 A;  3NKZ A;  2DI4 A;  2V7I A;  2Q9Q D;  4Q25 A;  4X20 E;  2XSA A;  2H3R A;  4UXU A;  2PTF A;  3CIR A;  2X68 A;  2UZ6 A;  4GOU A;  5TAO A;  2KT9 A;  4OYK A;  2CXL A;  2KIN B;  3X1D A;  1I9B A;  2F4V T;  3VU7 H;  1MMD A;  4CXY A;  5LYJ E;  4GKJ T;  3LK2 B;  4ISS A;  4DV6 T;  2VKO A;  2JIW A;  5JDN A;  3PMZ A;  3K1S A;  4CXX A;  5HEU A;  3PUW F;  4DVD A;  4IE7 A;  4U72 A;  5JH7 E;  4JEU B;  1D0Y A;  3IA3 A;  1CHU A;  3AAA B;  5FY1 A;  3UU5 A;  4PAG A;  4X1K E;  2NP9 A;  1H7C A;  3UUL A;  2XAS B;  3BQL A;  5AIN A;  3ZC1 A;  2Y48 B;  2KMF A;  3ZMU B;  3PUX F;  1HX8 A;  2B76 A;  4YLH A;  2NW8 A;  2W8F A;  5J2U E;  3U8M A;  3WTL A;  5C3J A;  3M65 A;  3EUH A;  2BG9 E;  2HN2 A;  2PGZ A;  2M67 A;  4AKI A;  3SRZ A;  3BK9 A;  3CVR A;  2X0H A;  4KHP T;  3HA4 A;  1WR6 A;  4GK0 E;  2V5C A;  2WSS V;  3VRA A;  3PU8 A;  4DR4 T;  4B3R T;  1UX5 A;  4CI2 B;  4DBR A;  5AFM A;  5ABF A;  2LHR A;  5ADX L;  2ZMA A;  4BFQ A;  1XDO A;  2HPJ A;  5AQH B;  2XYS A;  2CXF A;  4LFC T;  3N5L A;  3H3M A;  2ZM0 A;  3RHW A;  5DQV A;  3C50 A;  4JI6 T;  2EHO D;  4B6X A;  1VOM A;  5AFJ A;  2XQY A;  5L4E A;  4WBO A;  3BQK A;  1MMA A;  2QGS A;  2UXX B;  1VRB A;  3OPC A;  4IIJ E;  3ZST A;  2E9X D;  3ONX A;  5LNK A;  3B5M A;  3K3O A;  3AXJ B;  5JR9 A;  4BJM A;  4XBF B;  1YKH B;  4AQF A;  5AFM B;  2LSY A;  4ADZ A;  3CKD A;  3UU4 A;  4QXH B;  2E2A A;  2CPT A;  2KND A;  4OHF A;  3RKG A;  4JI3 T;  3UQ7 A;  2M6I A;  2XQ3 A;  4UR9 A;  3R6N A;  4UIG A;  4ZJS A;  2DWG A;  2HH7 A;  3W15 B;  3Q5X A;  3AE6 A;  1YW0 A;  2BG9 C;  5LBQ B;  2V8S V;  4MFR A;  4I0U A;  2X9Y A;  2BG9 B;  5CO5 A;  4KMC A;  2GK9 A;  2BYP A;  4QXB B;  3N9N A;  1W09 A;  2YMD A;  4LFA T;  3KVA A;  2PBI A;  2MBG A;  4YTN A;  2UXC T;  3ANW A;  4Z90 A;  3L09 A;  5FNV E;  4O4J E;  2JMH A;  1MIY A;  2FJE A;  1BR2 A;  3RIA A;  2YU1 A;  2Q9Q C;  4QX7 B;  4DBM A;  2Q9Q B;  4Z8X A;  4ZS3 A;  5LXT E; 
#chains in the Genus database with same CATH homology
 2Y54 A;  3P50 A;  2BG9 A;  4ZJT A;  2QC1 B;  4ZRU A;  5LG3 A;  4ZZB A;  3WTH A;  3EHZ A;  2VL0 A;  2XQ7 A;  5AFK A;  5AFJ A;  5KE4 A;  3U8J A;  4HFH A;  4QAA A;  5L4E A;  3SIO A;  3U8N A;  4FRR A;  2PH9 A;  3TLV A;  5HCJ A;  2LKG A;  3RQW A;  2XQA A;  3JAF A;  4TWF A;  2BR7 A;  4ILA A;  1OED E;  5BRX A;  2XQ9 A;  4TWH A;  3IGQ A;  5KZU A;  3TLT A;  4ILB A;  4IL4 A;  3ZDH A;  3WTJ A;  3U8L A;  3UU5 A;  4HFI A;  5CFB A;  5HEG A;  3C84 A;  3PEO A;  3ZKR A;  2X00 D;  3RQU A;  5SYO A;  3TLS A;  4ZZC A;  3T4M A;  2WNC A;  5HEO A;  4UY2 A;  5TVC A;  5L4H A;  4A98 A;  1UV6 A;  2BR8 A;  2Y57 A;  4HQP A;  5AFM B;  4TNW A;  3C79 A;  2BYN A;  5AIN A;  2YN6 A;  3UU4 A;  4HFC A;  2C9T A;  4ILC A;  5J5F A;  1UX2 A;  4IL9 A;  2YKS A;  3JAD A;  4LMK A;  1UW6 A;  4AFG A;  3UU8 A;  3JAE A;  3UQ7 A;  2XQ5 A;  2M6I A;  4UM1 A;  3WTK A;  4UM3 P;  4B5D A;  2XQ3 A;  5J5G A;  5LXB A;  4QAC A;  2BYQ A;  3WTI A;  4ALX A;  5HEH A;  3EAM A;  4BQT A;  2ZJV A;  4ZJS A;  3SQ9 A;  2MAW A;  5L47 A;  4UM3 S;  3P4W A;  4HFD A;  2W8F A;  2Y56 A;  5AFH A;  5AFL A;  3TLU A;  5IUX A;  2BG9 C;  2LM2 A;  2LLY A;  4X5T A;  4A97 A;  4LML A;  2YME A;  2KSR A;  5HEJ A;  4XHE A;  3WTM A;  2XQ6 A;  4AFH A;  4QH5 A;  2XYT A;  4HFB A;  5J5I A;  3U8M A;  3WTL A;  3RI5 A;  2BG9 B;  2WNJ A;  4Z91 A;  4QAB A;  5CO5 A;  2XZ5 A;  4ZK4 A;  3UU3 A;  2BJ0 A;  2BYP A;  4QH1 A;  2XNV A;  3RIF A;  2XNT A;  1OED C;  2LKH A;  2BG9 E;  4UXU A;  2PGZ A;  2WNL A;  1OED B;  4IRE A;  2Y7Y A;  2ZJU A;  4LMJ A;  2YMD A;  2UZ6 A;  4UM3 A;  5AFN A;  2XNU A;  2BYS A;  4NZB A;  4COF A;  3UU6 A;  2X00 A;  4QH4 A;  3LSV A;  2WZY A;  4ZR6 A;  4WV9 A;  5FJV A;  1I9B A;  3WTN A;  2M6B A;  4PIR A;  3SH1 A;  2YOE A;  4D01 A;  5BP0 A;  2WN9 A;  2XZ6 A;  3UUB A;  4Z90 A;  4ZK1 A;  5BW2 A;  2W8G A;  3TLW A;  2Y58 A;  3EI0 A;  5AFM A;  4EZ1 A;  5HCM A;  3RIA A;  4BFQ A;  2XQ8 A;  3WIP A;  2XYS A;  1OED A;  4TNV A;  4F8H A;  5J0Z A;  3PMZ A;  4XK9 A;  2XQ4 A;  3SQ6 A;  4AFT A;  3UQ4 A;  5HEU A;  4DBM A;  3U8K A;  3GUA A;  3RHW A;  4HFE A;  5JME A;  4TWD A;  5J5H A;  3WTO A;  3ZDG A;  4NPP A;  2BYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...