5L4EA

X-ray structure of the 2-22' locally-closed mutant of glic in complex with thiopental
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
source organism Gloeobacter
molecule tags Transport protein
total genus 89
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l4eA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l4eA01
4Z90A 5J5HA 4COFA 1OEDA 2XQ8A 3TLWA 1UX2A 2XNTA 5JMEA 2BYNA 4IL9A 3EHZA 2UZ6A 4UM3S 5J5IA 5L4HA 2ZJVA 1OEDE 4LMKA 4TWFA 5LG3A 5AFMB 2XQ7A 3WTLA 2C9TA 2BG9A 4HFDA 2Y7YA 5AFHA 5J0ZA 4ZK4A 2M6BA 3U8NA 2W8GA 3SQ6A 3UUBA 4QAAA 4EZ1A 4X5TA 2WN9A 1OEDC 4UM3P 3U8LA 1OEDB 4ZRUA 2XQAA 5AFLA 2BYRA 4FRRA 4B5DA 2WNJA 2XQ4A 3UU8A 3TLTA 4F8HA 2W8FA 3U8JA 3TLSA 4HFCA 2YN6A 5BRXA 2LLYA 3RIFA 3UQ4A 2XNUA 3JAFA 2YOEA 5FJVA 2XNVA 2BG9C 4PIRA 4DBMA 5AFKA 2BG9B 5HCMA 3C79A 5J5FA 2KSRA 2XQ6A 4XK9A 4HQPA 4HFEA 4ILAA 4ZJTA 2M6IA 4BFQA 4HFBA 2X00A 3SQ9A 2PH9A 3EI0A 4QH4A 3WTJA 4A98A 4AFHA 3P4WA 2XZ5A 2WNLA 4UXUA 3WTOA 4TWHA 3U8KA 2BR8A 4NPPA 4TWDA 2WZYA 3ZKRA 3WTHA 4AFGA 5AINA 3WTMA 2LKHA 2Y54A 3EAMA 2BYPA 5HEOA 2YMDA 4Z91A 2WNCA 2XYSA 5CFBA 4IREA 5CO5A 4ILCA 3C84A 4XHEA 2BYSA 3RIAA 5IUXA 3TLUA 2BJ0A 3WIPA 3SIOA 4QACA 3RI5A 5KZUA 5L47A 5HEHA 5TVCA 3LSVA 3WTKA 5HEJA 1I9BA 3U8MA 4UY2A 4ILBA 3UU5A 2PGZA 4A97A 2XZ6A 3JAEA 2LKGA 5HEUA 4ZJSA 5SYOA 5KE4A 4ZK1A 2Y58A 5BW2A 4QABA 4LMLA 2ZJUA 2YMEA 5L4EA 2XQ3A 4LMJA 2MAWA 4TNVA 5AFJA 4WV9A 3TLVA 3PEOA 4AFTA 4IL4A 1UV6A 3IGQA 3UU4A 5J5GA 3WTNA 4HFHA 5HCJA 5AFNA 2VL0A 2BYQA 3GUAA 3UQ7A 4UM1A 4QH5A 4BQTA 4D01A 3ZDGA 5HEGA 1UW6A 2BR7A 4ALXA 4ZR6A 4TNWA 2XYTA 3RQUA 2YKSA 2XQ9A 4UM3A 5BP0A 3RHWA 3SH1A 2QC1B 3PMZA 3UU3A 2LM2A 3P50A 5LXBA 3JADA 4NZBA 2X00D 4HFIA 2Y57A 4ZZCA 5AFMA 3RQWA 2BG9E 3ZDHA 3T4MA 4ZZBA 3UU6A 3WTIA 2Y56A 2XQ5A 4QH1A
chains in the Genus database with same CATH superfamily
1KNPA 3A8YC 3PU8A 3EDUA 3FZLB 5LBQB 2NWBA 2JIWA 1ZOYA 2XAHB 2JJ9A 4DR1T 2BG9A 3LBXA 2WY2A 3ETUA 3ZCIA 3PUWF 4UM3P 4NUVA 2I59A 3PUYF 5AQOB 3RPUA 1N32T 3TLTA 2UXCT 2W8FA 3NBXX 4IDNA 5BRXA 4TV9E 2XNUA 3I1AA 3D0TA 4NXMT 2CXFA 4LFBT 2C5IT 3KVAA 3N9MA 4HQPA 4ZJTA 3RYHE 2X00A 5ADXL 4AFHA 3AE2A 5LHGB 2XZ5A 1HTJF 1XDPA 2N9DA 3QB5A 2AE9A 3SS1A 3KV6A 3AAAB 4O8SA 3EUHA 3KDSE 4CN6A 5DJQC 3PUXF 4Q25A 4YJ2E 4JI3T 4UEMA 5KMGP 4A97A 2FBWA 2LKGA 1LVFA 2XQ3A 4TNVA 4HWFA 4DNDA 2CM0A 3UTKA 5ABGA 2LHNA 2BDEA 2ZLYA 1Y64B 3I9WA 2LSKA 2PJQA 1KNRA 1LRZA 5C3JA 5BP0A 4U2ZA 4FI5A 3UFGA 3VR8A 1Z8UA 2J1DG 1FIOA 3N2OA 4LF4T 4TUYE 4QH1A 1UX2A 3AA0B 1UUSA 3E0ZA 2BYNA 3EHZA 2UZ6A 3KV4A 4B6XA 3NWIA 2H7OA 4IE7A 5JDHA 2WDRA 3AEEA 2YDRA 2E9XC 5HXEA 2W8GA 1J5ET 1V9DA 4QAAA 2XAQB 3P8CD 4HGAA 5F8PA 4AQFC 5LB7B 2VQFT 1VCTA 2XQ4A 3KBTA 3U8JA 2E9XD 3AECA 1UX5A 3JAFA 1J5WA 4X20E 2PTFA 3ZSTA 3FBLA 3B5MA 5CB4E 2UXXB 2XHEB 4UIGA 3DTOA 2V7IA 2CHOA 2ZM6T 2V8SV 1NEKA 4UV8B 4ERRA 2V6XA 4N78D 2V7LA 4X64T 1QUUA 1WYCA 1D1CA 2VVNA 3OKQA 4ZS3A 4L5GA 3RI5A 3AVSA 4A56A 2IC6A 3AA7B 2D0TA 2Y6XA 4ZOLE 4E7ZA 3Q5DA 2W00A 5JH7E 1HX1B 3PEOA 1IZNB 3Q2MA 3UU4A 3ONLC 4UM1A 2VVSA 3Q9DA 1UW6A 5LG4A 5FY7A 4ZR6A 3RQUA 2H3RA 4GK0E 3U3IA 1IJ5A 4YJ3E 3C51A 3S4UA 4GKJT 5JRCA 2Y57A 3PUZF 5AFMA 4IE6A 4BJMA 1MNDA 3T4MA 3ZT5A 1I6ZA 4DMVA 2HPLA 4X1YE 1N36T 5JDLA 2WM9A 4BA9A 3UT5E 3E08A 3T1HT 2LE8A 3CKDA 2IW5B 2N1GA 2LSJA 2WS3A 1SE7A 2VQET 3MKDA 3O1IA 4TV8E 4CI2B 2BKPA 2WDQA 3RYCE 2BG9B 5HCMA 3V5SA 3LBXB 4DMWA 4HFEA 4ILAA 3B13A 4OHFA 4QXBB 3I9YA 2PH9A 4GYRA 4ZI7E 4TWHA 4IDZA 1KFYA 4DV3T 4H9RC 2W2UA 5HEOA 3HKBE 4PJJA 2DLRA 5EK4A 5IHYA 4OFZA 3RX6A 2V7JA 2FUPA 3AXJA 2CA5A 3N9PA 4UY2A 4XZCA 1D1BA 4LMLA 3C4XA 5L4EA 4DV1T 4U31A 2UXNB 3AE9A 5FL1A 4H9PC 2KNDA 2VL0A 3CX6B 4QKNA 5IYZE 2BR7A 4IE0A 2XYTA 2CMRA 1VOMA 2X9YA 3HI2A 3RC3A 2K9AA 2J47A 3N9OA 4AQYT 3ZN1B 2H7VC 4DR5T 4O4IE 4YHHT 4TWFA 1JNRA 4HKAA 2CEAA 2X66A 1S94A 3U8LA 2LOPA 3AE7A 1J1JA 2VKDA 3ZYMA 3MXZA 1UX4A 2K48A 5AQHB 2AXDS 5FJVA 4XK9A 1UGOA 3KFWX 4O4LE 2M6IA 3H37A 4IIJE 2IIUA 2XSAA 1E7PA 2HN2A 2IHR1 3P4WA 5JVDE 4EB6E 2NW7A 4DV6T 4NPPA 2L9QA 3B57A 5LGNB 3ZPOA 4I55E 2V7MA 3H3MA 5CFBA 2OLTA 3WAKA 3C84A 3RKGA 5AQIB 3L39A 3HL6A 2DI4A 3ONJA 3SIOA 5HEHA 3LSVA 3E22E 3ESLA 2BS4A 2XZEA 2D2SA 3LJCA 3WTNA 4HFHA 2K3WA 5LMNT 2JQ9A 4D01A 3L8RA 5HEGA 2H89A 4IDPA 4MHCA 5HAXA 2HN1A 2WMNA 4HFIA 1B7TA 3RQWA 2J4GA 3VRAA 4JI5T 5LJNA 3AVRA 1OWAA 5H6RB 3OBVE 4QX8B 3FZFB 5JRCB 5AFMB 5KDMC 2Y7YA 2M6BA 2Z6EA 3UUXB 4JYAT 1MMAA 1D1AA 3VKGA 5AQJB 3NVOA 2LSYA 3TKLB 2PFVA 3ZMUB 3NKZA 4DV7T 5CGMA 2BG9C 2X9WA 4LF8T 2KSRA 2KINB 2CPTA 2EHOD 3WTJA 3QOFA 4JLEA 1NAFA 5LGUB 3WTOA 3I0QA 1IJ6A 3SFDA 3RC8A 3U8KA 3JC6C 3LDQB 3MZKB 4UVBB 3G06A 5AQNB 2VWAA 1D0XA 4PK5A 3JC6D 4CXYA 4IE4A 4UXNB 4I50E 3AE6A 3JAEA 5ETWA 4ZJSA 2VURA 1ZP0A 3NRYA 1HS7A 3TLVA 1YW0A 4EZ4A 3W15B 1XNQT 2NP9A 3UQ7A 4QH5A 3AXJB 2WAUA 4U7IA 2BVMA 2V5DA 4U72A 4OYJA 4U74A 2BG9E 2MPKA 1SHZC 5J5IA 3RYFE 2E8IA 2ACXA 2XQ5A 4ZI2C 2XNTA 5JDFA 2V26A 3ZSSA 1KNZA 1T98A 4CI3B 5F3JA 2WU2A 1U5PA 1OEDE 2C0SA 2M67A 2ZJVA 2QGSA 1BR2A 5LG3A 2VK9A 3FHNA 2Y8DA 3I0OA 4YLHA 5DABA 3QC9A 1HCIA 4AQGA 4FRRA 4OX9T 2WWUA 4G63A 5L3BB 3UQ4A 2OA5A 3ONXA 2YOEA 5BR8T 5J5FA 2QA7A 2XUEA 2KMFA 5J2TE 2X0YA 4A98A 3QK6A 3CK6A 4KI0F 5FL0A 5LHIB 1XMOT 2BR8A 4TWDA 1ZHCA 3PUAA 5DQWA 2K5BB 2Y54A 2L8KA 4O4JE 3U78A 1WCRA 4X65T 5IUXA 4QACA 4HN9A 4OK0A 3L3PA 3U8MA 1MIVA 4EV6A 4B3TT 5AQSB 3HR0A 3ZEFB 4DR4T 2ZM2A 4I43B 1NENA 2CXLA 5J5GA 3QUJA 5AQMB 4PW8A 5TAOA 3ZYLA 2X0LB 4TNWA 2LM2A 5JR9A 2XJ7A 3ZT6A 3AE5A 1FJGT 4OYKA 1LVKA 3SQ6A 2VKOA 1BR0A 3ANWA 5HXSA 3HKDE 4UM3S 3RH3A 2UUBT 3FZHB 4KHPT 3VKHA 2V1DB 5FMNA 4WBNE 3WTLA 4JI0T 3V5UA 4TZ4C 5LP6E 3C98B 4ZRUA 4WBOA 4AISA 5AFLA 2Q9QA 2KLQA 4U2YA 2DNXA 4UVAB 3BK9A 3N2KE 2YN6A 2DCFA 3AAEB 5JDNA 3CVRA 5LOVE 2BVLA 4Z8XA 2Y48B 5FXZA 2LRKA 3AEGA 2W63A 2LM9A 5AQLB 5HWXA 4CXWA 2DWGA 1M7KA 2MBGA 3CX8B 3RIUA 4WZXA 2D0UA 2BYSA 3C4WA 3UUNA 3KINB 1I9BA 5HEUA 3P4PA 2JMHA 2WWVA 4LMJA 5AQTB 1JNZA 2WB5A 3AE3A 2JMKA 4LFAT 3ZDGA 1ZV4X 5L3DB 4I0UA 1YD8G 4IDQA 4PNIA 4AKRB 3F31A 2X51A 5FY0A 4CN4A 3P50A 4J2CA 4ZZCA 4O2BE 2BKNA 2WZHA 4K0KT 2CE7A 4IL9A 4HWCA 1HF8A 2C9TA 5AFHA 4HEAA 1IBLT 4GK5E 5EK2A 4DV5T 2CLYB 4XAXB 3PUQA 4C91A 2LSIA 1MIWA 2I0MA 4HFCA 4UV9B 4YSXA 2WCAA 2H88A 4KUMB 3KV9A 5ABFA 4NXNT 2UXDT 1N33T 2FJBA 2RP4A 2JRKA 2CCQA 3ZKRA 3LK3B 1T7SA 5KXJA 2DWKA 1AJ3A 2WNCA 2A2FX 4P1NA 1O3XA 3PJAA 4TX5A 3SOLA 4JEHB 4QWNB 5F5WA 3CMLA 4ILUA 5FXWA 2XASB 3UU5A 2NR4A 4ZK1A 4YTNA 2C5KT 4ZI3C 4EEDA 2FJAA 4DR6T 5AFJA 2PBIA 4AFTA 1WR6A 2QVAA 2CWYA 3BQIA 2BYQA 4ZI3D 3PURA 3OVUA 4G2AA 5CA1E 5L3CB 1R8IA 3VU7H 3SH1A 5FXXA 4IGUA 2YDSA 2CBIA 1H7CA 4ZZBA 3UU6A 4LF6T 4COFA 3RKOA 4PK6A 5L4HA 1SA0E 5JR9B 2RA1A 4U33A 2KWIB 4DBRA 4P0BA 3UUBA 2NW8A 3ANWB 3KV5A 2BYRA 4MLKA 3UU8A 2XSBA 3HA4A 3AB3B 2FJEA 4PIRA 4YTPA 5FKYA 4QX7B 2IC9A 2E5VA 4IE5A 4YT0A 4X66T 2LJLA 4UF0A 2Q9QB 3JCFA 3EVYA 5JDQA 1XZYA 3ZMTB 2YINA 3ETVA 5IWAT 2ZMAA 3KVBA 5AQFB 2VL8A 3TLUA 2VKJA 3AEAA 3MA9A 2KT9A 3O1HA 5LA6E 5HXHA 2OV9A 1WFDA 2Y58A 4P09A 1HFAA 1X79A 4CZZB 3HKCE 4ANJA 3H3AA 3CWZB 4DVDA 4UR9A 1WYBA 2XQYA 3AEDA 2UUAT 5JQGE 4BQTA 2YU1A 3RHWA 1M62A 4WW0A 3K3NA 4EZHA 4DR7T 4ZXLA 4QXHB 1WLXA 4IT4A 4HE8A 3SWHA 5L3EB 5JMEA 3AAIA 4ASKA 5DQVA 3PJAJ 4AKLA 2CWOA 4U3CA 3ZYKA 1UURA 1XNRT 3WI3A 4NIQA 2C5JA 5E0OA 4EAHA 4HFDA 3N9LA 4YY3T 2WBLA 3RGLA 5ABHA 2CLYC 4ADZA 4AI6A 2XTLA 4HFVA 2XM2A 2G0UA 2WP9A 1US7B 4LF5T 1L0VA 2HH7A 3AEBA 2ZM8A 1NWMX 4PJMA 2KWHA 3HKEE 2JPFA 4Z91A 5ABFB 3ZJ2A 3WAJA 2XYSA 1IAPA 1E1HB 1YKEB 5L47A 3K1SA 5GONE 1W0AA 2F4VT 5SYOA 5BW2A 2ZJUA 2MAWA 3ABVA 1UK5A 3IHRA 4X62T 4WYVA 2V6YA 2LSGA 2SPCA 3P4QA 3GA8A 2LHRA 3ZC1A 3UU3A 1CUNA 2BS2A 2GK9A 2X00D 2ACZA 3N5LA 3ZT7A 4L0RA 5M4YA 3M3ZB 3NRXA 4EOZB 5J5HA 2P9BA 2XQ8A 2CHNA 4AKIA 2L3LA 4AIUA 5JR9C 1WR0A 2X0HA 3IA3A 2MTQA 3QB5K 5J0ZA 5H6QB 2JQHA 3DJBA 5C8YE 3PE0A 1YKHB 3EDVA 1BR4A 5JDGA 3TLSA 3FZKB 4HWIB 3IBPA 2W66A 4MBQA 1W9RA 5FXVA 2NOXA 4WNKA 4HFBA 4ZI2D 2Q9QC 2DL1A 1IBMT 3N2GE 1UCUA 3FZMB 5JTGA 5LGTB 2WNLA 2BZBA 2HHHT 1EZ3A 3LK42 3EAMA 2YK0A 4IREA 2ES0A 2D9DA 5CO5A 4ILCA 5AQGB 2E2AA 4B3ST 5KX5E 4I4TE 4UF0B 3F2EA 5L2LA 2WU5A 5CJ5A 4YSZA 1MMNA 3OTOT 3VHLA 2LOSA 3RIUC 2IDOB 3KBUA 2LT3A 4KP3C 3GUAA 2XM1A 2QYWA 5FP3A 3IF8B 4ALXA 4GKKT 2RPAA 4UM3A 2EHOA 3GWHA 4NZBA 3FB2A 4B3RT 4P0AA 4H9OC 3ZLIA 3ZMZB 4O4HE 1OEDA 2XY8B 5EK3A 1KF6A 2X9HA 4YSYA 4DIDB 2WN9A 1SUMB 5FY1A 5ABEA 2J62A 4O2AE 1LKXA 2A9UA 2QRXA 4F8HA 3UFEA 1X9BA 3CX7B 3FXEB 5AFKA 5HYAA 2W4XA 2KXPB 3SQ9A 3GMIA 1BR1A 3EI0A 4QH4A 1HR0T 4TN7B 2BBJA 4UXUA 1G8XA 5AINA 5L3FB 2N2NA 3K8PC 5HXRA 1S35A 4YXDA 2WZIA 3WIPA 3AE4A 3WTKA 2YEVC 3RYIE 2XZ6A 2FJDA 4QABA 4FJOA 3CQGB 4IL4A 4XBFB 4LFCT 1VRBA 4M1PA 1YQ3A 3O1JA 3J9X1 2YKSA 4X1KE 1D0ZA 4H63H 2QC1B 3JADA 1HNZT 5FNVE 3P4SA 4GOUA 4KHZF 4JI2T 2V6YB 3RRWA 4E7SA 4MFRA 1Z0PA 4MALA 2VB6A 4Z90A 3PU3A 3TLWA 2DHRA 2JQKA 3VR9A 2MOZA 4L9IA 3EABA 4JI8T 1FMVA 4H9NC 2X67A 2E5LT 4EZ1A 1ZKEA 5LBMA 4DV4T 4EIWA 4ZS2A 1Y01A 4UVCB 3OPCA 3AEFA 4ISTA 2BS3A 2D5UA 4X1IE 1FEWA 3SFEA 2XAJB 3CIRA 4AFGA 3PUSA 2W67A 4EXTA 3GN5A 2BYPA 5AFUL 4U7YA 3RIAA 2BJ0A 5HEJA 2WMOA 3BQLA 2LEHA 4PK4A 3C50A 4JI4T 2W61A 3M65A 5JREA 4JI7T 3IEEA 4KMCA 2NTYA 1W09A 2VKHA 2WSSV 2KZ7B 4YFSA 4JV5T 4BAYB 3ZMVB 4KBMB 2CBJA 1E2AA 3WTIA 2E9XA 4ZHQE 3PUVF 2CXDA 2EHOB 4AQFA 1N34T 4EGWA 5LMUT 3L09A 2XQ7A 3AE8A 2XPKA 5AQUB 4ZK4A 2YU2A 4DV0T 3A7MA 4AKGA 3K3QC 4X5TA 5AQPB 5LNKA 1OEDB 3CQXC 3PDYA 2XQAA 4CN1A 5C2TA 1W0BA 3RRCA 4QXCB 2B76A 3DP7A 2W62A 2LLYA 3K3OA 1CHUA 3ZC0A 2XNVA 3MJXA 2ODUA 2A3DA 4ZEYA 3ZJ1A 1HG5A 1MNEA 2IUBA 3FXDB 2ODVA 3MACA 5BMVE 4DO0A 1ZEEA 3WTHA 2LKHA 4AKHA 4CI1B 2IMLA 2YMDA 1T8BA 2V7KA 1KK7A 4QHOA 2X68A 2B1EA 3Q5XA 4KX6A 5KE4A 2V5CA 4V1Av 3J7Yq 4YHJA 4JI1T 1XMQT 4GYSA 5L3GB 4HWDA 5LXBA 1U4QA 1YQ4A 1HNXT 2PG8A 2Y56A 1YXRA 3N9QA 2YDQA 1MMDA 4LMKA 5JDMA 4CQIA 3C4ZA 1DU2A 1I94T 3R6NA 3LFMA 4B5DA 4JUYA 5FVKA 3LK2B 3C64A 2W0GA 3AE1A 4DBMA 2K24A 3R84B 4BFQA 5LHHB 4UELA 2WQYA 4YTMA 2X9XA 1OXZA 5AQVB 3MK7C 3WTMA 3LG7A 3AA1B 3QNUA 4AXPA 4IHJE 4ILBA 2PGZA 4DUZT 1XDOA 4CXXA 4PAGA 5LYJE 5FVLA 3GN5B 1HX8A 5J2UE 5HWYA 4K0UA 3T8OA 5AQKB 3IGQA 2UU9T 3NZPA 3F57A 4DBQA 3NZQA 3A5XA 2UUCT 5AQRB 3OYXA 2IAKA 4DR2T 3ZN0B 4ISSA 3FBZA 1G73A 4B3MT 1MMGA 1HG2A 3PMZA 4C90A 1T72A 4F6RC 1XWMA 4PJNA 4H9QC 1MIYA 2JQQA 3PTRB 4EYUA 3Q5EA 2EHOC 4PFPA 3CQCB 2MYSA 2CRBA 4HTEA 5LXTE 4HWHA 4DR3T 4JEUB 5AQQB 4LF9T 3U8NA 2E9XB 2XAFB 1OEDC 4GIWA 3RLFF 3ZMSB 3UULA 1IBKT 2WNJA 3O9XA 2WDVA 2NTXA 4H9SE 2ZM0A 3RIFA 1HNWT 5A1LA 4A5XA 3C79A 4H63V 2XQ6A 1QSDA 5J1GA 4JI6T 1WRDA 4DUYT 2LRLA 1VCSA 2BBHA 3RF1A 5FYMA 1FMWA 3T1YT 3VRBA 3AA6B 4EYYR 2WZYA 3PV0F 5EZYE 3N9NA 2I6HA 3OYZA 5HXCA 1QLBA 3UUMA 3OJAA 3SRZA 4XHEA 5LJMA 4JBWF 5KZUA 4PFOA 5TVCA 2HPJA 2XAGB 1GQEA 3O4XE 4DV2T 3CPZA 4NUUA 3P7IA 1KEYA 2UXBT 2YMEA 3BQKA 4IDOA 4WV9A 3ZCJA 2R6GF 4PJLA 4EEBA 5CA0E 1UV6A 2BKOA 3PUGA 4BJNA 2Q9QD 5HCJA 4LF7T 5AFNA 3X1DA 2A72A 2NW9A 3Q5WA 3P4RA 2VASA 2XQ9A 1D0YA 5LCYA 3ZDHA
chains in the Genus database with same CATH topology
4Z90A 5J5HA 4COFA 1OEDA 2XQ8A 3TLWA 1UX2A 2XNTA 5JMEA 2BYNA 4IL9A 3EHZA 2UZ6A 4UM3S 5J5IA 5L4HA 2ZJVA 1OEDE 4LMKA 4TWFA 5LG3A 5AFMB 2XQ7A 3WTLA 2C9TA 2BG9A 4HFDA 2Y7YA 5AFHA 5J0ZA 4ZK4A 2M6BA 3U8NA 2W8GA 3SQ6A 3UUBA 4QAAA 4EZ1A 4X5TA 2WN9A 1OEDC 4UM3P 3U8LA 1OEDB 4ZRUA 2XQAA 5AFLA 2BYRA 4FRRA 4B5DA 2WNJA 2XQ4A 3UU8A 3TLTA 4F8HA 2W8FA 3U8JA 3TLSA 4HFCA 2YN6A 5BRXA 2LLYA 3RIFA 3UQ4A 2XNUA 3JAFA 2YOEA 5FJVA 2XNVA 2BG9C 4PIRA 4DBMA 5AFKA 2BG9B 5HCMA 3C79A 5J5FA 2KSRA 2XQ6A 4XK9A 4HQPA 4HFEA 4ILAA 4ZJTA 2M6IA 4BFQA 4HFBA 2X00A 3SQ9A 2PH9A 3EI0A 4QH4A 3WTJA 4A98A 4AFHA 3P4WA 2XZ5A 2WNLA 4UXUA 3WTOA 4TWHA 3U8KA 2BR8A 4NPPA 4TWDA 2WZYA 3ZKRA 3WTHA 4AFGA 5AINA 3WTMA 2LKHA 2Y54A 3EAMA 2BYPA 5HEOA 2YMDA 4Z91A 2WNCA 2XYSA 5CFBA 4IREA 5CO5A 4ILCA 3C84A 4XHEA 2BYSA 3RIAA 5IUXA 3TLUA 2BJ0A 3WIPA 3SIOA 4QACA 3RI5A 5KZUA 5L47A 5HEHA 5TVCA 3LSVA 3WTKA 5HEJA 1I9BA 3U8MA 4UY2A 4ILBA 3UU5A 2PGZA 4A97A 2XZ6A 3JAEA 2LKGA 5HEUA 4ZJSA 5SYOA 5KE4A 4ZK1A 2Y58A 5BW2A 4QABA 4LMLA 2ZJUA 2YMEA 5L4EA 2XQ3A 4LMJA 2MAWA 4TNVA 5AFJA 4WV9A 3TLVA 3PEOA 4AFTA 4IL4A 1UV6A 3IGQA 3UU4A 5J5GA 3WTNA 4HFHA 5HCJA 5AFNA 2VL0A 2BYQA 3GUAA 3UQ7A 4UM1A 4QH5A 4BQTA 4D01A 3ZDGA 5HEGA 1UW6A 2BR7A 4ALXA 4ZR6A 4TNWA 2XYTA 3RQUA 2YKSA 2XQ9A 4UM3A 5BP0A 3RHWA 3SH1A 2QC1B 3PMZA 3UU3A 2LM2A 3P50A 5LXBA 3JADA 4NZBA 2X00D 4HFIA 2Y57A 4ZZCA 5AFMA 3RQWA 2BG9E 3ZDHA 3T4MA 4ZZBA 3UU6A 3WTIA 2Y56A 2XQ5A 4QH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z90 A;  5J5H A;  4COF A;  1OED A;  2XQ8 A;  3TLW A;  1UX2 A;  2XNT A;  5JME A;  2BYN A;  4IL9 A;  3EHZ A;  2UZ6 A;  4UM3 S;  5J5I A;  5L4H A;  2ZJV A;  1OED E;  4LMK A;  4TWF A;  5LG3 A;  5AFM B;  2XQ7 A;  3WTL A;  2C9T A;  2BG9 A;  4HFD A;  2Y7Y A;  5AFH A;  5J0Z A;  4ZK4 A;  2M6B A;  3U8N A;  2W8G A;  3SQ6 A;  3UUB A;  4QAA A;  4EZ1 A;  4X5T A;  2WN9 A;  1OED C;  4UM3 P;  3U8L A;  1OED B;  4ZRU A;  2XQA A;  5AFL A;  2BYR A;  4FRR A;  4B5D A;  2WNJ A;  2XQ4 A;  3UU8 A;  3TLT A;  4F8H A;  2W8F A;  3U8J A;  3TLS A;  4HFC A;  2YN6 A;  5BRX A;  2LLY A;  3RIF A;  3UQ4 A;  2XNU A;  3JAF A;  2YOE A;  5FJV A;  2XNV A;  2BG9 C;  4PIR A;  4DBM A;  5AFK A;  2BG9 B;  5HCM A;  3C79 A;  5J5F A;  2KSR A;  2XQ6 A;  4XK9 A;  4HQP A;  4HFE A;  4ILA A;  4ZJT A;  2M6I A;  4BFQ A;  4HFB A;  2X00 A;  3SQ9 A;  2PH9 A;  3EI0 A;  4QH4 A;  3WTJ A;  4A98 A;  4AFH A;  3P4W A;  2XZ5 A;  2WNL A;  4UXU A;  3WTO A;  4TWH A;  3U8K A;  2BR8 A;  4NPP A;  4TWD A;  2WZY A;  3ZKR A;  3WTH A;  4AFG A;  5AIN A;  3WTM A;  2LKH A;  2Y54 A;  3EAM A;  2BYP A;  5HEO A;  2YMD A;  4Z91 A;  2WNC A;  2XYS A;  5CFB A;  4IRE A;  5CO5 A;  4ILC A;  3C84 A;  4XHE A;  2BYS A;  3RIA A;  5IUX A;  3TLU A;  2BJ0 A;  3WIP A;  3SIO A;  4QAC A;  3RI5 A;  5KZU A;  5L47 A;  5HEH A;  5TVC A;  3LSV A;  3WTK A;  5HEJ A;  1I9B A;  3U8M A;  4UY2 A;  4ILB A;  3UU5 A;  2PGZ A;  4A97 A;  2XZ6 A;  3JAE A;  2LKG A;  5HEU A;  4ZJS A;  5SYO A;  5KE4 A;  4ZK1 A;  2Y58 A;  5BW2 A;  4QAB A;  4LML A;  2ZJU A;  2YME A;  5L4E A;  2XQ3 A;  4LMJ A;  2MAW A;  4TNV A;  5AFJ A;  4WV9 A;  3TLV A;  3PEO A;  4AFT A;  4IL4 A;  1UV6 A;  3IGQ A;  3UU4 A;  5J5G A;  3WTN A;  4HFH A;  5HCJ A;  5AFN A;  2VL0 A;  2BYQ A;  3GUA A;  3UQ7 A;  4UM1 A;  4QH5 A;  4BQT A;  4D01 A;  3ZDG A;  5HEG A;  1UW6 A;  2BR7 A;  4ALX A;  4ZR6 A;  4TNW A;  2XYT A;  3RQU A;  2YKS A;  2XQ9 A;  4UM3 A;  5BP0 A;  3RHW A;  3SH1 A;  2QC1 B;  3PMZ A;  3UU3 A;  2LM2 A;  3P50 A;  5LXB A;  3JAD A;  4NZB A;  2X00 D;  4HFI A;  2Y57 A;  4ZZC A;  5AFM A;  3RQW A;  2BG9 E;  3ZDH A;  3T4M A;  4ZZB A;  3UU6 A;  3WTI A;  2Y56 A;  2XQ5 A;  4QH1 A; 
#chains in the Genus database with same CATH topology
 1KNP A;  3A8Y C;  3PU8 A;  3EDU A;  3FZL B;  5LBQ B;  2NWB A;  2JIW A;  1ZOY A;  2XAH B;  2JJ9 A;  4DR1 T;  2BG9 A;  3LBX A;  2WY2 A;  3ETU A;  3ZCI A;  3PUW F;  4UM3 P;  4NUV A;  2I59 A;  3PUY F;  5AQO B;  3RPU A;  1N32 T;  3TLT A;  2UXC T;  2W8F A;  3NBX X;  4IDN A;  5BRX A;  4TV9 E;  2XNU A;  3I1A A;  3D0T A;  4NXM T;  2CXF A;  4LFB T;  2C5I T;  3KVA A;  3N9M A;  4HQP A;  4ZJT A;  3RYH E;  2X00 A;  5ADX L;  4AFH A;  3AE2 A;  5LHG B;  2XZ5 A;  1HTJ F;  1XDP A;  2N9D A;  3QB5 A;  2AE9 A;  3SS1 A;  3KV6 A;  3AAA B;  4O8S A;  3EUH A;  3KDS E;  4CN6 A;  5DJQ C;  3PUX F;  4Q25 A;  4YJ2 E;  4JI3 T;  4UEM A;  5KMG P;  4A97 A;  2FBW A;  2LKG A;  1LVF A;  2XQ3 A;  4TNV A;  4HWF A;  4DND A;  2CM0 A;  3UTK A;  5ABG A;  2LHN A;  2BDE A;  2ZLY A;  1Y64 B;  3I9W A;  2LSK A;  2PJQ A;  1KNR A;  1LRZ A;  5C3J A;  5BP0 A;  4U2Z A;  4FI5 A;  3UFG A;  3VR8 A;  1Z8U A;  2J1D G;  1FIO A;  3N2O A;  4LF4 T;  4TUY E;  4QH1 A;  1UX2 A;  3AA0 B;  1UUS A;  3E0Z A;  2BYN A;  3EHZ A;  2UZ6 A;  3KV4 A;  4B6X A;  3NWI A;  2H7O A;  4IE7 A;  5JDH A;  2WDR A;  3AEE A;  2YDR A;  2E9X C;  5HXE A;  2W8G A;  1J5E T;  1V9D A;  4QAA A;  2XAQ B;  3P8C D;  4HGA A;  5F8P A;  4AQF C;  5LB7 B;  2VQF T;  1VCT A;  2XQ4 A;  3KBT A;  3U8J A;  2E9X D;  3AEC A;  1UX5 A;  3JAF A;  1J5W A;  4X20 E;  2PTF A;  3ZST A;  3FBL A;  3B5M A;  5CB4 E;  2UXX B;  2XHE B;  4UIG A;  3DTO A;  2V7I A;  2CHO A;  2ZM6 T;  2V8S V;  1NEK A;  4UV8 B;  4ERR A;  2V6X A;  4N78 D;  2V7L A;  4X64 T;  1QUU A;  1WYC A;  1D1C A;  2VVN A;  3OKQ A;  4ZS3 A;  4L5G A;  3RI5 A;  3AVS A;  4A56 A;  2IC6 A;  3AA7 B;  2D0T A;  2Y6X A;  4ZOL E;  4E7Z A;  3Q5D A;  2W00 A;  5JH7 E;  1HX1 B;  3PEO A;  1IZN B;  3Q2M A;  3UU4 A;  3ONL C;  4UM1 A;  2VVS A;  3Q9D A;  1UW6 A;  5LG4 A;  5FY7 A;  4ZR6 A;  3RQU A;  2H3R A;  4GK0 E;  3U3I A;  1IJ5 A;  4YJ3 E;  3C51 A;  3S4U A;  4GKJ T;  5JRC A;  2Y57 A;  3PUZ F;  5AFM A;  4IE6 A;  4BJM A;  1MND A;  3T4M A;  3ZT5 A;  1I6Z A;  4DMV A;  2HPL A;  4X1Y E;  1N36 T;  5JDL A;  2WM9 A;  4BA9 A;  3UT5 E;  3E08 A;  3T1H T;  2LE8 A;  3CKD A;  2IW5 B;  2N1G A;  2LSJ A;  2WS3 A;  1SE7 A;  2VQE T;  3MKD A;  3O1I A;  4TV8 E;  4CI2 B;  2BKP A;  2WDQ A;  3RYC E;  2BG9 B;  5HCM A;  3V5S A;  3LBX B;  4DMW A;  4HFE A;  4ILA A;  3B13 A;  4OHF A;  4QXB B;  3I9Y A;  2PH9 A;  4GYR A;  4ZI7 E;  4TWH A;  4IDZ A;  1KFY A;  4DV3 T;  4H9R C;  2W2U A;  5HEO A;  3HKB E;  4PJJ A;  2DLR A;  5EK4 A;  5IHY A;  4OFZ A;  3RX6 A;  2V7J A;  2FUP A;  3AXJ A;  2CA5 A;  3N9P A;  4UY2 A;  4XZC A;  1D1B A;  4LML A;  3C4X A;  5L4E A;  4DV1 T;  4U31 A;  2UXN B;  3AE9 A;  5FL1 A;  4H9P C;  2KND A;  2VL0 A;  3CX6 B;  4QKN A;  5IYZ E;  2BR7 A;  4IE0 A;  2XYT A;  2CMR A;  1VOM A;  2X9Y A;  3HI2 A;  3RC3 A;  2K9A A;  2J47 A;  3N9O A;  4AQY T;  3ZN1 B;  2H7V C;  4DR5 T;  4O4I E;  4YHH T;  4TWF A;  1JNR A;  4HKA A;  2CEA A;  2X66 A;  1S94 A;  3U8L A;  2LOP A;  3AE7 A;  1J1J A;  2VKD A;  3ZYM A;  3MXZ A;  1UX4 A;  2K48 A;  5AQH B;  2AXD S;  5FJV A;  4XK9 A;  1UGO A;  3KFW X;  4O4L E;  2M6I A;  3H37 A;  4IIJ E;  2IIU A;  2XSA A;  1E7P A;  2HN2 A;  2IHR 1;  3P4W A;  5JVD E;  4EB6 E;  2NW7 A;  4DV6 T;  4NPP A;  2L9Q A;  3B57 A;  5LGN B;  3ZPO A;  4I55 E;  2V7M A;  3H3M A;  5CFB A;  2OLT A;  3WAK A;  3C84 A;  3RKG A;  5AQI B;  3L39 A;  3HL6 A;  2DI4 A;  3ONJ A;  3SIO A;  5HEH A;  3LSV A;  3E22 E;  3ESL A;  2BS4 A;  2XZE A;  2D2S A;  3LJC A;  3WTN A;  4HFH A;  2K3W A;  5LMN T;  2JQ9 A;  4D01 A;  3L8R A;  5HEG A;  2H89 A;  4IDP A;  4MHC A;  5HAX A;  2HN1 A;  2WMN A;  4HFI A;  1B7T A;  3RQW A;  2J4G A;  3VRA A;  4JI5 T;  5LJN A;  3AVR A;  1OWA A;  5H6R B;  3OBV E;  4QX8 B;  3FZF B;  5JRC B;  5AFM B;  5KDM C;  2Y7Y A;  2M6B A;  2Z6E A;  3UUX B;  4JYA T;  1MMA A;  1D1A A;  3VKG A;  5AQJ B;  3NVO A;  2LSY A;  3TKL B;  2PFV A;  3ZMU B;  3NKZ A;  4DV7 T;  5CGM A;  2BG9 C;  2X9W A;  4LF8 T;  2KSR A;  2KIN B;  2CPT A;  2EHO D;  3WTJ A;  3QOF A;  4JLE A;  1NAF A;  5LGU B;  3WTO A;  3I0Q A;  1IJ6 A;  3SFD A;  3RC8 A;  3U8K A;  3JC6 C;  3LDQ B;  3MZK B;  4UVB B;  3G06 A;  5AQN B;  2VWA A;  1D0X A;  4PK5 A;  3JC6 D;  4CXY A;  4IE4 A;  4UXN B;  4I50 E;  3AE6 A;  3JAE A;  5ETW A;  4ZJS A;  2VUR A;  1ZP0 A;  3NRY A;  1HS7 A;  3TLV A;  1YW0 A;  4EZ4 A;  3W15 B;  1XNQ T;  2NP9 A;  3UQ7 A;  4QH5 A;  3AXJ B;  2WAU A;  4U7I A;  2BVM A;  2V5D A;  4U72 A;  4OYJ A;  4U74 A;  2BG9 E;  2MPK A;  1SHZ C;  5J5I A;  3RYF E;  2E8I A;  2ACX A;  2XQ5 A;  4ZI2 C;  2XNT A;  5JDF A;  2V26 A;  3ZSS A;  1KNZ A;  1T98 A;  4CI3 B;  5F3J A;  2WU2 A;  1U5P A;  1OED E;  2C0S A;  2M67 A;  2ZJV A;  2QGS A;  1BR2 A;  5LG3 A;  2VK9 A;  3FHN A;  2Y8D A;  3I0O A;  4YLH A;  5DAB A;  3QC9 A;  1HCI A;  4AQG A;  4FRR A;  4OX9 T;  2WWU A;  4G63 A;  5L3B B;  3UQ4 A;  2OA5 A;  3ONX A;  2YOE A;  5BR8 T;  5J5F A;  2QA7 A;  2XUE A;  2KMF A;  5J2T E;  2X0Y A;  4A98 A;  3QK6 A;  3CK6 A;  4KI0 F;  5FL0 A;  5LHI B;  1XMO T;  2BR8 A;  4TWD A;  1ZHC A;  3PUA A;  5DQW A;  2K5B B;  2Y54 A;  2L8K A;  4O4J E;  3U78 A;  1WCR A;  4X65 T;  5IUX A;  4QAC A;  4HN9 A;  4OK0 A;  3L3P A;  3U8M A;  1MIV A;  4EV6 A;  4B3T T;  5AQS B;  3HR0 A;  3ZEF B;  4DR4 T;  2ZM2 A;  4I43 B;  1NEN A;  2CXL A;  5J5G A;  3QUJ A;  5AQM B;  4PW8 A;  5TAO A;  3ZYL A;  2X0L B;  4TNW A;  2LM2 A;  5JR9 A;  2XJ7 A;  3ZT6 A;  3AE5 A;  1FJG T;  4OYK A;  1LVK A;  3SQ6 A;  2VKO A;  1BR0 A;  3ANW A;  5HXS A;  3HKD E;  4UM3 S;  3RH3 A;  2UUB T;  3FZH B;  4KHP T;  3VKH A;  2V1D B;  5FMN A;  4WBN E;  3WTL A;  4JI0 T;  3V5U A;  4TZ4 C;  5LP6 E;  3C98 B;  4ZRU A;  4WBO A;  4AIS A;  5AFL A;  2Q9Q A;  2KLQ A;  4U2Y A;  2DNX A;  4UVA B;  3BK9 A;  3N2K E;  2YN6 A;  2DCF A;  3AAE B;  5JDN A;  3CVR A;  5LOV E;  2BVL A;  4Z8X A;  2Y48 B;  5FXZ A;  2LRK A;  3AEG A;  2W63 A;  2LM9 A;  5AQL B;  5HWX A;  4CXW A;  2DWG A;  1M7K A;  2MBG A;  3CX8 B;  3RIU A;  4WZX A;  2D0U A;  2BYS A;  3C4W A;  3UUN A;  3KIN B;  1I9B A;  5HEU A;  3P4P A;  2JMH A;  2WWV A;  4LMJ A;  5AQT B;  1JNZ A;  2WB5 A;  3AE3 A;  2JMK A;  4LFA T;  3ZDG A;  1ZV4 X;  5L3D B;  4I0U A;  1YD8 G;  4IDQ A;  4PNI A;  4AKR B;  3F31 A;  2X51 A;  5FY0 A;  4CN4 A;  3P50 A;  4J2C A;  4ZZC A;  4O2B E;  2BKN A;  2WZH A;  4K0K T;  2CE7 A;  4IL9 A;  4HWC A;  1HF8 A;  2C9T A;  5AFH A;  4HEA A;  1IBL T;  4GK5 E;  5EK2 A;  4DV5 T;  2CLY B;  4XAX B;  3PUQ A;  4C91 A;  2LSI A;  1MIW A;  2I0M A;  4HFC A;  4UV9 B;  4YSX A;  2WCA A;  2H88 A;  4KUM B;  3KV9 A;  5ABF A;  4NXN T;  2UXD T;  1N33 T;  2FJB A;  2RP4 A;  2JRK A;  2CCQ A;  3ZKR A;  3LK3 B;  1T7S A;  5KXJ A;  2DWK A;  1AJ3 A;  2WNC A;  2A2F X;  4P1N A;  1O3X A;  3PJA A;  4TX5 A;  3SOL A;  4JEH B;  4QWN B;  5F5W A;  3CML A;  4ILU A;  5FXW A;  2XAS B;  3UU5 A;  2NR4 A;  4ZK1 A;  4YTN A;  2C5K T;  4ZI3 C;  4EED A;  2FJA A;  4DR6 T;  5AFJ A;  2PBI A;  4AFT A;  1WR6 A;  2QVA A;  2CWY A;  3BQI A;  2BYQ A;  4ZI3 D;  3PUR A;  3OVU A;  4G2A A;  5CA1 E;  5L3C B;  1R8I A;  3VU7 H;  3SH1 A;  5FXX A;  4IGU A;  2YDS A;  2CBI A;  1H7C A;  4ZZB A;  3UU6 A;  4LF6 T;  4COF A;  3RKO A;  4PK6 A;  5L4H A;  1SA0 E;  5JR9 B;  2RA1 A;  4U33 A;  2KWI B;  4DBR A;  4P0B A;  3UUB A;  2NW8 A;  3ANW B;  3KV5 A;  2BYR A;  4MLK A;  3UU8 A;  2XSB A;  3HA4 A;  3AB3 B;  2FJE A;  4PIR A;  4YTP A;  5FKY A;  4QX7 B;  2IC9 A;  2E5V A;  4IE5 A;  4YT0 A;  4X66 T;  2LJL A;  4UF0 A;  2Q9Q B;  3JCF A;  3EVY A;  5JDQ A;  1XZY A;  3ZMT B;  2YIN A;  3ETV A;  5IWA T;  2ZMA A;  3KVB A;  5AQF B;  2VL8 A;  3TLU A;  2VKJ A;  3AEA A;  3MA9 A;  2KT9 A;  3O1H A;  5LA6 E;  5HXH A;  2OV9 A;  1WFD A;  2Y58 A;  4P09 A;  1HFA A;  1X79 A;  4CZZ B;  3HKC E;  4ANJ A;  3H3A A;  3CWZ B;  4DVD A;  4UR9 A;  1WYB A;  2XQY A;  3AED A;  2UUA T;  5JQG E;  4BQT A;  2YU1 A;  3RHW A;  1M62 A;  4WW0 A;  3K3N A;  4EZH A;  4DR7 T;  4ZXL A;  4QXH B;  1WLX A;  4IT4 A;  4HE8 A;  3SWH A;  5L3E B;  5JME A;  3AAI A;  4ASK A;  5DQV A;  3PJA J;  4AKL A;  2CWO A;  4U3C A;  3ZYK A;  1UUR A;  1XNR T;  3WI3 A;  4NIQ A;  2C5J A;  5E0O A;  4EAH A;  4HFD A;  3N9L A;  4YY3 T;  2WBL A;  3RGL A;  5ABH A;  2CLY C;  4ADZ A;  4AI6 A;  2XTL A;  4HFV A;  2XM2 A;  2G0U A;  2WP9 A;  1US7 B;  4LF5 T;  1L0V A;  2HH7 A;  3AEB A;  2ZM8 A;  1NWM X;  4PJM A;  2KWH A;  3HKE E;  2JPF A;  4Z91 A;  5ABF B;  3ZJ2 A;  3WAJ A;  2XYS A;  1IAP A;  1E1H B;  1YKE B;  5L47 A;  3K1S A;  5GON E;  1W0A A;  2F4V T;  5SYO A;  5BW2 A;  2ZJU A;  2MAW A;  3ABV A;  1UK5 A;  3IHR A;  4X62 T;  4WYV A;  2V6Y A;  2LSG A;  2SPC A;  3P4Q A;  3GA8 A;  2LHR A;  3ZC1 A;  3UU3 A;  1CUN A;  2BS2 A;  2GK9 A;  2X00 D;  2ACZ A;  3N5L A;  3ZT7 A;  4L0R A;  5M4Y A;  3M3Z B;  3NRX A;  4EOZ B;  5J5H A;  2P9B A;  2XQ8 A;  2CHN A;  4AKI A;  2L3L A;  4AIU A;  5JR9 C;  1WR0 A;  2X0H A;  3IA3 A;  2MTQ A;  3QB5 K;  5J0Z A;  5H6Q B;  2JQH A;  3DJB A;  5C8Y E;  3PE0 A;  1YKH B;  3EDV A;  1BR4 A;  5JDG A;  3TLS A;  3FZK B;  4HWI B;  3IBP A;  2W66 A;  4MBQ A;  1W9R A;  5FXV A;  2NOX A;  4WNK A;  4HFB A;  4ZI2 D;  2Q9Q C;  2DL1 A;  1IBM T;  3N2G E;  1UCU A;  3FZM B;  5JTG A;  5LGT B;  2WNL A;  2BZB A;  2HHH T;  1EZ3 A;  3LK4 2;  3EAM A;  2YK0 A;  4IRE A;  2ES0 A;  2D9D A;  5CO5 A;  4ILC A;  5AQG B;  2E2A A;  4B3S T;  5KX5 E;  4I4T E;  4UF0 B;  3F2E A;  5L2L A;  2WU5 A;  5CJ5 A;  4YSZ A;  1MMN A;  3OTO T;  3VHL A;  2LOS A;  3RIU C;  2IDO B;  3KBU A;  2LT3 A;  4KP3 C;  3GUA A;  2XM1 A;  2QYW A;  5FP3 A;  3IF8 B;  4ALX A;  4GKK T;  2RPA A;  4UM3 A;  2EHO A;  3GWH A;  4NZB A;  3FB2 A;  4B3R T;  4P0A A;  4H9O C;  3ZLI A;  3ZMZ B;  4O4H E;  1OED A;  2XY8 B;  5EK3 A;  1KF6 A;  2X9H A;  4YSY A;  4DID B;  2WN9 A;  1SUM B;  5FY1 A;  5ABE A;  2J62 A;  4O2A E;  1LKX A;  2A9U A;  2QRX A;  4F8H A;  3UFE A;  1X9B A;  3CX7 B;  3FXE B;  5AFK A;  5HYA A;  2W4X A;  2KXP B;  3SQ9 A;  3GMI A;  1BR1 A;  3EI0 A;  4QH4 A;  1HR0 T;  4TN7 B;  2BBJ A;  4UXU A;  1G8X A;  5AIN A;  5L3F B;  2N2N A;  3K8P C;  5HXR A;  1S35 A;  4YXD A;  2WZI A;  3WIP A;  3AE4 A;  3WTK A;  2YEV C;  3RYI E;  2XZ6 A;  2FJD A;  4QAB A;  4FJO A;  3CQG B;  4IL4 A;  4XBF B;  4LFC T;  1VRB A;  4M1P A;  1YQ3 A;  3O1J A;  3J9X 1;  2YKS A;  4X1K E;  1D0Z A;  4H63 H;  2QC1 B;  3JAD A;  1HNZ T;  5FNV E;  3P4S A;  4GOU A;  4KHZ F;  4JI2 T;  2V6Y B;  3RRW A;  4E7S A;  4MFR A;  1Z0P A;  4MAL A;  2VB6 A;  4Z90 A;  3PU3 A;  3TLW A;  2DHR A;  2JQK A;  3VR9 A;  2MOZ A;  4L9I A;  3EAB A;  4JI8 T;  1FMV A;  4H9N C;  2X67 A;  2E5L T;  4EZ1 A;  1ZKE A;  5LBM A;  4DV4 T;  4EIW A;  4ZS2 A;  1Y01 A;  4UVC B;  3OPC A;  3AEF A;  4IST A;  2BS3 A;  2D5U A;  4X1I E;  1FEW A;  3SFE A;  2XAJ B;  3CIR A;  4AFG A;  3PUS A;  2W67 A;  4EXT A;  3GN5 A;  2BYP A;  5AFU L;  4U7Y A;  3RIA A;  2BJ0 A;  5HEJ A;  2WMO A;  3BQL A;  2LEH A;  4PK4 A;  3C50 A;  4JI4 T;  2W61 A;  3M65 A;  5JRE A;  4JI7 T;  3IEE A;  4KMC A;  2NTY A;  1W09 A;  2VKH A;  2WSS V;  2KZ7 B;  4YFS A;  4JV5 T;  4BAY B;  3ZMV B;  4KBM B;  2CBJ A;  1E2A A;  3WTI A;  2E9X A;  4ZHQ E;  3PUV F;  2CXD A;  2EHO B;  4AQF A;  1N34 T;  4EGW A;  5LMU T;  3L09 A;  2XQ7 A;  3AE8 A;  2XPK A;  5AQU B;  4ZK4 A;  2YU2 A;  4DV0 T;  3A7M A;  4AKG A;  3K3Q C;  4X5T A;  5AQP B;  5LNK A;  1OED B;  3CQX C;  3PDY A;  2XQA A;  4CN1 A;  5C2T A;  1W0B A;  3RRC A;  4QXC B;  2B76 A;  3DP7 A;  2W62 A;  2LLY A;  3K3O A;  1CHU A;  3ZC0 A;  2XNV A;  3MJX A;  2ODU A;  2A3D A;  4ZEY A;  3ZJ1 A;  1HG5 A;  1MNE A;  2IUB A;  3FXD B;  2ODV A;  3MAC A;  5BMV E;  4DO0 A;  1ZEE A;  3WTH A;  2LKH A;  4AKH A;  4CI1 B;  2IML A;  2YMD A;  1T8B A;  2V7K A;  1KK7 A;  4QHO A;  2X68 A;  2B1E A;  3Q5X A;  4KX6 A;  5KE4 A;  2V5C A;  4V1A v;  3J7Y q;  4YHJ A;  4JI1 T;  1XMQ T;  4GYS A;  5L3G B;  4HWD A;  5LXB A;  1U4Q A;  1YQ4 A;  1HNX T;  2PG8 A;  2Y56 A;  1YXR A;  3N9Q A;  2YDQ A;  1MMD A;  4LMK A;  5JDM A;  4CQI A;  3C4Z A;  1DU2 A;  1I94 T;  3R6N A;  3LFM A;  4B5D A;  4JUY A;  5FVK A;  3LK2 B;  3C64 A;  2W0G A;  3AE1 A;  4DBM A;  2K24 A;  3R84 B;  4BFQ A;  5LHH B;  4UEL A;  2WQY A;  4YTM A;  2X9X A;  1OXZ A;  5AQV B;  3MK7 C;  3WTM A;  3LG7 A;  3AA1 B;  3QNU A;  4AXP A;  4IHJ E;  4ILB A;  2PGZ A;  4DUZ T;  1XDO A;  4CXX A;  4PAG A;  5LYJ E;  5FVL A;  3GN5 B;  1HX8 A;  5J2U E;  5HWY A;  4K0U A;  3T8O A;  5AQK B;  3IGQ A;  2UU9 T;  3NZP A;  3F57 A;  4DBQ A;  3NZQ A;  3A5X A;  2UUC T;  5AQR B;  3OYX A;  2IAK A;  4DR2 T;  3ZN0 B;  4ISS A;  3FBZ A;  1G73 A;  4B3M T;  1MMG A;  1HG2 A;  3PMZ A;  4C90 A;  1T72 A;  4F6R C;  1XWM A;  4PJN A;  4H9Q C;  1MIY A;  2JQQ A;  3PTR B;  4EYU A;  3Q5E A;  2EHO C;  4PFP A;  3CQC B;  2MYS A;  2CRB A;  4HTE A;  5LXT E;  4HWH A;  4DR3 T;  4JEU B;  5AQQ B;  4LF9 T;  3U8N A;  2E9X B;  2XAF B;  1OED C;  4GIW A;  3RLF F;  3ZMS B;  3UUL A;  1IBK T;  2WNJ A;  3O9X A;  2WDV A;  2NTX A;  4H9S E;  2ZM0 A;  3RIF A;  1HNW T;  5A1L A;  4A5X A;  3C79 A;  4H63 V;  2XQ6 A;  1QSD A;  5J1G A;  4JI6 T;  1WRD A;  4DUY T;  2LRL A;  1VCS A;  2BBH A;  3RF1 A;  5FYM A;  1FMW A;  3T1Y T;  3VRB A;  3AA6 B;  4EYY R;  2WZY A;  3PV0 F;  5EZY E;  3N9N A;  2I6H A;  3OYZ A;  5HXC A;  1QLB A;  3UUM A;  3OJA A;  3SRZ A;  4XHE A;  5LJM A;  4JBW F;  5KZU A;  4PFO A;  5TVC A;  2HPJ A;  2XAG B;  1GQE A;  3O4X E;  4DV2 T;  3CPZ A;  4NUU A;  3P7I A;  1KEY A;  2UXB T;  2YME A;  3BQK A;  4IDO A;  4WV9 A;  3ZCJ A;  2R6G F;  4PJL A;  4EEB A;  5CA0 E;  1UV6 A;  2BKO A;  3PUG A;  4BJN A;  2Q9Q D;  5HCJ A;  4LF7 T;  5AFN A;  3X1D A;  2A72 A;  2NW9 A;  3Q5W A;  3P4R A;  2VAS A;  2XQ9 A;  1D0Y A;  5LCY A;  3ZDH A; 
#chains in the Genus database with same CATH homology
 4Z90 A;  5J5H A;  4COF A;  1OED A;  2XQ8 A;  3TLW A;  1UX2 A;  2XNT A;  5JME A;  2BYN A;  4IL9 A;  3EHZ A;  2UZ6 A;  4UM3 S;  5J5I A;  5L4H A;  2ZJV A;  1OED E;  4LMK A;  4TWF A;  5LG3 A;  5AFM B;  2XQ7 A;  3WTL A;  2C9T A;  2BG9 A;  4HFD A;  2Y7Y A;  5AFH A;  5J0Z A;  4ZK4 A;  2M6B A;  3U8N A;  2W8G A;  3SQ6 A;  3UUB A;  4QAA A;  4EZ1 A;  4X5T A;  2WN9 A;  1OED C;  4UM3 P;  3U8L A;  1OED B;  4ZRU A;  2XQA A;  5AFL A;  2BYR A;  4FRR A;  4B5D A;  2WNJ A;  2XQ4 A;  3UU8 A;  3TLT A;  4F8H A;  2W8F A;  3U8J A;  3TLS A;  4HFC A;  2YN6 A;  5BRX A;  2LLY A;  3RIF A;  3UQ4 A;  2XNU A;  3JAF A;  2YOE A;  5FJV A;  2XNV A;  2BG9 C;  4PIR A;  4DBM A;  5AFK A;  2BG9 B;  5HCM A;  3C79 A;  5J5F A;  2KSR A;  2XQ6 A;  4XK9 A;  4HQP A;  4HFE A;  4ILA A;  4ZJT A;  2M6I A;  4BFQ A;  4HFB A;  2X00 A;  3SQ9 A;  2PH9 A;  3EI0 A;  4QH4 A;  3WTJ A;  4A98 A;  4AFH A;  3P4W A;  2XZ5 A;  2WNL A;  4UXU A;  3WTO A;  4TWH A;  3U8K A;  2BR8 A;  4NPP A;  4TWD A;  2WZY A;  3ZKR A;  3WTH A;  4AFG A;  5AIN A;  3WTM A;  2LKH A;  2Y54 A;  3EAM A;  2BYP A;  5HEO A;  2YMD A;  4Z91 A;  2WNC A;  2XYS A;  5CFB A;  4IRE A;  5CO5 A;  4ILC A;  3C84 A;  4XHE A;  2BYS A;  3RIA A;  5IUX A;  3TLU A;  2BJ0 A;  3WIP A;  3SIO A;  4QAC A;  3RI5 A;  5KZU A;  5L47 A;  5HEH A;  5TVC A;  3LSV A;  3WTK A;  5HEJ A;  1I9B A;  3U8M A;  4UY2 A;  4ILB A;  3UU5 A;  2PGZ A;  4A97 A;  2XZ6 A;  3JAE A;  2LKG A;  5HEU A;  4ZJS A;  5SYO A;  5KE4 A;  4ZK1 A;  2Y58 A;  5BW2 A;  4QAB A;  4LML A;  2ZJU A;  2YME A;  5L4E A;  2XQ3 A;  4LMJ A;  2MAW A;  4TNV A;  5AFJ A;  4WV9 A;  3TLV A;  3PEO A;  4AFT A;  4IL4 A;  1UV6 A;  3IGQ A;  3UU4 A;  5J5G A;  3WTN A;  4HFH A;  5HCJ A;  5AFN A;  2VL0 A;  2BYQ A;  3GUA A;  3UQ7 A;  4UM1 A;  4QH5 A;  4BQT A;  4D01 A;  3ZDG A;  5HEG A;  1UW6 A;  2BR7 A;  4ALX A;  4ZR6 A;  4TNW A;  2XYT A;  3RQU A;  2YKS A;  2XQ9 A;  4UM3 A;  5BP0 A;  3RHW A;  3SH1 A;  2QC1 B;  3PMZ A;  3UU3 A;  2LM2 A;  3P50 A;  5LXB A;  3JAD A;  4NZB A;  2X00 D;  4HFI A;  2Y57 A;  4ZZC A;  5AFM A;  3RQW A;  2BG9 E;  3ZDH A;  3T4M A;  4ZZB A;  3UU6 A;  3WTI A;  2Y56 A;  2XQ5 A;  4QH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...