5L4EA

X-ray structure of the 2-22' locally-closed mutant of glic in complex with thiopental
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
source organism Gloeobacter
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 89
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l4eA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l4eA01
2W8GA 5L47A 3ZDHA 4HFBA 3PEOA 3P4WA 3TLTA 4WV9A 2XQ5A 5AFJA 5JMEA 2YOEA 2XQ3A 2XNVA 3WTHA 3WTNA 4BQTA 2BJ0A 3WTJA 3SQ6A 4EZ1A 2WNLA 3IGQA 4IL4A 3TLWA 4AFHA 3TLVA 4D01A 3RI5A 3JAFA 4ILCA 5CO5A 2Y58A 3ZKRA 3C79A 5IUXA 2X00A 4TNVA 2M6IA 4TNWA 3U8JA 3RQWA 4HQPA 2W8FA 2YKSA 3U8KA 4UY2A 4TWHA 2XQ8A 5HEUA 4UM3P 2BR7A 3WIPA 2Y56A 2Y57A 4UM3A 5AFMB 4LMKA 3RQUA 2XYSA 4NZBA 2XQ4A 4AFTA 4UM3S 5HEJA 2XNUA 2WZYA 4QH5A 3WTIA 5HCMA 4XK9A 2YMDA 2XQ9A 4QH1A 5L4EA 4UXUA 2XZ5A 4HFIA 3C84A 2BYSA 3UU3A 4ZJTA 3TLSA 2XQ7A 4TWFA 2BYPA 2YN6A 3JADA 2BG9C 4HFCA 4ZR6A 4ALXA 2WN9A 5KE4A 2WNJA 3GUAA 3WTOA 1OEDA 2QC1B 4TWDA 3RHWA 2LKHA 4COFA 4ZZCA 2UZ6A 2M6BA 2Y54A 3TLUA 3SIOA 3EI0A 1OEDC 2Y7YA 2C9TA 3LSVA 3UQ7A 1UW6A 4B5DA 5BP0A 3PMZA 4HFDA 4F8HA 1UX2A 4HFEA 5KZUA 2ZJVA 3WTMA 3UU6A 3RIFA 3WTKA 5AFNA 2BYRA 4QH4A 4LMLA 2BR8A 2XNTA 5SYOA 2VL0A 4ZK1A 2LKGA 4UM1A 4QAAA 4ZZBA 5CFBA 3ZDGA 5AFMA 5AINA 4QABA 3EHZA 4PIRA 4FRRA 4Z91A 2BG9E 5J5GA 2LLYA 5HEGA 4A97A 5LG3A 4Z90A 4ZJSA 1OEDE 5TVCA 3RIAA 2XQ6A 3JAEA 4LMJA 4NPPA 4IL9A 2PGZA 2BYNA 2ZJUA 1UV6A 5BW2A 3UQ4A 4IREA 4ILAA 2WNCA 3SH1A 4ZK4A 5AFLA 4QACA 3T4MA 3U8NA 2BG9B 5J5HA 2LM2A 4HFHA 4A98A 3WTLA 5HCJA 3EAMA 5LXBA 2MAWA 2PH9A 5AFKA 5HEHA 2KSRA 2XYTA 2YMEA 5J0ZA 2XZ6A 2XQAA 2BYQA 4DBMA 5J5FA 3UU5A 4ILBA 3UU4A 5HEOA 4X5TA 5J5IA 5AFHA 2BG9A 3P50A 4BFQA 1I9BA 4AFGA 5L4HA 4XHEA 5FJVA 3SQ9A 3U8MA 3UU8A 2X00D 1OEDB 3U8LA 3UUBA 4ZRUA 5BRXA
chains in the Genus database with same CATH superfamily
3ZDHA 5H6QB 4DO0A 4HWFA 2X68A 4QX7B 1LKXA 2KWIB 3RPUA 4DMWA 5FVLA 4O4JE 4X64T 2YKSA 3U8KA 5LMUT 5JR9A 2Y56A 4EV6A 3SRZA 2XQ4A 3KV6A 4BJNA 2XQ9A 4JI2T 2XZ5A 3UU3A 3OYXA 4EYYR 3CX7B 2YN6A 4QXHB 1N34T 2BBJA 3AA1B 3B57A 3I0OA 2Q9QD 1WR0A 5JDQA 1MMAA 2D9DA 2L9QA 4ZHQE 2Q9QB 3KBUA 3FBLA 1NWMX 5AQNB 3FB2A 2FUPA 4DR1T 1IJ5A 5AQFB 4AQFC 2IMLA 3P4RA 2YU2A 5AINA 3T8OA 3NZQA 3ZJ1A 2UXCT 2K5BB 2W63A 4ZI3C 3UQ4A 5L3FB 2V7LA 2IHR1 2BG9B 2VKJA 1Y64B 2FBWA 3PUYF 4B3TT 4HGAA 4X1KE 2PH9A 5ABHA 5AQKB 2G0UA 4JYAT 4BFQA 2XSAA 1W09A 2LSJA 2C5KT 3PURA 1IBLT 5KMGP 2VB6A 2BJ0A 2FJDA 4HEAA 5TAOA 4AFHA 2WWVA 2NTYA 4UF0B 2A72A 5LYJE 4ASKA 5FNVE 2E9XA 4J2CA 3JC6D 2FJEA 4DV2T 4NUUA 5AQHB 1D0XA 2V6YA 2XSBA 3AE3A 3C4WA 3ZYKA 2LSYA 3I1AA 4YHHT 4EOZB 4ADZA 1HCIA 4TWFA 2BYPA 2BG9C 4AISA 2OA5A 3GUAA 4QX8B 2M6BA 3EDVA 1MMGA 4DBQA 2I59A 2VQFT 4OX9T 3FZMB 1UX2A 4V1Av 4O4HE 3D0TA 1AJ3A 5KXJA 3FXDB 3OBVE 2C5IT 2DWKA 2A2FX 4H63H 5HYAA 3ONLC 5LG4A 2VVNA 5J5HA 4HFHA 3N5LA 4DVDA 3LK2B 1X79A 2YMEA 2RA1A 5DQVA 2XQYA 4YT0A 2XM2A 3HKEE 4IDOA 3RYIE 2CPTA 3CPZA 2XPKA 2EHOC 4X1YE 1BR0A 2GK9A 2YINA 5GONE 3RGLA 3AE7A 1XMOT 4HQPA 2ACZA 2DHRA 2V7JA 2BR7A 2H3RA 4B3RT 2CWYA 2N9DA 4HWCA 4UM3A 3IA3A 3QUJA 4AKRB 3LDQB 5AQOB 4LFCT 4XK9A 4HN9A 3CIRA 2OV9A 3ZC0A 4IE4A 2WNJA 2VASA 1J5WA 2CLYB 3RHWA 2LKHA 3RIUC 4ZZCA 4AQYT 2ES0A 1YKEB 4BAYB 2I0MA 4HFDA 2NW8A 5C8YE 1HTJF 2H89A 2ZJVA 1US7B 1WFDA 5AFNA 2JMKA 4YSZA 2KMFA 3IF8B 2VL0A 4EEBA 4CN6A 2DLRA 3L3PA 4QABA 2CEAA 5LG3A 2HPLA 3KV5A 2BYNA 3HKCE 1XNQT 3SH1A 3AVSA 4UV9B 3V5SA 2BKNA 4LF5T 5A1LA 4XAXB 3KBTA 5LJMA 3N9PA 4K0UA 4B3MT 2K24A 4O4IE 2HN1A 2PTFA 2X00D 3L39A 3ZMTB 3LJCA 1D0YA 2CA5A 3O1HA 4HFBA 5HXHA 2XQ5A 2YOEA 3AE4A 1KK7A 4UIGA 1IBKT 3K1SA 4O2AE 3P4QA 2YDRA 3QOFA 2WZHA 4ZI2C 3F31A 3VKHA 5CO5A 1VCSA 3CWZB 4DV4T 5JDMA 4Z8XA 4YJ3E 1ZOYA 2BS2A 4ERRA 4TWHA 2EHOD 4F6RC 3CQGB 1HR0T 2H7OA 5ABFA 3N2GE 3V5UA 3KVAA 5HEJA 5FVKA 3AECA 1D1CA 3KV4A 4IDPA 4UXUA 5C2TA 1VOMA 3I0QA 2XM1A 3JADA 3OPCA 2WN9A 4X20E 1MMNA 4JI8T 3UQ7A 4B5DA 2XJ7A 3BQIA 1CUNA 4FJOA 3T1YT 3UU6A 2HHHT 3B13A 4ILUA 2A3DA 1YW0A 4UM1A 2BKPA 2CCQA 2WBLA 5HWYA 5CFBA 1XMQT 1QUUA 2LLYA 3CVRA 2V6XA 1SE7A 3RRWA 1IJ6A 1LRZA 5EK3A 3GN5A 2LEHA 3R6NA 5AFLA 4QACA 2BBHA 4E7ZA 2ZM0A 4NXMT 4LFAT 2W00A 2CE7A 2J62A 5HEHA 5JRCA 3ONXA 5AQVB 5J0ZA 1MIWA 3MZKB 3UU5A 3NVOA 2HH7A 2UUAT 2K48A 4XHEA 5FJVA 5LCYA 4O2BE 3VHLA 1T7SA 1WYCA 4EXTA 2WY2A 3K3NA 2X9XA 3RC3A 2BKOA 4IGUA 3FZFB 5LB7B 3I9YA 4U2YA 3AE1A 4MFRA 3ZT6A 3GN5B 2ZM8A 1V9DA 3MXZA 5LMNT 4ZS3A 2XAFB 3O1IA 3N9MA 2W4XA 4QH5A 1NAFA 4CI1B 2XAGB 2IC6A 4XZCA 4HFIA 4LF7T 1QLBA 2H88A 2YDSA 4C91A 2KLQA 2UZ6A 1GQEA 3TLUA 3PUWF 4IE5A 3RIUA 2YU1A 3C50A 4LF6T 3F57A 2XHEB 1Z8UA 4HE8A 3ZPOA 4TX5A 4C90A 2ZM6T 4JV5T 1L0VA 3T1HT 4ZOLE 4IE0A 3RIAA 4HFVA 3OYZA 4JUYA 2W0GA 4EGWA 5JDHA 1UV6A 2V7IA 2LJLA 4ZK4A 5FXWA 2KWHA 4X1IE 3N9NA 4JEUB 3ZN1B 5LXBA 2V7KA 2J1DG 2X51A 3BK9A 2MAWA 2SPCA 2ZM2A 4ILBA 4YJ2E 5AFUL 5JDLA 2BG9A 3PV0F 3NKZA 4AFGA 4OFZA 4ZRUA 3AXJB 2XUEA 2X9WA 4DR2T 3OKQA 3SQ6A 4PFPA 5F8PA 4JBWF 3CQXC 4PJMA 4CN1A 2W67A 1T98A 1QSDA 3AAAB 5AQIB 2IW5B 3O4XE 5BR8T 2MTQA 1WRDA 2UXBT 5FXXA 5L4EA 1I94T 1FMWA 3AE8A 3AB3B 5EZYE 2V6YB 2VK9A 3UUNA 3HL6A 1IBMT 3WI3A 4PK4A 1ZEEA 4I4TE 2XNTA 5AQTB 3AE5A 4BA9A 3RC8A 4ZZBA 3NBXX 3EHZA 4NIQA 4X66T 4HWHA 3K3OA 2WMOA 3X1DA 2UXXB 4KHZF 3KVBA 4TN7B 2Y48B 3AEFA 4GK0E 2MPKA 4P1NA 4OYJA 3FHNA 5L3EB 3ZCJA 2WP9A 3A7MA 2JQHA 2XZ6A 3GMIA 3ZYMA 2OLTA 2J4GA 5L3GB 1YKHB 3UU8A 5JR9B 1N33T 2MYSA 2W61A 3IHRA 1XDPA 3WTHA 3L09A 2B1EA 2EHOB 3TLVA 2LSKA 4A5XA 5JTGA 2VURA 4B6XA 3U8JA 4U7YA 4DMVA 2W8FA 1S94A 3DTOA 3MACA 4LMKA 5C3JA 2NOXA 5LJNA 4H63V 2PG8A 2NP9A 3WTOA 1HNZT 1UCUA 4COFA 2BS3A 3A8YC 2Y54A 3SIOA 1SHZC 3PMZA 3QNUA 5DJQC 3N2OA 2I6HA 4QH4A 2CXDA 2QRXA 4U72A 1FJGT 2WMNA 4QAAA 5AFMA 1YXRA 2QA7A 4UVBB 4DV6T 3OVUA 5LNKA 3PUGA 1MNEA 4YXDA 4DR3T 3OJAA 4A56A 3FZKB 3ZEFB 4PW8A 1MMDA 3FZHB 5AFKA 2YK0A 2E9XC 2IAKA 2D0TA 1WYBA 2JPFA 2X66A 4H9RC 2WQYA 4EEDA 1U4QA 5JMEA 3WTNA 3Q2MA 5ADXL 2WU2A 4ISSA 3KFWX 4DNDA 1VRBA 2CBIA 1Z0PA 2M67A 2XQ8A 3N9QA 4YSXA 5AQLB 1E2AA 4DV5T 3RQUA 1KEYA 5HXSA 1LVFA 3WTIA 2Q9QC 1MNDA 1H7CA 1UUSA 4QKNA 2BYSA 1S35A 3TKLB 5ABEA 3LG7A 5J2TE 5CGMA 2LHRA 1UW6A 4U33A 5KZUA 3WTMA 4ANJA 3WTKA 4AXPA 2LHNA 4JI0T 4LF9T 3ZDGA 2UU9T 2BG9E 5LHIB 3AEGA 2E5LT 3ZT5A 4AKIA 2WCAA 2IC9A 4P0BA 3UTKA 5LHHB 4IDQA 2X67A 4H9QC 3G06A 2V5DA 4UV8B 2XQAA 1VCTA 3ZC1A 1HG2A 5J5FA 3ZJ2A 4CN4A 3PDYA 5KX5E 3SQ9A 3U8LA 3LFMA 4DR7T 2NR4A 5IWAT 2UXDT 2WNLA 4IT4A 3UFEA 2FJBA 4D01A 3QK6A 5ETWA 5LGUB 3C4ZA 3ZKRA 5AQUB 5LBMA 4GOUA 4TNVA 1BR2A 3C98B 2VKOA 5LHGB 5LP6E 2P9BA 4JI3T 2XYSA 3ESLA 2XAQB 3QB5K 5F3JA 2XQ7A 3SS1A 3PTRB 4FI5A 5JREA 2C9TA 4I0UA 4F8HA 5EK4A 3ZN0B 2ACXA 4JI6T 1UX5A 1UK5A 3RKGA 1HX8A 5FKYA 5AQGB 3P8CD 1KFYA 2E8IA 4L9IA 2HN2A 5TVCA 4AKGA 4NPPA 2YEVC 2WNCA 3T4MA 2ODVA 1U5PA 3EVYA 3EAMA 3AE6A 2WDVA 3M65A 2KSRA 2XYTA 3C51A 2WU5A 3ZMUB 2RPAA 3UU4A 4ZI7E 1Y01A 4KX6A 1X9BA 3AEDA 2W8GA 3PUSA 3SFEA 2AXDS 2WDQA 2CWOA 2BS4A 2UUBT 4JI5T 4KHPT 4AIUA 3H3AA 4ILCA 1G8XA 2Y58A 2PBIA 4WBNE 2M6IA 3RQWA 3LK42 2NW7A 1ZKEA 4YY3T 4YFSA 2EHOA 4NZBA 4PJLA 5FXZA 1KNRA 2FJAA 4H9SE 5LGNB 1UURA 2WB5A 3AAIA 4I43B 4U7IA 2UXNB 4MLKA 2Y7YA 2AE9A 4EB6E 3LSVA 2C5JA 3PUAA 4G2AA 2WS3A 2B76A 4X62T 4PK6A 3AEEA 2DWGA 3U78A 4YTPA 3E0ZA 2BYRA 2BR8A 5CJ5A 4HWDA 4WNKA 2WWUA 2D5UA 2LSIA 4YLHA 5BW2A 2WDRA 3Q5XA 3RH3A 3U8NA 3ABVA 3N2KE 1ZV4X 4ZI3D 3IEEA 5H6RB 3BQLA 2BYQA 3KV9A 5HEOA 3RF1A 3MKDA 5IYZE 3U8MA 3N9LA 4UXNB 5CB4E 5L47A 4WZXA 2LSGA 3M3ZB 3AA0B 3HKDE 3Q9DA 4IL4A 4KMCA 2NWBA 3PUVF 2VWAA 3O1JA 2HPJA 5J1GA 3UULA 4JI7T 4DV1T 4LF8T 4UM3P 2IIUA 4HWIB 1KNPA 5HWXA 2K3WA 5F5WA 4EZ4A 3EDUA 4WYVA 3TLSA 4ALXA 5JVDE 4IE7A 2DL1A 4YTMA 1J1JA 2VKDA 4UF0A 1OWAA 5BMVE 4HFEA 4ZEYA 5JR9C 3PUXF 3CK6A 3FZLB 3P4PA 4EYUA 3ETVA 3JCFA 3RYFE 3HKBE 3O9XA 4Z90A 3Q5WA 2XASB 2LE8A 3PU3A 2PGZA 2W66A 2UUCT 4IHJE 5L3BB 1YD8G 3ZSSA 3ZYLA 1D1BA 4DUYT 2JIWA 4A98A 5HCJA 2V26A 2LT3A 2DCFA 2Q9QA 3AEBA 1BR4A 4TV8E 1YQ4A 2CBJA 3AEAA 4DBMA 2KXPB 5E0OA 5FY7A 2LOPA 5AFHA 4OK0A 2V1DB 1I9BA 1DU2A 5L2LA 1OEDB 1MIVA 5LA6E 2E9XD 1EZ3A 3ANWB 2KINB 3TLTA 4WV9A 4I50E 2JQKA 4EZ1A 3VRBA 2JMHA 4TV9E 2LM9A 3SFDA 2X0HA 3C79A 2VKHA 4QXBB 4HKAA 4AFTA 1UGOA 5HCMA 4DR5T 2YMDA 3DP7A 4GK5E 4GYSA 4ZJTA 1OEDA 2CM0A 4GIWA 3EI0A 2VQET 5ABFB 3KINB 4U74A 3UFGA 4E7SA 3PU8A 4QWNB 4U2ZA 5IHYA 3RIFA 2V5CA 2H7VC 5FXVA 5LOVE 3AAEB 2VL8A 2XZEA 5J5GA 4PFOA 4A97A 2Y8DA 5ABGA 4DIDB 2RP4A 4IL9A 2ZJUA 1ZP0A 4IREA 4ILAA 1M62A 3AE9A 3EUHA 1HNXT 5EK2A 4G63A 2JRKA 3VRAA 4DV3T 3HR0A 4AQGA 2W2UA 4JI1T 5JDFA 3ZT7A 4X5TA 4CQIA 1W0BA 4P0AA 1N36T 3IBPA 3DJBA 4MHCA 2KZ7B 3IGQA 4KI0F 5FY1A 3UT5E 5HXCA 2XTLA 3RRCA 3UUMA 3ZMVB 3VR8A 5HXRA 3K3QC 5DABA 4CZZB 2E5VA 2Y57A 5JDGA 1HS7A 4UM3S 4JI4T 4AKHA 2WZYA 1T8BA 3AA7B 4GYRA 2C0SA 3ZMZB 3GWHA 1E1HB 5KE4A 2QC1B 4KUMB 4TWDA 4IE6A 3P7IA 4OHFA 4UEMA 4H9NC 4WW0A 4DUZT 5L3CB 3UUXB 4H9OC 1HG5A 1XDOA 2W62A 3J9X1 4LMLA 5SYOA 3MJXA 4ZK1A 1HNWT 1O3XA 4NXNT 4TUYE 4FRRA 4Z91A 2V7MA 3C4XA 2CXLA 4YTNA 3Q5EA 2F4VT 1CHUA 1WCRA 4U3CA 1HFAA 4QXCB 3E08A 3LK3B 4ZXLA 4PJJA 5DQWA 1NEKA 3NRYA 3CKDA 5FL1A 5J5IA 3WAJA 5M4YA 3QC9A 4KBMB 2Y6XA 2WSSV 4IDZA 4I55E 4N78D 4JEHB 4ZS2A 3PEOA 3P4WA 2E9XB 3NZPA 5AFJA 4AQFA 3VKGA 3AE2A 2XAJB 2ODUA 3JAFA 3PE0A 1HF8A 3R84B 5AQQB 2CHNA 2L8KA 3I9WA 3PJAA 1W9RA 1UX4A 3LBXA 1WR6A 5HEUA 3WIPA 4EAHA 4DV0T 5AFMB 4IDNA 1OXZA 4ISTA 4X65T 4QH1A 3AA6B 3JC6C 4EZHA 3CX6B 3MA9A 2NTXA 2ZMAA 1IZNB 4H9PC 2D2SA 4XBFB 3ZLIA 2BVMA 1FMVA 5FMNA 1OEDC 3GA8A 3PUQA 2Z6EA 3HA4A 4WBOA 4UVAB 5AQPB 4KP3C 2NW9A 3QB5A 3ZMSB 2BZBA 1R8IA 2K9AA 3NWIA 5AQSB 3P4SA 3NRXA 3F2EA 3J7Yq 1JNRA 2LRKA 5J2UE 3JAEA 3Q5DA 2CHOA 3BQKA 1WLXA 2CLYC 2LOSA 3OTOT 3B5MA 2BVLA 2QYWA 4CXYA 4DR4T 1M7KA 1G73A 4CXXA 4YHJA 1JNZA 1N32T 4HTEA 3VR9A 4M1PA 1FEWA 3HI2A 3P50A 2KNDA 2DNXA 4L0RA 4CI3B 2XNVA 4PJNA 4BQTA 3WTJA 4EIWA 2BDEA 1IAPA 3RI5A 5JRCB 3N9OA 4DBRA 3PUZF 1SUMB 4UVCB 5IUXA 2X00A 4TNWA 4TZ4C 2IDOB 3ANWA 4MALA 4DV7T 4ZI2D 4UY2A 5FP3A 2E2AA 2WAUA 3KDSE 4Q25A 3FXEB 3CMLA 3SWHA 2X9HA 2QGSA 2XNUA 2N1GA 4LFBT 3C84A 1W0AA 3ZCIA 4QHOA 4HFCA 5HXEA 3CX8B 5KDMC 3ETUA 3SOLA 2MOZA 1KNZA 3FBZA 2D0UA 2XAHB 2CMRA 1ZHCA 2ZLYA 2L3LA 4CI2B 3K8PC 4UR9A 5JDNA 4CXWA 1OEDE 3RYHE 4LMJA 4BJMA 4GKKT 2JQ9A 2V8SV 4AI6A 5HAXA 1XWMA 2KT9A 4YSYA 3RYCE 4GKJT 2A9UA 1FIOA 2WZIA 3MK7C 2X9YA 4JLEA 2QVAA 3RKOA 3EABA 2J47A 2PJQA 5L4HA 1BR1A 2VVSA 1NENA 4UELA 4PAGA 3UUBA 2PFVA 5CA1E 5JH7E 2XQ3A 2MBGA 5FY0A 3TLWA 4MBQA 3VU7H 2CXFA 4IIJE 1YQ3A 1J5ET 1XZYA 1KF6A 5FL0A 1D1AA 5CA0E 4U31A 3LBXB 4PK5A 3WAKA 5L3DB 4LF4T 2JJ9A 1MIYA 4L5GA 1I6ZA 3AVRA 3AXJA 4ZR6A 3PJAJ 1SA0E 4P09A 2R6GF 5BP0A 5LGTB 3E22E 5LBQB 3H37A 2N2NA 2WM9A 3A5XA 5AQRB 3S4UA 2XY8B 3U3IA 4B3ST 5LXTE 2LKGA 4O8SA 1D0ZA 2X0LB 2LRLA 5JQGE 4NUVA 4PIRA 2DI4A 5HEGA 5FYMA 4ZJSA 3H3MA 5AQJB 2XQ6A 3CQCB 4PNIA 4AKLA 1T72A 4OYKA 3ZSTA 3ONJA 3W15B 1LVKA 2LM2A 3RX6A 4K0KT 3WTLA 2YDQA 3C64A 1XNRT 5AQMB 1B7TA 1HX1B 3L8RA 2JQQA 2CRBA 4O4LE 3RLFF 1E7PA 2X0YA 4DR6T 2IUBA 5BRXA
chains in the Genus database with same CATH topology
2W8GA 5L47A 3ZDHA 4HFBA 3PEOA 3P4WA 3TLTA 4WV9A 2XQ5A 5AFJA 5JMEA 2YOEA 2XQ3A 2XNVA 3WTHA 3WTNA 4BQTA 2BJ0A 3WTJA 3SQ6A 4EZ1A 2WNLA 3IGQA 4IL4A 3TLWA 4AFHA 3TLVA 4D01A 3RI5A 3JAFA 4ILCA 5CO5A 2Y58A 3ZKRA 3C79A 5IUXA 2X00A 4TNVA 2M6IA 4TNWA 3U8JA 3RQWA 4HQPA 2W8FA 2YKSA 3U8KA 4UY2A 4TWHA 2XQ8A 5HEUA 4UM3P 2BR7A 3WIPA 2Y56A 2Y57A 4UM3A 5AFMB 4LMKA 3RQUA 2XYSA 4NZBA 2XQ4A 4AFTA 4UM3S 5HEJA 2XNUA 2WZYA 4QH5A 3WTIA 5HCMA 4XK9A 2YMDA 2XQ9A 4QH1A 5L4EA 4UXUA 2XZ5A 4HFIA 3C84A 2BYSA 3UU3A 4ZJTA 3TLSA 2XQ7A 4TWFA 2BYPA 2YN6A 3JADA 2BG9C 4HFCA 4ZR6A 4ALXA 2WN9A 5KE4A 2WNJA 3GUAA 3WTOA 1OEDA 2QC1B 4TWDA 3RHWA 2LKHA 4COFA 4ZZCA 2UZ6A 2M6BA 2Y54A 3TLUA 3SIOA 3EI0A 1OEDC 2Y7YA 2C9TA 3LSVA 3UQ7A 1UW6A 4B5DA 5BP0A 3PMZA 4HFDA 4F8HA 1UX2A 4HFEA 5KZUA 2ZJVA 3WTMA 3UU6A 3RIFA 3WTKA 5AFNA 2BYRA 4QH4A 4LMLA 2BR8A 2XNTA 5SYOA 2VL0A 4ZK1A 2LKGA 4UM1A 4QAAA 4ZZBA 5CFBA 3ZDGA 5AFMA 5AINA 4QABA 3EHZA 4PIRA 4FRRA 4Z91A 2BG9E 5J5GA 2LLYA 5HEGA 4A97A 5LG3A 4Z90A 4ZJSA 1OEDE 5TVCA 3RIAA 2XQ6A 3JAEA 4LMJA 4NPPA 4IL9A 2PGZA 2BYNA 2ZJUA 1UV6A 5BW2A 3UQ4A 4IREA 4ILAA 2WNCA 3SH1A 4ZK4A 5AFLA 4QACA 3T4MA 3U8NA 2BG9B 5J5HA 2LM2A 4HFHA 4A98A 3WTLA 5HCJA 3EAMA 5LXBA 2MAWA 2PH9A 5AFKA 5HEHA 2KSRA 2XYTA 2YMEA 5J0ZA 2XZ6A 2XQAA 2BYQA 4DBMA 5J5FA 3UU5A 4ILBA 3UU4A 5HEOA 4X5TA 5J5IA 5AFHA 2BG9A 3P50A 4BFQA 1I9BA 4AFGA 5L4HA 4XHEA 5FJVA 3SQ9A 3U8MA 3UU8A 2X00D 1OEDB 3U8LA 3UUBA 4ZRUA 5BRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8G A;  5L47 A;  3ZDH A;  4HFB A;  3PEO A;  3P4W A;  3TLT A;  4WV9 A;  2XQ5 A;  5AFJ A;  5JME A;  2YOE A;  2XQ3 A;  2XNV A;  3WTH A;  3WTN A;  4BQT A;  2BJ0 A;  3WTJ A;  3SQ6 A;  4EZ1 A;  2WNL A;  3IGQ A;  4IL4 A;  3TLW A;  4AFH A;  3TLV A;  4D01 A;  3RI5 A;  3JAF A;  4ILC A;  5CO5 A;  2Y58 A;  3ZKR A;  3C79 A;  5IUX A;  2X00 A;  4TNV A;  2M6I A;  4TNW A;  3U8J A;  3RQW A;  4HQP A;  2W8F A;  2YKS A;  3U8K A;  4UY2 A;  4TWH A;  2XQ8 A;  5HEU A;  4UM3 P;  2BR7 A;  3WIP A;  2Y56 A;  2Y57 A;  4UM3 A;  5AFM B;  4LMK A;  3RQU A;  2XYS A;  4NZB A;  2XQ4 A;  4AFT A;  4UM3 S;  5HEJ A;  2XNU A;  2WZY A;  4QH5 A;  3WTI A;  5HCM A;  4XK9 A;  2YMD A;  2XQ9 A;  4QH1 A;  5L4E A;  4UXU A;  2XZ5 A;  4HFI A;  3C84 A;  2BYS A;  3UU3 A;  4ZJT A;  3TLS A;  2XQ7 A;  4TWF A;  2BYP A;  2YN6 A;  3JAD A;  2BG9 C;  4HFC A;  4ZR6 A;  4ALX A;  2WN9 A;  5KE4 A;  2WNJ A;  3GUA A;  3WTO A;  1OED A;  2QC1 B;  4TWD A;  3RHW A;  2LKH A;  4COF A;  4ZZC A;  2UZ6 A;  2M6B A;  2Y54 A;  3TLU A;  3SIO A;  3EI0 A;  1OED C;  2Y7Y A;  2C9T A;  3LSV A;  3UQ7 A;  1UW6 A;  4B5D A;  5BP0 A;  3PMZ A;  4HFD A;  4F8H A;  1UX2 A;  4HFE A;  5KZU A;  2ZJV A;  3WTM A;  3UU6 A;  3RIF A;  3WTK A;  5AFN A;  2BYR A;  4QH4 A;  4LML A;  2BR8 A;  2XNT A;  5SYO A;  2VL0 A;  4ZK1 A;  2LKG A;  4UM1 A;  4QAA A;  4ZZB A;  5CFB A;  3ZDG A;  5AFM A;  5AIN A;  4QAB A;  3EHZ A;  4PIR A;  4FRR A;  4Z91 A;  2BG9 E;  5J5G A;  2LLY A;  5HEG A;  4A97 A;  5LG3 A;  4Z90 A;  4ZJS A;  1OED E;  5TVC A;  3RIA A;  2XQ6 A;  3JAE A;  4LMJ A;  4NPP A;  4IL9 A;  2PGZ A;  2BYN A;  2ZJU A;  1UV6 A;  5BW2 A;  3UQ4 A;  4IRE A;  4ILA A;  2WNC A;  3SH1 A;  4ZK4 A;  5AFL A;  4QAC A;  3T4M A;  3U8N A;  2BG9 B;  5J5H A;  2LM2 A;  4HFH A;  4A98 A;  3WTL A;  5HCJ A;  3EAM A;  5LXB A;  2MAW A;  2PH9 A;  5AFK A;  5HEH A;  2KSR A;  2XYT A;  2YME A;  5J0Z A;  2XZ6 A;  2XQA A;  2BYQ A;  4DBM A;  5J5F A;  3UU5 A;  4ILB A;  3UU4 A;  5HEO A;  4X5T A;  5J5I A;  5AFH A;  2BG9 A;  3P50 A;  4BFQ A;  1I9B A;  4AFG A;  5L4H A;  4XHE A;  5FJV A;  3SQ9 A;  3U8M A;  3UU8 A;  2X00 D;  1OED B;  3U8L A;  3UUB A;  4ZRU A;  5BRX A; 
#chains in the Genus database with same CATH topology
 3ZDH A;  5H6Q B;  4DO0 A;  4HWF A;  2X68 A;  4QX7 B;  1LKX A;  2KWI B;  3RPU A;  4DMW A;  5FVL A;  4O4J E;  4X64 T;  2YKS A;  3U8K A;  5LMU T;  5JR9 A;  2Y56 A;  4EV6 A;  3SRZ A;  2XQ4 A;  3KV6 A;  4BJN A;  2XQ9 A;  4JI2 T;  2XZ5 A;  3UU3 A;  3OYX A;  4EYY R;  3CX7 B;  2YN6 A;  4QXH B;  1N34 T;  2BBJ A;  3AA1 B;  3B57 A;  3I0O A;  2Q9Q D;  1WR0 A;  5JDQ A;  1MMA A;  2D9D A;  2L9Q A;  4ZHQ E;  2Q9Q B;  3KBU A;  3FBL A;  1NWM X;  5AQN B;  3FB2 A;  2FUP A;  4DR1 T;  1IJ5 A;  5AQF B;  4AQF C;  2IML A;  3P4R A;  2YU2 A;  5AIN A;  3T8O A;  3NZQ A;  3ZJ1 A;  2UXC T;  2K5B B;  2W63 A;  4ZI3 C;  3UQ4 A;  5L3F B;  2V7L A;  2IHR 1;  2BG9 B;  2VKJ A;  1Y64 B;  2FBW A;  3PUY F;  4B3T T;  4HGA A;  4X1K E;  2PH9 A;  5ABH A;  5AQK B;  2G0U A;  4JYA T;  4BFQ A;  2XSA A;  1W09 A;  2LSJ A;  2C5K T;  3PUR A;  1IBL T;  5KMG P;  2VB6 A;  2BJ0 A;  2FJD A;  4HEA A;  5TAO A;  4AFH A;  2WWV A;  2NTY A;  4UF0 B;  2A72 A;  5LYJ E;  4ASK A;  5FNV E;  2E9X A;  4J2C A;  3JC6 D;  2FJE A;  4DV2 T;  4NUU A;  5AQH B;  1D0X A;  2V6Y A;  2XSB A;  3AE3 A;  3C4W A;  3ZYK A;  2LSY A;  3I1A A;  4YHH T;  4EOZ B;  4ADZ A;  1HCI A;  4TWF A;  2BYP A;  2BG9 C;  4AIS A;  2OA5 A;  3GUA A;  4QX8 B;  2M6B A;  3EDV A;  1MMG A;  4DBQ A;  2I59 A;  2VQF T;  4OX9 T;  3FZM B;  1UX2 A;  4V1A v;  4O4H E;  3D0T A;  1AJ3 A;  5KXJ A;  3FXD B;  3OBV E;  2C5I T;  2DWK A;  2A2F X;  4H63 H;  5HYA A;  3ONL C;  5LG4 A;  2VVN A;  5J5H A;  4HFH A;  3N5L A;  4DVD A;  3LK2 B;  1X79 A;  2YME A;  2RA1 A;  5DQV A;  2XQY A;  4YT0 A;  2XM2 A;  3HKE E;  4IDO A;  3RYI E;  2CPT A;  3CPZ A;  2XPK A;  2EHO C;  4X1Y E;  1BR0 A;  2GK9 A;  2YIN A;  5GON E;  3RGL A;  3AE7 A;  1XMO T;  4HQP A;  2ACZ A;  2DHR A;  2V7J A;  2BR7 A;  2H3R A;  4B3R T;  2CWY A;  2N9D A;  4HWC A;  4UM3 A;  3IA3 A;  3QUJ A;  4AKR B;  3LDQ B;  5AQO B;  4LFC T;  4XK9 A;  4HN9 A;  3CIR A;  2OV9 A;  3ZC0 A;  4IE4 A;  2WNJ A;  2VAS A;  1J5W A;  2CLY B;  3RHW A;  2LKH A;  3RIU C;  4ZZC A;  4AQY T;  2ES0 A;  1YKE B;  4BAY B;  2I0M A;  4HFD A;  2NW8 A;  5C8Y E;  1HTJ F;  2H89 A;  2ZJV A;  1US7 B;  1WFD A;  5AFN A;  2JMK A;  4YSZ A;  2KMF A;  3IF8 B;  2VL0 A;  4EEB A;  4CN6 A;  2DLR A;  3L3P A;  4QAB A;  2CEA A;  5LG3 A;  2HPL A;  3KV5 A;  2BYN A;  3HKC E;  1XNQ T;  3SH1 A;  3AVS A;  4UV9 B;  3V5S A;  2BKN A;  4LF5 T;  5A1L A;  4XAX B;  3KBT A;  5LJM A;  3N9P A;  4K0U A;  4B3M T;  2K24 A;  4O4I E;  2HN1 A;  2PTF A;  2X00 D;  3L39 A;  3ZMT B;  3LJC A;  1D0Y A;  2CA5 A;  3O1H A;  4HFB A;  5HXH A;  2XQ5 A;  2YOE A;  3AE4 A;  1KK7 A;  4UIG A;  1IBK T;  3K1S A;  4O2A E;  3P4Q A;  2YDR A;  3QOF A;  2WZH A;  4ZI2 C;  3F31 A;  3VKH A;  5CO5 A;  1VCS A;  3CWZ B;  4DV4 T;  5JDM A;  4Z8X A;  4YJ3 E;  1ZOY A;  2BS2 A;  4ERR A;  4TWH A;  2EHO D;  4F6R C;  3CQG B;  1HR0 T;  2H7O A;  5ABF A;  3N2G E;  3V5U A;  3KVA A;  5HEJ A;  5FVK A;  3AEC A;  1D1C A;  3KV4 A;  4IDP A;  4UXU A;  5C2T A;  1VOM A;  3I0Q A;  2XM1 A;  3JAD A;  3OPC A;  2WN9 A;  4X20 E;  1MMN A;  4JI8 T;  3UQ7 A;  4B5D A;  2XJ7 A;  3BQI A;  1CUN A;  4FJO A;  3T1Y T;  3UU6 A;  2HHH T;  3B13 A;  4ILU A;  2A3D A;  1YW0 A;  4UM1 A;  2BKP A;  2CCQ A;  2WBL A;  5HWY A;  5CFB A;  1XMQ T;  1QUU A;  2LLY A;  3CVR A;  2V6X A;  1SE7 A;  3RRW A;  1IJ6 A;  1LRZ A;  5EK3 A;  3GN5 A;  2LEH A;  3R6N A;  5AFL A;  4QAC A;  2BBH A;  4E7Z A;  2ZM0 A;  4NXM T;  4LFA T;  2W00 A;  2CE7 A;  2J62 A;  5HEH A;  5JRC A;  3ONX A;  5AQV B;  5J0Z A;  1MIW A;  3MZK B;  3UU5 A;  3NVO A;  2HH7 A;  2UUA T;  2K48 A;  4XHE A;  5FJV A;  5LCY A;  4O2B E;  3VHL A;  1T7S A;  1WYC A;  4EXT A;  2WY2 A;  3K3N A;  2X9X A;  3RC3 A;  2BKO A;  4IGU A;  3FZF B;  5LB7 B;  3I9Y A;  4U2Y A;  3AE1 A;  4MFR A;  3ZT6 A;  3GN5 B;  2ZM8 A;  1V9D A;  3MXZ A;  5LMN T;  4ZS3 A;  2XAF B;  3O1I A;  3N9M A;  2W4X A;  4QH5 A;  1NAF A;  4CI1 B;  2XAG B;  2IC6 A;  4XZC A;  4HFI A;  4LF7 T;  1QLB A;  2H88 A;  2YDS A;  4C91 A;  2KLQ A;  2UZ6 A;  1GQE A;  3TLU A;  3PUW F;  4IE5 A;  3RIU A;  2YU1 A;  3C50 A;  4LF6 T;  3F57 A;  2XHE B;  1Z8U A;  4HE8 A;  3ZPO A;  4TX5 A;  4C90 A;  2ZM6 T;  4JV5 T;  1L0V A;  3T1H T;  4ZOL E;  4IE0 A;  3RIA A;  4HFV A;  3OYZ A;  4JUY A;  2W0G A;  4EGW A;  5JDH A;  1UV6 A;  2V7I A;  2LJL A;  4ZK4 A;  5FXW A;  2KWH A;  4X1I E;  3N9N A;  4JEU B;  3ZN1 B;  5LXB A;  2V7K A;  2J1D G;  2X51 A;  3BK9 A;  2MAW A;  2SPC A;  2ZM2 A;  4ILB A;  4YJ2 E;  5AFU L;  5JDL A;  2BG9 A;  3PV0 F;  3NKZ A;  4AFG A;  4OFZ A;  4ZRU A;  3AXJ B;  2XUE A;  2X9W A;  4DR2 T;  3OKQ A;  3SQ6 A;  4PFP A;  5F8P A;  4JBW F;  3CQX C;  4PJM A;  4CN1 A;  2W67 A;  1T98 A;  1QSD A;  3AAA B;  5AQI B;  2IW5 B;  3O4X E;  5BR8 T;  2MTQ A;  1WRD A;  2UXB T;  5FXX A;  5L4E A;  1I94 T;  1FMW A;  3AE8 A;  3AB3 B;  5EZY E;  2V6Y B;  2VK9 A;  3UUN A;  3HL6 A;  1IBM T;  3WI3 A;  4PK4 A;  1ZEE A;  4I4T E;  2XNT A;  5AQT B;  3AE5 A;  4BA9 A;  3RC8 A;  4ZZB A;  3NBX X;  3EHZ A;  4NIQ A;  4X66 T;  4HWH A;  3K3O A;  2WMO A;  3X1D A;  2UXX B;  4KHZ F;  3KVB A;  4TN7 B;  2Y48 B;  3AEF A;  4GK0 E;  2MPK A;  4P1N A;  4OYJ A;  3FHN A;  5L3E B;  3ZCJ A;  2WP9 A;  3A7M A;  2JQH A;  2XZ6 A;  3GMI A;  3ZYM A;  2OLT A;  2J4G A;  5L3G B;  1YKH B;  3UU8 A;  5JR9 B;  1N33 T;  2MYS A;  2W61 A;  3IHR A;  1XDP A;  3WTH A;  3L09 A;  2B1E A;  2EHO B;  3TLV A;  2LSK A;  4A5X A;  5JTG A;  2VUR A;  4B6X A;  3U8J A;  4U7Y A;  4DMV A;  2W8F A;  1S94 A;  3DTO A;  3MAC A;  4LMK A;  5C3J A;  2NOX A;  5LJN A;  4H63 V;  2PG8 A;  2NP9 A;  3WTO A;  1HNZ T;  1UCU A;  4COF A;  2BS3 A;  3A8Y C;  2Y54 A;  3SIO A;  1SHZ C;  3PMZ A;  3QNU A;  5DJQ C;  3N2O A;  2I6H A;  4QH4 A;  2CXD A;  2QRX A;  4U72 A;  1FJG T;  2WMN A;  4QAA A;  5AFM A;  1YXR A;  2QA7 A;  4UVB B;  4DV6 T;  3OVU A;  5LNK A;  3PUG A;  1MNE A;  4YXD A;  4DR3 T;  3OJA A;  4A56 A;  3FZK B;  3ZEF B;  4PW8 A;  1MMD A;  3FZH B;  5AFK A;  2YK0 A;  2E9X C;  2IAK A;  2D0T A;  1WYB A;  2JPF A;  2X66 A;  4H9R C;  2WQY A;  4EED A;  1U4Q A;  5JME A;  3WTN A;  3Q2M A;  5ADX L;  2WU2 A;  4ISS A;  3KFW X;  4DND A;  1VRB A;  2CBI A;  1Z0P A;  2M67 A;  2XQ8 A;  3N9Q A;  4YSX A;  5AQL B;  1E2A A;  4DV5 T;  3RQU A;  1KEY A;  5HXS A;  1LVF A;  3WTI A;  2Q9Q C;  1MND A;  1H7C A;  1UUS A;  4QKN A;  2BYS A;  1S35 A;  3TKL B;  5ABE A;  3LG7 A;  5J2T E;  5CGM A;  2LHR A;  1UW6 A;  4U33 A;  5KZU A;  3WTM A;  4ANJ A;  3WTK A;  4AXP A;  2LHN A;  4JI0 T;  4LF9 T;  3ZDG A;  2UU9 T;  2BG9 E;  5LHI B;  3AEG A;  2E5L T;  3ZT5 A;  4AKI A;  2WCA A;  2IC9 A;  4P0B A;  3UTK A;  5LHH B;  4IDQ A;  2X67 A;  4H9Q C;  3G06 A;  2V5D A;  4UV8 B;  2XQA A;  1VCT A;  3ZC1 A;  1HG2 A;  5J5F A;  3ZJ2 A;  4CN4 A;  3PDY A;  5KX5 E;  3SQ9 A;  3U8L A;  3LFM A;  4DR7 T;  2NR4 A;  5IWA T;  2UXD T;  2WNL A;  4IT4 A;  3UFE A;  2FJB A;  4D01 A;  3QK6 A;  5ETW A;  5LGU B;  3C4Z A;  3ZKR A;  5AQU B;  5LBM A;  4GOU A;  4TNV A;  1BR2 A;  3C98 B;  2VKO A;  5LHG B;  5LP6 E;  2P9B A;  4JI3 T;  2XYS A;  3ESL A;  2XAQ B;  3QB5 K;  5F3J A;  2XQ7 A;  3SS1 A;  3PTR B;  4FI5 A;  5JRE A;  2C9T A;  4I0U A;  4F8H A;  5EK4 A;  3ZN0 B;  2ACX A;  4JI6 T;  1UX5 A;  1UK5 A;  3RKG A;  1HX8 A;  5FKY A;  5AQG B;  3P8C D;  1KFY A;  2E8I A;  4L9I A;  2HN2 A;  5TVC A;  4AKG A;  4NPP A;  2YEV C;  2WNC A;  3T4M A;  2ODV A;  1U5P A;  3EVY A;  3EAM A;  3AE6 A;  2WDV A;  3M65 A;  2KSR A;  2XYT A;  3C51 A;  2WU5 A;  3ZMU B;  2RPA A;  3UU4 A;  4ZI7 E;  1Y01 A;  4KX6 A;  1X9B A;  3AED A;  2W8G A;  3PUS A;  3SFE A;  2AXD S;  2WDQ A;  2CWO A;  2BS4 A;  2UUB T;  4JI5 T;  4KHP T;  4AIU A;  3H3A A;  4ILC A;  1G8X A;  2Y58 A;  2PBI A;  4WBN E;  2M6I A;  3RQW A;  3LK4 2;  2NW7 A;  1ZKE A;  4YY3 T;  4YFS A;  2EHO A;  4NZB A;  4PJL A;  5FXZ A;  1KNR A;  2FJA A;  4H9S E;  5LGN B;  1UUR A;  2WB5 A;  3AAI A;  4I43 B;  4U7I A;  2UXN B;  4MLK A;  2Y7Y A;  2AE9 A;  4EB6 E;  3LSV A;  2C5J A;  3PUA A;  4G2A A;  2WS3 A;  2B76 A;  4X62 T;  4PK6 A;  3AEE A;  2DWG A;  3U78 A;  4YTP A;  3E0Z A;  2BYR A;  2BR8 A;  5CJ5 A;  4HWD A;  4WNK A;  2WWU A;  2D5U A;  2LSI A;  4YLH A;  5BW2 A;  2WDR A;  3Q5X A;  3RH3 A;  3U8N A;  3ABV A;  3N2K E;  1ZV4 X;  4ZI3 D;  3IEE A;  5H6R B;  3BQL A;  2BYQ A;  3KV9 A;  5HEO A;  3RF1 A;  3MKD A;  5IYZ E;  3U8M A;  3N9L A;  4UXN B;  5CB4 E;  5L47 A;  4WZX A;  2LSG A;  3M3Z B;  3AA0 B;  3HKD E;  3Q9D A;  4IL4 A;  4KMC A;  2NWB A;  3PUV F;  2VWA A;  3O1J A;  2HPJ A;  5J1G A;  3UUL A;  4JI7 T;  4DV1 T;  4LF8 T;  4UM3 P;  2IIU A;  4HWI B;  1KNP A;  5HWX A;  2K3W A;  5F5W A;  4EZ4 A;  3EDU A;  4WYV A;  3TLS A;  4ALX A;  5JVD E;  4IE7 A;  2DL1 A;  4YTM A;  1J1J A;  2VKD A;  4UF0 A;  1OWA A;  5BMV E;  4HFE A;  4ZEY A;  5JR9 C;  3PUX F;  3CK6 A;  3FZL B;  3P4P A;  4EYU A;  3ETV A;  3JCF A;  3RYF E;  3HKB E;  3O9X A;  4Z90 A;  3Q5W A;  2XAS B;  2LE8 A;  3PU3 A;  2PGZ A;  2W66 A;  2UUC T;  4IHJ E;  5L3B B;  1YD8 G;  3ZSS A;  3ZYL A;  1D1B A;  4DUY T;  2JIW A;  4A98 A;  5HCJ A;  2V26 A;  2LT3 A;  2DCF A;  2Q9Q A;  3AEB A;  1BR4 A;  4TV8 E;  1YQ4 A;  2CBJ A;  3AEA A;  4DBM A;  2KXP B;  5E0O A;  5FY7 A;  2LOP A;  5AFH A;  4OK0 A;  2V1D B;  1I9B A;  1DU2 A;  5L2L A;  1OED B;  1MIV A;  5LA6 E;  2E9X D;  1EZ3 A;  3ANW B;  2KIN B;  3TLT A;  4WV9 A;  4I50 E;  2JQK A;  4EZ1 A;  3VRB A;  2JMH A;  4TV9 E;  2LM9 A;  3SFD A;  2X0H A;  3C79 A;  2VKH A;  4QXB B;  4HKA A;  4AFT A;  1UGO A;  5HCM A;  4DR5 T;  2YMD A;  3DP7 A;  4GK5 E;  4GYS A;  4ZJT A;  1OED A;  2CM0 A;  4GIW A;  3EI0 A;  2VQE T;  5ABF B;  3KIN B;  4U74 A;  3UFG A;  4E7S A;  3PU8 A;  4QWN B;  4U2Z A;  5IHY A;  3RIF A;  2V5C A;  2H7V C;  5FXV A;  5LOV E;  3AAE B;  2VL8 A;  2XZE A;  5J5G A;  4PFO A;  4A97 A;  2Y8D A;  5ABG A;  4DID B;  2RP4 A;  4IL9 A;  2ZJU A;  1ZP0 A;  4IRE A;  4ILA A;  1M62 A;  3AE9 A;  3EUH A;  1HNX T;  5EK2 A;  4G63 A;  2JRK A;  3VRA A;  4DV3 T;  3HR0 A;  4AQG A;  2W2U A;  4JI1 T;  5JDF A;  3ZT7 A;  4X5T A;  4CQI A;  1W0B A;  4P0A A;  1N36 T;  3IBP A;  3DJB A;  4MHC A;  2KZ7 B;  3IGQ A;  4KI0 F;  5FY1 A;  3UT5 E;  5HXC A;  2XTL A;  3RRC A;  3UUM A;  3ZMV B;  3VR8 A;  5HXR A;  3K3Q C;  5DAB A;  4CZZ B;  2E5V A;  2Y57 A;  5JDG A;  1HS7 A;  4UM3 S;  4JI4 T;  4AKH A;  2WZY A;  1T8B A;  3AA7 B;  4GYR A;  2C0S A;  3ZMZ B;  3GWH A;  1E1H B;  5KE4 A;  2QC1 B;  4KUM B;  4TWD A;  4IE6 A;  3P7I A;  4OHF A;  4UEM A;  4H9N C;  4WW0 A;  4DUZ T;  5L3C B;  3UUX B;  4H9O C;  1HG5 A;  1XDO A;  2W62 A;  3J9X 1;  4LML A;  5SYO A;  3MJX A;  4ZK1 A;  1HNW T;  1O3X A;  4NXN T;  4TUY E;  4FRR A;  4Z91 A;  2V7M A;  3C4X A;  2CXL A;  4YTN A;  3Q5E A;  2F4V T;  1CHU A;  1WCR A;  4U3C A;  1HFA A;  4QXC B;  3E08 A;  3LK3 B;  4ZXL A;  4PJJ A;  5DQW A;  1NEK A;  3NRY A;  3CKD A;  5FL1 A;  5J5I A;  3WAJ A;  5M4Y A;  3QC9 A;  4KBM B;  2Y6X A;  2WSS V;  4IDZ A;  4I55 E;  4N78 D;  4JEH B;  4ZS2 A;  3PEO A;  3P4W A;  2E9X B;  3NZP A;  5AFJ A;  4AQF A;  3VKG A;  3AE2 A;  2XAJ B;  2ODU A;  3JAF A;  3PE0 A;  1HF8 A;  3R84 B;  5AQQ B;  2CHN A;  2L8K A;  3I9W A;  3PJA A;  1W9R A;  1UX4 A;  3LBX A;  1WR6 A;  5HEU A;  3WIP A;  4EAH A;  4DV0 T;  5AFM B;  4IDN A;  1OXZ A;  4IST A;  4X65 T;  4QH1 A;  3AA6 B;  3JC6 C;  4EZH A;  3CX6 B;  3MA9 A;  2NTX A;  2ZMA A;  1IZN B;  4H9P C;  2D2S A;  4XBF B;  3ZLI A;  2BVM A;  1FMV A;  5FMN A;  1OED C;  3GA8 A;  3PUQ A;  2Z6E A;  3HA4 A;  4WBO A;  4UVA B;  5AQP B;  4KP3 C;  2NW9 A;  3QB5 A;  3ZMS B;  2BZB A;  1R8I A;  2K9A A;  3NWI A;  5AQS B;  3P4S A;  3NRX A;  3F2E A;  3J7Y q;  1JNR A;  2LRK A;  5J2U E;  3JAE A;  3Q5D A;  2CHO A;  3BQK A;  1WLX A;  2CLY C;  2LOS A;  3OTO T;  3B5M A;  2BVL A;  2QYW A;  4CXY A;  4DR4 T;  1M7K A;  1G73 A;  4CXX A;  4YHJ A;  1JNZ A;  1N32 T;  4HTE A;  3VR9 A;  4M1P A;  1FEW A;  3HI2 A;  3P50 A;  2KND A;  2DNX A;  4L0R A;  4CI3 B;  2XNV A;  4PJN A;  4BQT A;  3WTJ A;  4EIW A;  2BDE A;  1IAP A;  3RI5 A;  5JRC B;  3N9O A;  4DBR A;  3PUZ F;  1SUM B;  4UVC B;  5IUX A;  2X00 A;  4TNW A;  4TZ4 C;  2IDO B;  3ANW A;  4MAL A;  4DV7 T;  4ZI2 D;  4UY2 A;  5FP3 A;  2E2A A;  2WAU A;  3KDS E;  4Q25 A;  3FXE B;  3CML A;  3SWH A;  2X9H A;  2QGS A;  2XNU A;  2N1G A;  4LFB T;  3C84 A;  1W0A A;  3ZCI A;  4QHO A;  4HFC A;  5HXE A;  3CX8 B;  5KDM C;  3ETU A;  3SOL A;  2MOZ A;  1KNZ A;  3FBZ A;  2D0U A;  2XAH B;  2CMR A;  1ZHC A;  2ZLY A;  2L3L A;  4CI2 B;  3K8P C;  4UR9 A;  5JDN A;  4CXW A;  1OED E;  3RYH E;  4LMJ A;  4BJM A;  4GKK T;  2JQ9 A;  2V8S V;  4AI6 A;  5HAX A;  1XWM A;  2KT9 A;  4YSY A;  3RYC E;  4GKJ T;  2A9U A;  1FIO A;  2WZI A;  3MK7 C;  2X9Y A;  4JLE A;  2QVA A;  3RKO A;  3EAB A;  2J47 A;  2PJQ A;  5L4H A;  1BR1 A;  2VVS A;  1NEN A;  4UEL A;  4PAG A;  3UUB A;  2PFV A;  5CA1 E;  5JH7 E;  2XQ3 A;  2MBG A;  5FY0 A;  3TLW A;  4MBQ A;  3VU7 H;  2CXF A;  4IIJ E;  1YQ3 A;  1J5E T;  1XZY A;  1KF6 A;  5FL0 A;  1D1A A;  5CA0 E;  4U31 A;  3LBX B;  4PK5 A;  3WAK A;  5L3D B;  4LF4 T;  2JJ9 A;  1MIY A;  4L5G A;  1I6Z A;  3AVR A;  3AXJ A;  4ZR6 A;  3PJA J;  1SA0 E;  4P09 A;  2R6G F;  5BP0 A;  5LGT B;  3E22 E;  5LBQ B;  3H37 A;  2N2N A;  2WM9 A;  3A5X A;  5AQR B;  3S4U A;  2XY8 B;  3U3I A;  4B3S T;  5LXT E;  2LKG A;  4O8S A;  1D0Z A;  2X0L B;  2LRL A;  5JQG E;  4NUV A;  4PIR A;  2DI4 A;  5HEG A;  5FYM A;  4ZJS A;  3H3M A;  5AQJ B;  2XQ6 A;  3CQC B;  4PNI A;  4AKL A;  1T72 A;  4OYK A;  3ZST A;  3ONJ A;  3W15 B;  1LVK A;  2LM2 A;  3RX6 A;  4K0K T;  3WTL A;  2YDQ A;  3C64 A;  1XNR T;  5AQM B;  1B7T A;  1HX1 B;  3L8R A;  2JQQ A;  2CRB A;  4O4L E;  3RLF F;  1E7P A;  2X0Y A;  4DR6 T;  2IUB A;  5BRX A; 
#chains in the Genus database with same CATH homology
 2W8G A;  5L47 A;  3ZDH A;  4HFB A;  3PEO A;  3P4W A;  3TLT A;  4WV9 A;  2XQ5 A;  5AFJ A;  5JME A;  2YOE A;  2XQ3 A;  2XNV A;  3WTH A;  3WTN A;  4BQT A;  2BJ0 A;  3WTJ A;  3SQ6 A;  4EZ1 A;  2WNL A;  3IGQ A;  4IL4 A;  3TLW A;  4AFH A;  3TLV A;  4D01 A;  3RI5 A;  3JAF A;  4ILC A;  5CO5 A;  2Y58 A;  3ZKR A;  3C79 A;  5IUX A;  2X00 A;  4TNV A;  2M6I A;  4TNW A;  3U8J A;  3RQW A;  4HQP A;  2W8F A;  2YKS A;  3U8K A;  4UY2 A;  4TWH A;  2XQ8 A;  5HEU A;  4UM3 P;  2BR7 A;  3WIP A;  2Y56 A;  2Y57 A;  4UM3 A;  5AFM B;  4LMK A;  3RQU A;  2XYS A;  4NZB A;  2XQ4 A;  4AFT A;  4UM3 S;  5HEJ A;  2XNU A;  2WZY A;  4QH5 A;  3WTI A;  5HCM A;  4XK9 A;  2YMD A;  2XQ9 A;  4QH1 A;  5L4E A;  4UXU A;  2XZ5 A;  4HFI A;  3C84 A;  2BYS A;  3UU3 A;  4ZJT A;  3TLS A;  2XQ7 A;  4TWF A;  2BYP A;  2YN6 A;  3JAD A;  2BG9 C;  4HFC A;  4ZR6 A;  4ALX A;  2WN9 A;  5KE4 A;  2WNJ A;  3GUA A;  3WTO A;  1OED A;  2QC1 B;  4TWD A;  3RHW A;  2LKH A;  4COF A;  4ZZC A;  2UZ6 A;  2M6B A;  2Y54 A;  3TLU A;  3SIO A;  3EI0 A;  1OED C;  2Y7Y A;  2C9T A;  3LSV A;  3UQ7 A;  1UW6 A;  4B5D A;  5BP0 A;  3PMZ A;  4HFD A;  4F8H A;  1UX2 A;  4HFE A;  5KZU A;  2ZJV A;  3WTM A;  3UU6 A;  3RIF A;  3WTK A;  5AFN A;  2BYR A;  4QH4 A;  4LML A;  2BR8 A;  2XNT A;  5SYO A;  2VL0 A;  4ZK1 A;  2LKG A;  4UM1 A;  4QAA A;  4ZZB A;  5CFB A;  3ZDG A;  5AFM A;  5AIN A;  4QAB A;  3EHZ A;  4PIR A;  4FRR A;  4Z91 A;  2BG9 E;  5J5G A;  2LLY A;  5HEG A;  4A97 A;  5LG3 A;  4Z90 A;  4ZJS A;  1OED E;  5TVC A;  3RIA A;  2XQ6 A;  3JAE A;  4LMJ A;  4NPP A;  4IL9 A;  2PGZ A;  2BYN A;  2ZJU A;  1UV6 A;  5BW2 A;  3UQ4 A;  4IRE A;  4ILA A;  2WNC A;  3SH1 A;  4ZK4 A;  5AFL A;  4QAC A;  3T4M A;  3U8N A;  2BG9 B;  5J5H A;  2LM2 A;  4HFH A;  4A98 A;  3WTL A;  5HCJ A;  3EAM A;  5LXB A;  2MAW A;  2PH9 A;  5AFK A;  5HEH A;  2KSR A;  2XYT A;  2YME A;  5J0Z A;  2XZ6 A;  2XQA A;  2BYQ A;  4DBM A;  5J5F A;  3UU5 A;  4ILB A;  3UU4 A;  5HEO A;  4X5T A;  5J5I A;  5AFH A;  2BG9 A;  3P50 A;  4BFQ A;  1I9B A;  4AFG A;  5L4H A;  4XHE A;  5FJV A;  3SQ9 A;  3U8M A;  3UU8 A;  2X00 D;  1OED B;  3U8L A;  3UUB A;  4ZRU A;  5BRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...