4DBMA

Aplysia californica-achbp in complex with triazole 18
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
211
Chain Sequence
DDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein
molecule keywords Soluble acetylcholine receptor
publication title Generation of candidate ligands for nicotinic acetylcholine receptors via in situ click chemistry with a soluble acetylcholine binding protein template.
pubmed doi rcsb
source organism Aplysia californica
total genus 51
structure length 211
sequence length 211
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4dbmA00
2BG9E 3UU8A 2YOEA 2QC1B 2XQ4A 3EHZA 5TVCA 3UQ4A 5AFLA 2WN9A 3PMZA 4UM1A 2XNVA 4B5DA 2YKSA 2BG9C 4TWHA 5J5FA 3T4MA 3UU3A 4HFCA 4DBMA 4A97A 4ZZCA 4ZK4A 4TNVA 2XQ9A 4FRRA 2BR7A 3WTKA 2VL0A 4HFIA 2UZ6A 3JAEA 3RIAA 2XQ8A 2XYTA 4HFEA 4ILBA 2XNTA 4BQTA 1UV6A 2WNJA 2WNLA 2Y54A 2BYQA 4NZBA 4UM3S 4XHEA 2BG9B 4HFDA 3C79A 3ZDHA 2Y57A 4LMKA 3TLUA 5J5IA 3WIPA 3UU5A 3EAMA 4QH4A 5AFNA 3RI5A 4NPPA 2XYSA 3UU6A 1UX2A 4D01A 3WTHA 2X00A 5HEJA 5BP0A 5J5HA 2Y7YA 3TLTA 3P50A 3U8MA 5FJVA 4ILAA 3EI0A 4COFA 2PH9A 4Z91A 5L4HA 4ZJSA 4EZ1A 5JMEA 3WTOA 4UY2A 5KZUA 2BG9A 2Y56A 4AFGA 4ZR6A 3WTNA 4ALXA 3C84A 4F8HA 2W8GA 2BJ0A 5L4EA 2WZYA 5CO5A 3GUAA 3P4WA 4ILCA 2XQAA 3JADA 5HEOA 5CFBA 4TNWA 5HCMA 5J5GA 5L47A 4UXUA 4Z90A 3ZDGA 3TLSA 4WV9A 4A98A 5AFJA 3RQWA 4AFHA 2XQ5A 4QH1A 4HQPA 4PIRA 3RQUA 2ZJVA 2W8FA 3WTIA 2YN6A 5AFMB 2BYSA 4IL4A 5BW2A 2YMDA 4QAAA 4QH5A 3U8NA 4LMJA 4UM3P 5HEGA 2PGZA 3SQ6A 5AINA 3U8LA 2XZ6A 5AFKA 2Y58A 1UW6A 4IL9A 5IUXA 3U8JA 4BFQA 2XNUA 3SQ9A 4QABA 3U8KA 5HEUA 4LMLA 3WTJA 5BRXA 4QACA 4HFHA 2BYRA 4ZK1A 5AFMA 5J0ZA 3PEOA 3RIFA 3UQ7A 4ZRUA 2XZ5A 3SH1A 3WTMA 3LSVA 3IGQA 2XQ7A 2C9TA 2YMEA 4X5TA 3SIOA 2XQ3A 2X00D 4AFTA 4ZZBA 5KE4A 3TLVA 2BYPA 4ZJTA 2BR8A 4UM3A 5AFHA 1I9BA 3JAFA 2XQ6A 3WTLA 2BYNA 5HCJA 4TWDA 5SYOA 4HFBA 5LXBA 3UU4A 4XK9A 3ZKRA 5HEHA 5LG3A 4IREA 4TWFA 2ZJUA 3TLWA 3RHWA 2WNCA 3UUBA
chains in the Genus database with same CATH superfamily
2BG9E 3UU8A 2YOEA 2QC1B 2XQ4A 3EHZA 5TVCA 3UQ4A 5AFLA 2WN9A 3PMZA 4UM1A 2XNVA 4B5DA 2YKSA 2BG9C 4TWHA 5J5FA 3T4MA 3UU3A 4HFCA 4DBMA 4A97A 4ZZCA 4ZK4A 4TNVA 2XQ9A 4FRRA 2BR7A 3WTKA 2VL0A 4HFIA 2UZ6A 3JAEA 3RIAA 2XQ8A 2XYTA 4HFEA 4ILBA 2XNTA 4BQTA 1UV6A 2WNJA 2WNLA 2Y54A 2BYQA 4NZBA 4UM3S 4XHEA 2BG9B 4HFDA 3C79A 3ZDHA 2Y57A 4LMKA 3TLUA 5J5IA 3WIPA 3UU5A 3EAMA 4QH4A 5AFNA 3RI5A 4NPPA 2XYSA 3UU6A 1UX2A 4D01A 3WTHA 2X00A 5HEJA 5BP0A 5J5HA 2Y7YA 3TLTA 3P50A 3U8MA 5FJVA 4ILAA 3EI0A 4COFA 2PH9A 4Z91A 5L4HA 4ZJSA 4EZ1A 5JMEA 3WTOA 4UY2A 5KZUA 2BG9A 2Y56A 4AFGA 4ZR6A 3WTNA 4ALXA 3C84A 4F8HA 2W8GA 2BJ0A 5L4EA 2WZYA 5CO5A 3GUAA 3P4WA 4ILCA 2XQAA 3JADA 5HEOA 5CFBA 4TNWA 5HCMA 5J5GA 5L47A 4UXUA 4Z90A 3ZDGA 3TLSA 4WV9A 4A98A 5AFJA 3RQWA 4AFHA 2XQ5A 4QH1A 4HQPA 4PIRA 3RQUA 2ZJVA 2W8FA 3WTIA 2YN6A 5AFMB 2BYSA 4IL4A 5BW2A 2YMDA 4QAAA 4QH5A 3U8NA 4LMJA 4UM3P 5HEGA 2PGZA 3SQ6A 5AINA 3U8LA 2XZ6A 5AFKA 2Y58A 1UW6A 4IL9A 5IUXA 3U8JA 4BFQA 2XNUA 3SQ9A 4QABA 3U8KA 5HEUA 4LMLA 3WTJA 5BRXA 4QACA 4HFHA 2BYRA 4ZK1A 5AFMA 5J0ZA 3PEOA 3RIFA 3UQ7A 4ZRUA 2XZ5A 3SH1A 3WTMA 3LSVA 3IGQA 2XQ7A 2C9TA 2YMEA 4X5TA 3SIOA 2XQ3A 2X00D 4AFTA 4ZZBA 5KE4A 3TLVA 2BYPA 4ZJTA 2BR8A 4UM3A 5AFHA 1I9BA 3JAFA 2XQ6A 3WTLA 2BYNA 5HCJA 4TWDA 5SYOA 4HFBA 5LXBA 3UU4A 4XK9A 3ZKRA 5HEHA 5LG3A 4IREA 4TWFA 2ZJUA 3TLWA 3RHWA 2WNCA 3UUBA
chains in the Genus database with same CATH topology
2BG9E 3UU8A 2YOEA 2QC1B 2XQ4A 3EHZA 5TVCA 3UQ4A 5AFLA 2WN9A 3PMZA 4UM1A 2XNVA 4B5DA 2YKSA 2BG9C 4TWHA 5J5FA 3T4MA 3UU3A 4HFCA 4DBMA 4A97A 4ZZCA 4ZK4A 4TNVA 2XQ9A 4FRRA 2BR7A 3WTKA 2VL0A 4HFIA 2UZ6A 3JAEA 3RIAA 2XQ8A 2XYTA 4HFEA 4ILBA 2XNTA 4BQTA 1UV6A 2WNJA 2WNLA 2Y54A 2BYQA 4NZBA 4UM3S 4XHEA 2BG9B 4HFDA 3C79A 3ZDHA 2Y57A 4LMKA 3TLUA 5J5IA 3WIPA 3UU5A 3EAMA 4QH4A 5AFNA 3RI5A 4NPPA 2XYSA 3UU6A 1UX2A 4D01A 3WTHA 2X00A 5HEJA 5BP0A 5J5HA 2Y7YA 3TLTA 3P50A 3U8MA 5FJVA 4ILAA 3EI0A 4COFA 2PH9A 4Z91A 5L4HA 4ZJSA 4EZ1A 5JMEA 3WTOA 4UY2A 5KZUA 2BG9A 2Y56A 4AFGA 4ZR6A 3WTNA 4ALXA 3C84A 4F8HA 2W8GA 2BJ0A 5L4EA 2WZYA 5CO5A 3GUAA 3P4WA 4ILCA 2XQAA 3JADA 5HEOA 5CFBA 4TNWA 5HCMA 5J5GA 5L47A 4UXUA 4Z90A 3ZDGA 3TLSA 4WV9A 4A98A 5AFJA 3RQWA 4AFHA 2XQ5A 4QH1A 4HQPA 4PIRA 3RQUA 2ZJVA 2W8FA 3WTIA 2YN6A 5AFMB 2BYSA 4IL4A 5BW2A 2YMDA 4QAAA 4QH5A 3U8NA 4LMJA 4UM3P 5HEGA 2PGZA 3SQ6A 5AINA 3U8LA 2XZ6A 5AFKA 2Y58A 1UW6A 4IL9A 5IUXA 3U8JA 4BFQA 2XNUA 3SQ9A 4QABA 3U8KA 5HEUA 4LMLA 3WTJA 5BRXA 4QACA 4HFHA 2BYRA 4ZK1A 5AFMA 5J0ZA 3PEOA 3RIFA 3UQ7A 4ZRUA 2XZ5A 3SH1A 3WTMA 3LSVA 3IGQA 2XQ7A 2C9TA 2YMEA 4X5TA 3SIOA 2XQ3A 2X00D 4AFTA 4ZZBA 5KE4A 3TLVA 2BYPA 4ZJTA 2BR8A 4UM3A 5AFHA 1I9BA 3JAFA 2XQ6A 3WTLA 2BYNA 5HCJA 4TWDA 5SYOA 4HFBA 5LXBA 3UU4A 4XK9A 3ZKRA 5HEHA 5LG3A 4IREA 4TWFA 2ZJUA 3TLWA 3RHWA 2WNCA 3UUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG9 E;  3UU8 A;  2YOE A;  2QC1 B;  2XQ4 A;  3EHZ A;  5TVC A;  3UQ4 A;  5AFL A;  2WN9 A;  3PMZ A;  4UM1 A;  2XNV A;  4B5D A;  2YKS A;  2BG9 C;  4TWH A;  5J5F A;  3T4M A;  3UU3 A;  4HFC A;  4DBM A;  4A97 A;  4ZZC A;  4ZK4 A;  4TNV A;  2XQ9 A;  4FRR A;  2BR7 A;  3WTK A;  2VL0 A;  4HFI A;  2UZ6 A;  3JAE A;  3RIA A;  2XQ8 A;  2XYT A;  4HFE A;  4ILB A;  2XNT A;  4BQT A;  1UV6 A;  2WNJ A;  2WNL A;  2Y54 A;  2BYQ A;  4NZB A;  4UM3 S;  4XHE A;  2BG9 B;  4HFD A;  3C79 A;  3ZDH A;  2Y57 A;  4LMK A;  3TLU A;  5J5I A;  3WIP A;  3UU5 A;  3EAM A;  4QH4 A;  5AFN A;  3RI5 A;  4NPP A;  2XYS A;  3UU6 A;  1UX2 A;  4D01 A;  3WTH A;  2X00 A;  5HEJ A;  5BP0 A;  5J5H A;  2Y7Y A;  3TLT A;  3P50 A;  3U8M A;  5FJV A;  4ILA A;  3EI0 A;  4COF A;  2PH9 A;  4Z91 A;  5L4H A;  4ZJS A;  4EZ1 A;  5JME A;  3WTO A;  4UY2 A;  5KZU A;  2BG9 A;  2Y56 A;  4AFG A;  4ZR6 A;  3WTN A;  4ALX A;  3C84 A;  4F8H A;  2W8G A;  2BJ0 A;  5L4E A;  2WZY A;  5CO5 A;  3GUA A;  3P4W A;  4ILC A;  2XQA A;  3JAD A;  5HEO A;  5CFB A;  4TNW A;  5HCM A;  5J5G A;  5L47 A;  4UXU A;  4Z90 A;  3ZDG A;  3TLS A;  4WV9 A;  4A98 A;  5AFJ A;  3RQW A;  4AFH A;  2XQ5 A;  4QH1 A;  4HQP A;  4PIR A;  3RQU A;  2ZJV A;  2W8F A;  3WTI A;  2YN6 A;  5AFM B;  2BYS A;  4IL4 A;  5BW2 A;  2YMD A;  4QAA A;  4QH5 A;  3U8N A;  4LMJ A;  4UM3 P;  5HEG A;  2PGZ A;  3SQ6 A;  5AIN A;  3U8L A;  2XZ6 A;  5AFK A;  2Y58 A;  1UW6 A;  4IL9 A;  5IUX A;  3U8J A;  4BFQ A;  2XNU A;  3SQ9 A;  4QAB A;  3U8K A;  5HEU A;  4LML A;  3WTJ A;  5BRX A;  4QAC A;  4HFH A;  2BYR A;  4ZK1 A;  5AFM A;  5J0Z A;  3PEO A;  3RIF A;  3UQ7 A;  4ZRU A;  2XZ5 A;  3SH1 A;  3WTM A;  3LSV A;  3IGQ A;  2XQ7 A;  2C9T A;  2YME A;  4X5T A;  3SIO A;  2XQ3 A;  2X00 D;  4AFT A;  4ZZB A;  5KE4 A;  3TLV A;  2BYP A;  4ZJT A;  2BR8 A;  4UM3 A;  5AFH A;  1I9B A;  3JAF A;  2XQ6 A;  3WTL A;  2BYN A;  5HCJ A;  4TWD A;  5SYO A;  4HFB A;  5LXB A;  3UU4 A;  4XK9 A;  3ZKR A;  5HEH A;  5LG3 A;  4IRE A;  4TWF A;  2ZJU A;  3TLW A;  3RHW A;  2WNC A;  3UUB A; 
#chains in the Genus database with same CATH topology
 2BG9 E;  3UU8 A;  2YOE A;  2QC1 B;  2XQ4 A;  3EHZ A;  5TVC A;  3UQ4 A;  5AFL A;  2WN9 A;  3PMZ A;  4UM1 A;  2XNV A;  4B5D A;  2YKS A;  2BG9 C;  4TWH A;  5J5F A;  3T4M A;  3UU3 A;  4HFC A;  4DBM A;  4A97 A;  4ZZC A;  4ZK4 A;  4TNV A;  2XQ9 A;  4FRR A;  2BR7 A;  3WTK A;  2VL0 A;  4HFI A;  2UZ6 A;  3JAE A;  3RIA A;  2XQ8 A;  2XYT A;  4HFE A;  4ILB A;  2XNT A;  4BQT A;  1UV6 A;  2WNJ A;  2WNL A;  2Y54 A;  2BYQ A;  4NZB A;  4UM3 S;  4XHE A;  2BG9 B;  4HFD A;  3C79 A;  3ZDH A;  2Y57 A;  4LMK A;  3TLU A;  5J5I A;  3WIP A;  3UU5 A;  3EAM A;  4QH4 A;  5AFN A;  3RI5 A;  4NPP A;  2XYS A;  3UU6 A;  1UX2 A;  4D01 A;  3WTH A;  2X00 A;  5HEJ A;  5BP0 A;  5J5H A;  2Y7Y A;  3TLT A;  3P50 A;  3U8M A;  5FJV A;  4ILA A;  3EI0 A;  4COF A;  2PH9 A;  4Z91 A;  5L4H A;  4ZJS A;  4EZ1 A;  5JME A;  3WTO A;  4UY2 A;  5KZU A;  2BG9 A;  2Y56 A;  4AFG A;  4ZR6 A;  3WTN A;  4ALX A;  3C84 A;  4F8H A;  2W8G A;  2BJ0 A;  5L4E A;  2WZY A;  5CO5 A;  3GUA A;  3P4W A;  4ILC A;  2XQA A;  3JAD A;  5HEO A;  5CFB A;  4TNW A;  5HCM A;  5J5G A;  5L47 A;  4UXU A;  4Z90 A;  3ZDG A;  3TLS A;  4WV9 A;  4A98 A;  5AFJ A;  3RQW A;  4AFH A;  2XQ5 A;  4QH1 A;  4HQP A;  4PIR A;  3RQU A;  2ZJV A;  2W8F A;  3WTI A;  2YN6 A;  5AFM B;  2BYS A;  4IL4 A;  5BW2 A;  2YMD A;  4QAA A;  4QH5 A;  3U8N A;  4LMJ A;  4UM3 P;  5HEG A;  2PGZ A;  3SQ6 A;  5AIN A;  3U8L A;  2XZ6 A;  5AFK A;  2Y58 A;  1UW6 A;  4IL9 A;  5IUX A;  3U8J A;  4BFQ A;  2XNU A;  3SQ9 A;  4QAB A;  3U8K A;  5HEU A;  4LML A;  3WTJ A;  5BRX A;  4QAC A;  4HFH A;  2BYR A;  4ZK1 A;  5AFM A;  5J0Z A;  3PEO A;  3RIF A;  3UQ7 A;  4ZRU A;  2XZ5 A;  3SH1 A;  3WTM A;  3LSV A;  3IGQ A;  2XQ7 A;  2C9T A;  2YME A;  4X5T A;  3SIO A;  2XQ3 A;  2X00 D;  4AFT A;  4ZZB A;  5KE4 A;  3TLV A;  2BYP A;  4ZJT A;  2BR8 A;  4UM3 A;  5AFH A;  1I9B A;  3JAF A;  2XQ6 A;  3WTL A;  2BYN A;  5HCJ A;  4TWD A;  5SYO A;  4HFB A;  5LXB A;  3UU4 A;  4XK9 A;  3ZKR A;  5HEH A;  5LG3 A;  4IRE A;  4TWF A;  2ZJU A;  3TLW A;  3RHW A;  2WNC A;  3UUB A; 
#chains in the Genus database with same CATH homology
 2BG9 E;  3UU8 A;  2YOE A;  2QC1 B;  2XQ4 A;  3EHZ A;  5TVC A;  3UQ4 A;  5AFL A;  2WN9 A;  3PMZ A;  4UM1 A;  2XNV A;  4B5D A;  2YKS A;  2BG9 C;  4TWH A;  5J5F A;  3T4M A;  3UU3 A;  4HFC A;  4DBM A;  4A97 A;  4ZZC A;  4ZK4 A;  4TNV A;  2XQ9 A;  4FRR A;  2BR7 A;  3WTK A;  2VL0 A;  4HFI A;  2UZ6 A;  3JAE A;  3RIA A;  2XQ8 A;  2XYT A;  4HFE A;  4ILB A;  2XNT A;  4BQT A;  1UV6 A;  2WNJ A;  2WNL A;  2Y54 A;  2BYQ A;  4NZB A;  4UM3 S;  4XHE A;  2BG9 B;  4HFD A;  3C79 A;  3ZDH A;  2Y57 A;  4LMK A;  3TLU A;  5J5I A;  3WIP A;  3UU5 A;  3EAM A;  4QH4 A;  5AFN A;  3RI5 A;  4NPP A;  2XYS A;  3UU6 A;  1UX2 A;  4D01 A;  3WTH A;  2X00 A;  5HEJ A;  5BP0 A;  5J5H A;  2Y7Y A;  3TLT A;  3P50 A;  3U8M A;  5FJV A;  4ILA A;  3EI0 A;  4COF A;  2PH9 A;  4Z91 A;  5L4H A;  4ZJS A;  4EZ1 A;  5JME A;  3WTO A;  4UY2 A;  5KZU A;  2BG9 A;  2Y56 A;  4AFG A;  4ZR6 A;  3WTN A;  4ALX A;  3C84 A;  4F8H A;  2W8G A;  2BJ0 A;  5L4E A;  2WZY A;  5CO5 A;  3GUA A;  3P4W A;  4ILC A;  2XQA A;  3JAD A;  5HEO A;  5CFB A;  4TNW A;  5HCM A;  5J5G A;  5L47 A;  4UXU A;  4Z90 A;  3ZDG A;  3TLS A;  4WV9 A;  4A98 A;  5AFJ A;  3RQW A;  4AFH A;  2XQ5 A;  4QH1 A;  4HQP A;  4PIR A;  3RQU A;  2ZJV A;  2W8F A;  3WTI A;  2YN6 A;  5AFM B;  2BYS A;  4IL4 A;  5BW2 A;  2YMD A;  4QAA A;  4QH5 A;  3U8N A;  4LMJ A;  4UM3 P;  5HEG A;  2PGZ A;  3SQ6 A;  5AIN A;  3U8L A;  2XZ6 A;  5AFK A;  2Y58 A;  1UW6 A;  4IL9 A;  5IUX A;  3U8J A;  4BFQ A;  2XNU A;  3SQ9 A;  4QAB A;  3U8K A;  5HEU A;  4LML A;  3WTJ A;  5BRX A;  4QAC A;  4HFH A;  2BYR A;  4ZK1 A;  5AFM A;  5J0Z A;  3PEO A;  3RIF A;  3UQ7 A;  4ZRU A;  2XZ5 A;  3SH1 A;  3WTM A;  3LSV A;  3IGQ A;  2XQ7 A;  2C9T A;  2YME A;  4X5T A;  3SIO A;  2XQ3 A;  2X00 D;  4AFT A;  4ZZB A;  5KE4 A;  3TLV A;  2BYP A;  4ZJT A;  2BR8 A;  4UM3 A;  5AFH A;  1I9B A;  3JAF A;  2XQ6 A;  3WTL A;  2BYN A;  5HCJ A;  4TWD A;  5SYO A;  4HFB A;  5LXB A;  3UU4 A;  4XK9 A;  3ZKR A;  5HEH A;  5LG3 A;  4IRE A;  4TWF A;  2ZJU A;  3TLW A;  3RHW A;  2WNC A;  3UUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...