2XNUA

Acetylcholine binding protein (achbp) as template for hierarchical in silico screening procedures to identify structurally novel ligands for the nicotinic receptors
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Acetylcholine Binding Protein (Achbp) as Template for Hierarchical in Silico Screening Procedures to Identify Structurally Novel Ligands for the Nicotinic Receptors.
pubmed doi rcsb
source organism Aplysia californica
total genus 50
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xnuA00
3WIPA 4QH5A 5HEUA 3ZDGA 4XK9A 3TLWA 3WTLA 4ILAA 3LSVA 4ZZCA 2XNUA 2BG9A 2C9TA 3SQ9A 4HFDA 3UQ7A 4ZJSA 4NZBA 3U8NA 5KE4A 2Y57A 3TLVA 3RIAA 2XNVA 3UU6A 1UV6A 4UXUA 4PIRA 2BJ0A 5J5HA 5KZUA 3WTNA 3P4WA 2BYPA 3ZKRA 2X00D 5HEJA 4HFIA 3TLSA 5BP0A 4WV9A 4HFBA 2XQAA 2XQ6A 1UW6A 2VL0A 3RQWA 3WTHA 2XNTA 2YN6A 4LMKA 4Z90A 3UU5A 5AFMA 4ZZBA 3UUBA 5HEOA 2ZJUA 2WNLA 3U8KA 3WTMA 5AFNA 2BYQA 4HFEA 3WTOA 2PH9A 2XYTA 4BQTA 2YMDA 3C79A 4AFTA 4TWFA 5CO5A 3UU3A 3UU4A 3PMZA 5HEHA 4B5DA 5HEGA 3RIFA 2BYRA 4X5TA 2WNCA 4EZ1A 3TLTA 5IUXA 2YMEA 2UZ6A 3RI5A 5TVCA 4COFA 4A98A 2XQ8A 3JAFA 5FJVA 2BG9E 4QH4A 2Y7YA 4IREA 5L47A 2BR7A 4D01A 4ZK1A 4UM3A 4QACA 2YOEA 2ZJVA 4AFHA 4UM1A 5J5FA 4DBMA 4ILCA 3SQ6A 5LXBA 2W8GA 4A97A 4BFQA 2X00A 4IL4A 2BYNA 3WTKA 2WN9A 4UY2A 4ZRUA 3UU8A 4QH1A 3TLUA 5J5IA 3C84A 4HFCA 4QABA 2BG9C 2BG9B 1UX2A 1I9BA 3GUAA 3EI0A 5CFBA 2BR8A 4IL9A 4TWHA 2XQ5A 3RQUA 4ALXA 3EAMA 3RHWA 4ZJTA 5L4HA 5BW2A 3JAEA 2XQ7A 3P50A 5AFHA 2Y56A 2YKSA 3T4MA 2WZYA 4AFGA 5L4EA 2XZ6A 3JADA 3EHZA 2PGZA 3PEOA 5AFKA 4QAAA 2XQ3A 4ZK4A 3WTJA 2XQ4A 3UQ4A 3U8MA 4NPPA 4ILBA 4TNVA 2WNJA 3IGQA 4FRRA 4HQPA 5J5GA 4TWDA 4ZR6A 2XZ5A 2Y58A 5HCMA 3WTIA 4F8HA 5BRXA 2QC1B 2Y54A 4LMJA 5JMEA 4UM3S 4XHEA 5AFJA 5AINA 4LMLA 2XQ9A 4UM3P 5HCJA 2W8FA 4TNWA 5LG3A 4Z91A 4HFHA 3U8LA 5SYOA 3SIOA 3ZDHA 5J0ZA 3SH1A 5AFMB 3U8JA 2XYSA 2BYSA 5AFLA
chains in the Genus database with same CATH superfamily
3WIPA 4QH5A 5HEUA 3ZDGA 4XK9A 3TLWA 3WTLA 4ILAA 3LSVA 4ZZCA 2XNUA 2BG9A 2C9TA 3SQ9A 4HFDA 3UQ7A 4ZJSA 4NZBA 3U8NA 5KE4A 2Y57A 3TLVA 3RIAA 2XNVA 3UU6A 1UV6A 4UXUA 4PIRA 2BJ0A 5J5HA 5KZUA 3WTNA 3P4WA 2BYPA 3ZKRA 2X00D 5HEJA 4HFIA 3TLSA 5BP0A 4WV9A 4HFBA 2XQAA 2XQ6A 1UW6A 2VL0A 3RQWA 3WTHA 2XNTA 2YN6A 4LMKA 4Z90A 3UU5A 5AFMA 4ZZBA 3UUBA 5HEOA 2ZJUA 2WNLA 3U8KA 3WTMA 5AFNA 2BYQA 4HFEA 3WTOA 2PH9A 2XYTA 4BQTA 2YMDA 3C79A 4AFTA 4TWFA 5CO5A 3UU3A 3UU4A 3PMZA 5HEHA 4B5DA 5HEGA 3RIFA 2BYRA 4X5TA 2WNCA 4EZ1A 3TLTA 5IUXA 2YMEA 2UZ6A 3RI5A 5TVCA 4COFA 4A98A 2XQ8A 3JAFA 5FJVA 2BG9E 4QH4A 2Y7YA 4IREA 5L47A 2BR7A 4D01A 4ZK1A 4UM3A 4QACA 2YOEA 2ZJVA 4AFHA 4UM1A 5J5FA 4DBMA 4ILCA 3SQ6A 5LXBA 2W8GA 4A97A 4BFQA 2X00A 4IL4A 2BYNA 3WTKA 2WN9A 4UY2A 4ZRUA 3UU8A 4QH1A 3TLUA 5J5IA 3C84A 4HFCA 4QABA 2BG9C 2BG9B 1UX2A 1I9BA 3GUAA 3EI0A 5CFBA 2BR8A 4IL9A 4TWHA 2XQ5A 3RQUA 4ALXA 3EAMA 3RHWA 4ZJTA 5L4HA 5BW2A 3JAEA 2XQ7A 3P50A 5AFHA 2Y56A 2YKSA 3T4MA 2WZYA 4AFGA 5L4EA 2XZ6A 3JADA 3EHZA 2PGZA 3PEOA 5AFKA 4QAAA 2XQ3A 4ZK4A 3WTJA 2XQ4A 3UQ4A 3U8MA 4NPPA 4ILBA 4TNVA 2WNJA 3IGQA 4FRRA 4HQPA 5J5GA 4TWDA 4ZR6A 2XZ5A 2Y58A 5HCMA 3WTIA 4F8HA 5BRXA 2QC1B 2Y54A 4LMJA 5JMEA 4UM3S 4XHEA 5AFJA 5AINA 4LMLA 2XQ9A 4UM3P 5HCJA 2W8FA 4TNWA 5LG3A 4Z91A 4HFHA 3U8LA 5SYOA 3SIOA 3ZDHA 5J0ZA 3SH1A 5AFMB 3U8JA 2XYSA 2BYSA 5AFLA
chains in the Genus database with same CATH topology
3WIPA 4QH5A 5HEUA 3ZDGA 4XK9A 3TLWA 3WTLA 4ILAA 3LSVA 4ZZCA 2XNUA 2BG9A 2C9TA 3SQ9A 4HFDA 3UQ7A 4ZJSA 4NZBA 3U8NA 5KE4A 2Y57A 3TLVA 3RIAA 2XNVA 3UU6A 1UV6A 4UXUA 4PIRA 2BJ0A 5J5HA 5KZUA 3WTNA 3P4WA 2BYPA 3ZKRA 2X00D 5HEJA 4HFIA 3TLSA 5BP0A 4WV9A 4HFBA 2XQAA 2XQ6A 1UW6A 2VL0A 3RQWA 3WTHA 2XNTA 2YN6A 4LMKA 4Z90A 3UU5A 5AFMA 4ZZBA 3UUBA 5HEOA 2ZJUA 2WNLA 3U8KA 3WTMA 5AFNA 2BYQA 4HFEA 3WTOA 2PH9A 2XYTA 4BQTA 2YMDA 3C79A 4AFTA 4TWFA 5CO5A 3UU3A 3UU4A 3PMZA 5HEHA 4B5DA 5HEGA 3RIFA 2BYRA 4X5TA 2WNCA 4EZ1A 3TLTA 5IUXA 2YMEA 2UZ6A 3RI5A 5TVCA 4COFA 4A98A 2XQ8A 3JAFA 5FJVA 2BG9E 4QH4A 2Y7YA 4IREA 5L47A 2BR7A 4D01A 4ZK1A 4UM3A 4QACA 2YOEA 2ZJVA 4AFHA 4UM1A 5J5FA 4DBMA 4ILCA 3SQ6A 5LXBA 2W8GA 4A97A 4BFQA 2X00A 4IL4A 2BYNA 3WTKA 2WN9A 4UY2A 4ZRUA 3UU8A 4QH1A 3TLUA 5J5IA 3C84A 4HFCA 4QABA 2BG9C 2BG9B 1UX2A 1I9BA 3GUAA 3EI0A 5CFBA 2BR8A 4IL9A 4TWHA 2XQ5A 3RQUA 4ALXA 3EAMA 3RHWA 4ZJTA 5L4HA 5BW2A 3JAEA 2XQ7A 3P50A 5AFHA 2Y56A 2YKSA 3T4MA 2WZYA 4AFGA 5L4EA 2XZ6A 3JADA 3EHZA 2PGZA 3PEOA 5AFKA 4QAAA 2XQ3A 4ZK4A 3WTJA 2XQ4A 3UQ4A 3U8MA 4NPPA 4ILBA 4TNVA 2WNJA 3IGQA 4FRRA 4HQPA 5J5GA 4TWDA 4ZR6A 2XZ5A 2Y58A 5HCMA 3WTIA 4F8HA 5BRXA 2QC1B 2Y54A 4LMJA 5JMEA 4UM3S 4XHEA 5AFJA 5AINA 4LMLA 2XQ9A 4UM3P 5HCJA 2W8FA 4TNWA 5LG3A 4Z91A 4HFHA 3U8LA 5SYOA 3SIOA 3ZDHA 5J0ZA 3SH1A 5AFMB 3U8JA 2XYSA 2BYSA 5AFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WIP A;  4QH5 A;  5HEU A;  3ZDG A;  4XK9 A;  3TLW A;  3WTL A;  4ILA A;  3LSV A;  4ZZC A;  2XNU A;  2BG9 A;  2C9T A;  3SQ9 A;  4HFD A;  3UQ7 A;  4ZJS A;  4NZB A;  3U8N A;  5KE4 A;  2Y57 A;  3TLV A;  3RIA A;  2XNV A;  3UU6 A;  1UV6 A;  4UXU A;  4PIR A;  2BJ0 A;  5J5H A;  5KZU A;  3WTN A;  3P4W A;  2BYP A;  3ZKR A;  2X00 D;  5HEJ A;  4HFI A;  3TLS A;  5BP0 A;  4WV9 A;  4HFB A;  2XQA A;  2XQ6 A;  1UW6 A;  2VL0 A;  3RQW A;  3WTH A;  2XNT A;  2YN6 A;  4LMK A;  4Z90 A;  3UU5 A;  5AFM A;  4ZZB A;  3UUB A;  5HEO A;  2ZJU A;  2WNL A;  3U8K A;  3WTM A;  5AFN A;  2BYQ A;  4HFE A;  3WTO A;  2PH9 A;  2XYT A;  4BQT A;  2YMD A;  3C79 A;  4AFT A;  4TWF A;  5CO5 A;  3UU3 A;  3UU4 A;  3PMZ A;  5HEH A;  4B5D A;  5HEG A;  3RIF A;  2BYR A;  4X5T A;  2WNC A;  4EZ1 A;  3TLT A;  5IUX A;  2YME A;  2UZ6 A;  3RI5 A;  5TVC A;  4COF A;  4A98 A;  2XQ8 A;  3JAF A;  5FJV A;  2BG9 E;  4QH4 A;  2Y7Y A;  4IRE A;  5L47 A;  2BR7 A;  4D01 A;  4ZK1 A;  4UM3 A;  4QAC A;  2YOE A;  2ZJV A;  4AFH A;  4UM1 A;  5J5F A;  4DBM A;  4ILC A;  3SQ6 A;  5LXB A;  2W8G A;  4A97 A;  4BFQ A;  2X00 A;  4IL4 A;  2BYN A;  3WTK A;  2WN9 A;  4UY2 A;  4ZRU A;  3UU8 A;  4QH1 A;  3TLU A;  5J5I A;  3C84 A;  4HFC A;  4QAB A;  2BG9 C;  2BG9 B;  1UX2 A;  1I9B A;  3GUA A;  3EI0 A;  5CFB A;  2BR8 A;  4IL9 A;  4TWH A;  2XQ5 A;  3RQU A;  4ALX A;  3EAM A;  3RHW A;  4ZJT A;  5L4H A;  5BW2 A;  3JAE A;  2XQ7 A;  3P50 A;  5AFH A;  2Y56 A;  2YKS A;  3T4M A;  2WZY A;  4AFG A;  5L4E A;  2XZ6 A;  3JAD A;  3EHZ A;  2PGZ A;  3PEO A;  5AFK A;  4QAA A;  2XQ3 A;  4ZK4 A;  3WTJ A;  2XQ4 A;  3UQ4 A;  3U8M A;  4NPP A;  4ILB A;  4TNV A;  2WNJ A;  3IGQ A;  4FRR A;  4HQP A;  5J5G A;  4TWD A;  4ZR6 A;  2XZ5 A;  2Y58 A;  5HCM A;  3WTI A;  4F8H A;  5BRX A;  2QC1 B;  2Y54 A;  4LMJ A;  5JME A;  4UM3 S;  4XHE A;  5AFJ A;  5AIN A;  4LML A;  2XQ9 A;  4UM3 P;  5HCJ A;  2W8F A;  4TNW A;  5LG3 A;  4Z91 A;  4HFH A;  3U8L A;  5SYO A;  3SIO A;  3ZDH A;  5J0Z A;  3SH1 A;  5AFM B;  3U8J A;  2XYS A;  2BYS A;  5AFL A; 
#chains in the Genus database with same CATH topology
 3WIP A;  4QH5 A;  5HEU A;  3ZDG A;  4XK9 A;  3TLW A;  3WTL A;  4ILA A;  3LSV A;  4ZZC A;  2XNU A;  2BG9 A;  2C9T A;  3SQ9 A;  4HFD A;  3UQ7 A;  4ZJS A;  4NZB A;  3U8N A;  5KE4 A;  2Y57 A;  3TLV A;  3RIA A;  2XNV A;  3UU6 A;  1UV6 A;  4UXU A;  4PIR A;  2BJ0 A;  5J5H A;  5KZU A;  3WTN A;  3P4W A;  2BYP A;  3ZKR A;  2X00 D;  5HEJ A;  4HFI A;  3TLS A;  5BP0 A;  4WV9 A;  4HFB A;  2XQA A;  2XQ6 A;  1UW6 A;  2VL0 A;  3RQW A;  3WTH A;  2XNT A;  2YN6 A;  4LMK A;  4Z90 A;  3UU5 A;  5AFM A;  4ZZB A;  3UUB A;  5HEO A;  2ZJU A;  2WNL A;  3U8K A;  3WTM A;  5AFN A;  2BYQ A;  4HFE A;  3WTO A;  2PH9 A;  2XYT A;  4BQT A;  2YMD A;  3C79 A;  4AFT A;  4TWF A;  5CO5 A;  3UU3 A;  3UU4 A;  3PMZ A;  5HEH A;  4B5D A;  5HEG A;  3RIF A;  2BYR A;  4X5T A;  2WNC A;  4EZ1 A;  3TLT A;  5IUX A;  2YME A;  2UZ6 A;  3RI5 A;  5TVC A;  4COF A;  4A98 A;  2XQ8 A;  3JAF A;  5FJV A;  2BG9 E;  4QH4 A;  2Y7Y A;  4IRE A;  5L47 A;  2BR7 A;  4D01 A;  4ZK1 A;  4UM3 A;  4QAC A;  2YOE A;  2ZJV A;  4AFH A;  4UM1 A;  5J5F A;  4DBM A;  4ILC A;  3SQ6 A;  5LXB A;  2W8G A;  4A97 A;  4BFQ A;  2X00 A;  4IL4 A;  2BYN A;  3WTK A;  2WN9 A;  4UY2 A;  4ZRU A;  3UU8 A;  4QH1 A;  3TLU A;  5J5I A;  3C84 A;  4HFC A;  4QAB A;  2BG9 C;  2BG9 B;  1UX2 A;  1I9B A;  3GUA A;  3EI0 A;  5CFB A;  2BR8 A;  4IL9 A;  4TWH A;  2XQ5 A;  3RQU A;  4ALX A;  3EAM A;  3RHW A;  4ZJT A;  5L4H A;  5BW2 A;  3JAE A;  2XQ7 A;  3P50 A;  5AFH A;  2Y56 A;  2YKS A;  3T4M A;  2WZY A;  4AFG A;  5L4E A;  2XZ6 A;  3JAD A;  3EHZ A;  2PGZ A;  3PEO A;  5AFK A;  4QAA A;  2XQ3 A;  4ZK4 A;  3WTJ A;  2XQ4 A;  3UQ4 A;  3U8M A;  4NPP A;  4ILB A;  4TNV A;  2WNJ A;  3IGQ A;  4FRR A;  4HQP A;  5J5G A;  4TWD A;  4ZR6 A;  2XZ5 A;  2Y58 A;  5HCM A;  3WTI A;  4F8H A;  5BRX A;  2QC1 B;  2Y54 A;  4LMJ A;  5JME A;  4UM3 S;  4XHE A;  5AFJ A;  5AIN A;  4LML A;  2XQ9 A;  4UM3 P;  5HCJ A;  2W8F A;  4TNW A;  5LG3 A;  4Z91 A;  4HFH A;  3U8L A;  5SYO A;  3SIO A;  3ZDH A;  5J0Z A;  3SH1 A;  5AFM B;  3U8J A;  2XYS A;  2BYS A;  5AFL A; 
#chains in the Genus database with same CATH homology
 3WIP A;  4QH5 A;  5HEU A;  3ZDG A;  4XK9 A;  3TLW A;  3WTL A;  4ILA A;  3LSV A;  4ZZC A;  2XNU A;  2BG9 A;  2C9T A;  3SQ9 A;  4HFD A;  3UQ7 A;  4ZJS A;  4NZB A;  3U8N A;  5KE4 A;  2Y57 A;  3TLV A;  3RIA A;  2XNV A;  3UU6 A;  1UV6 A;  4UXU A;  4PIR A;  2BJ0 A;  5J5H A;  5KZU A;  3WTN A;  3P4W A;  2BYP A;  3ZKR A;  2X00 D;  5HEJ A;  4HFI A;  3TLS A;  5BP0 A;  4WV9 A;  4HFB A;  2XQA A;  2XQ6 A;  1UW6 A;  2VL0 A;  3RQW A;  3WTH A;  2XNT A;  2YN6 A;  4LMK A;  4Z90 A;  3UU5 A;  5AFM A;  4ZZB A;  3UUB A;  5HEO A;  2ZJU A;  2WNL A;  3U8K A;  3WTM A;  5AFN A;  2BYQ A;  4HFE A;  3WTO A;  2PH9 A;  2XYT A;  4BQT A;  2YMD A;  3C79 A;  4AFT A;  4TWF A;  5CO5 A;  3UU3 A;  3UU4 A;  3PMZ A;  5HEH A;  4B5D A;  5HEG A;  3RIF A;  2BYR A;  4X5T A;  2WNC A;  4EZ1 A;  3TLT A;  5IUX A;  2YME A;  2UZ6 A;  3RI5 A;  5TVC A;  4COF A;  4A98 A;  2XQ8 A;  3JAF A;  5FJV A;  2BG9 E;  4QH4 A;  2Y7Y A;  4IRE A;  5L47 A;  2BR7 A;  4D01 A;  4ZK1 A;  4UM3 A;  4QAC A;  2YOE A;  2ZJV A;  4AFH A;  4UM1 A;  5J5F A;  4DBM A;  4ILC A;  3SQ6 A;  5LXB A;  2W8G A;  4A97 A;  4BFQ A;  2X00 A;  4IL4 A;  2BYN A;  3WTK A;  2WN9 A;  4UY2 A;  4ZRU A;  3UU8 A;  4QH1 A;  3TLU A;  5J5I A;  3C84 A;  4HFC A;  4QAB A;  2BG9 C;  2BG9 B;  1UX2 A;  1I9B A;  3GUA A;  3EI0 A;  5CFB A;  2BR8 A;  4IL9 A;  4TWH A;  2XQ5 A;  3RQU A;  4ALX A;  3EAM A;  3RHW A;  4ZJT A;  5L4H A;  5BW2 A;  3JAE A;  2XQ7 A;  3P50 A;  5AFH A;  2Y56 A;  2YKS A;  3T4M A;  2WZY A;  4AFG A;  5L4E A;  2XZ6 A;  3JAD A;  3EHZ A;  2PGZ A;  3PEO A;  5AFK A;  4QAA A;  2XQ3 A;  4ZK4 A;  3WTJ A;  2XQ4 A;  3UQ4 A;  3U8M A;  4NPP A;  4ILB A;  4TNV A;  2WNJ A;  3IGQ A;  4FRR A;  4HQP A;  5J5G A;  4TWD A;  4ZR6 A;  2XZ5 A;  2Y58 A;  5HCM A;  3WTI A;  4F8H A;  5BRX A;  2QC1 B;  2Y54 A;  4LMJ A;  5JME A;  4UM3 S;  4XHE A;  5AFJ A;  5AIN A;  4LML A;  2XQ9 A;  4UM3 P;  5HCJ A;  2W8F A;  4TNW A;  5LG3 A;  4Z91 A;  4HFH A;  3U8L A;  5SYO A;  3SIO A;  3ZDH A;  5J0Z A;  3SH1 A;  5AFM B;  3U8J A;  2XYS A;  2BYS A;  5AFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...