2XNVA

Acetylcholine binding protein (achbp) as template for hierarchical in silico screening procedures to identify structurally novel ligands for the nicotinic receptors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Acetylcholine Binding Protein (Achbp) as Template for Hierarchical in Silico Screening Procedures to Identify Structurally Novel Ligands for the Nicotinic Receptors.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 48
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xnvA00
4BQTA 4BFQA 1I9BA 5LXBA 2PGZA 2BG9E 4UM3A 4F8HA 3C84A 3C79A 4Z90A 5JMEA 2WNCA 5HCMA 3WTNA 4COFA 4ILBA 2BYRA 4ZJSA 4WV9A 3UU6A 4TWDA 2BG9B 5HEHA 2YMDA 3JAFA 3WTMA 3WTHA 3TLTA 4NZBA 3SQ6A 5BP0A 3SIOA 2C9TA 3UUBA 3RI5A 3EHZA 3UU3A 2BYNA 4UXUA 4QH4A 3SQ9A 5L4EA 3ZDGA 2XNUA 2BYSA 2YKSA 2XQ6A 3P4WA 2W8GA 4QABA 3WTLA 4EZ1A 2XZ6A 3WIPA 2XYSA 4TNWA 4Z91A 2WNLA 5AFMB 5AFLA 4QAAA 5HEUA 2Y54A 2Y58A 2XQ3A 2PH9A 4QACA 3EAMA 2X00A 4XK9A 3P50A 2ZJVA 3IGQA 3PEOA 4HFBA 4UM3S 4QH5A 3WTOA 3PMZA 2BG9C 1UW6A 4HFDA 3RIFA 4TNVA 2QC1B 4A98A 5J5GA 4TWFA 4B5DA 5IUXA 2YMEA 4XHEA 2WNJA 4A97A 4DBMA 3JADA 4PIRA 2BG9A 2X00D 5KZUA 5L47A 3JAEA 1UX2A 2Y56A 4NPPA 3UU8A 5AFJA 5HEGA 5HCJA 4IL9A 3WTKA 4ALXA 4ZZBA 3RQUA 1UV6A 4FRRA 5TVCA 3RIAA 4ILAA 5SYOA 3WTJA 4IL4A 2WZYA 4IREA 2W8FA 3GUAA 2XQAA 5AFMA 2BR7A 2Y7YA 3U8LA 5AFHA 3EI0A 3TLUA 2UZ6A 3TLVA 5FJVA 3UQ7A 4LMJA 5J0ZA 5J5HA 2XQ4A 3U8NA 5AINA 4ZJTA 4HFHA 2BYQA 5BW2A 4AFTA 2ZJUA 2YN6A 3UU4A 5CO5A 2XQ8A 3U8MA 2BYPA 4X5TA 2YOEA 3SH1A 3RQWA 5LG3A 2XNTA 4ZK4A 5J5FA 2WN9A 2XZ5A 4AFGA 4HQPA 3TLWA 2XNVA 4ZZCA 2BJ0A 2VL0A 4UM1A 4UY2A 4ZR6A 5L4HA 2XYTA 4UM3P 4AFHA 3UU5A 4ZRUA 5HEOA 2XQ5A 2BR8A 4ZK1A 3WTIA 3RHWA 4HFIA 3T4MA 3UQ4A 2XQ9A 2XQ7A 5CFBA 5KE4A 4QH1A 3ZDHA 4ILCA 5AFNA 3ZKRA 5AFKA 4D01A 2Y57A 4HFCA 4LMKA 4LMLA 4TWHA 3U8KA 4HFEA 5BRXA 5J5IA 3TLSA 5HEJA 3LSVA 3U8JA
chains in the Genus database with same CATH superfamily
4BQTA 4BFQA 1I9BA 5LXBA 2PGZA 2BG9E 4UM3A 4F8HA 3C84A 3C79A 4Z90A 5JMEA 2WNCA 5HCMA 3WTNA 4COFA 4ILBA 2BYRA 4ZJSA 4WV9A 3UU6A 4TWDA 2BG9B 5HEHA 2YMDA 3JAFA 3WTMA 3WTHA 3TLTA 4NZBA 3SQ6A 5BP0A 3SIOA 2C9TA 3UUBA 3RI5A 3EHZA 3UU3A 2BYNA 4UXUA 4QH4A 3SQ9A 5L4EA 3ZDGA 2XNUA 2BYSA 2YKSA 2XQ6A 3P4WA 2W8GA 4QABA 3WTLA 4EZ1A 2XZ6A 3WIPA 2XYSA 4TNWA 4Z91A 2WNLA 5AFMB 5AFLA 4QAAA 5HEUA 2Y54A 2Y58A 2XQ3A 2PH9A 4QACA 3EAMA 2X00A 4XK9A 3P50A 2ZJVA 3IGQA 3PEOA 4HFBA 4UM3S 4QH5A 3WTOA 3PMZA 2BG9C 1UW6A 4HFDA 3RIFA 4TNVA 2QC1B 4A98A 5J5GA 4TWFA 4B5DA 5IUXA 2YMEA 4XHEA 2WNJA 4A97A 4DBMA 3JADA 4PIRA 2BG9A 2X00D 5KZUA 5L47A 3JAEA 1UX2A 2Y56A 4NPPA 3UU8A 5AFJA 5HEGA 5HCJA 4IL9A 3WTKA 4ALXA 4ZZBA 3RQUA 1UV6A 4FRRA 5TVCA 3RIAA 4ILAA 5SYOA 3WTJA 4IL4A 2WZYA 4IREA 2W8FA 3GUAA 2XQAA 5AFMA 2BR7A 2Y7YA 3U8LA 5AFHA 3EI0A 3TLUA 2UZ6A 3TLVA 5FJVA 3UQ7A 4LMJA 5J0ZA 5J5HA 2XQ4A 3U8NA 5AINA 4ZJTA 4HFHA 2BYQA 5BW2A 4AFTA 2ZJUA 2YN6A 3UU4A 5CO5A 2XQ8A 3U8MA 2BYPA 4X5TA 2YOEA 3SH1A 3RQWA 5LG3A 2XNTA 4ZK4A 5J5FA 2WN9A 2XZ5A 4AFGA 4HQPA 3TLWA 2XNVA 4ZZCA 2BJ0A 2VL0A 4UM1A 4UY2A 4ZR6A 5L4HA 2XYTA 4UM3P 4AFHA 3UU5A 4ZRUA 5HEOA 2XQ5A 2BR8A 4ZK1A 3WTIA 3RHWA 4HFIA 3T4MA 3UQ4A 2XQ9A 2XQ7A 5CFBA 5KE4A 4QH1A 3ZDHA 4ILCA 5AFNA 3ZKRA 5AFKA 4D01A 2Y57A 4HFCA 4LMKA 4LMLA 4TWHA 3U8KA 4HFEA 5BRXA 5J5IA 3TLSA 5HEJA 3LSVA 3U8JA
chains in the Genus database with same CATH topology
4BQTA 4BFQA 1I9BA 5LXBA 2PGZA 2BG9E 4UM3A 4F8HA 3C84A 3C79A 4Z90A 5JMEA 2WNCA 5HCMA 3WTNA 4COFA 4ILBA 2BYRA 4ZJSA 4WV9A 3UU6A 4TWDA 2BG9B 5HEHA 2YMDA 3JAFA 3WTMA 3WTHA 3TLTA 4NZBA 3SQ6A 5BP0A 3SIOA 2C9TA 3UUBA 3RI5A 3EHZA 3UU3A 2BYNA 4UXUA 4QH4A 3SQ9A 5L4EA 3ZDGA 2XNUA 2BYSA 2YKSA 2XQ6A 3P4WA 2W8GA 4QABA 3WTLA 4EZ1A 2XZ6A 3WIPA 2XYSA 4TNWA 4Z91A 2WNLA 5AFMB 5AFLA 4QAAA 5HEUA 2Y54A 2Y58A 2XQ3A 2PH9A 4QACA 3EAMA 2X00A 4XK9A 3P50A 2ZJVA 3IGQA 3PEOA 4HFBA 4UM3S 4QH5A 3WTOA 3PMZA 2BG9C 1UW6A 4HFDA 3RIFA 4TNVA 2QC1B 4A98A 5J5GA 4TWFA 4B5DA 5IUXA 2YMEA 4XHEA 2WNJA 4A97A 4DBMA 3JADA 4PIRA 2BG9A 2X00D 5KZUA 5L47A 3JAEA 1UX2A 2Y56A 4NPPA 3UU8A 5AFJA 5HEGA 5HCJA 4IL9A 3WTKA 4ALXA 4ZZBA 3RQUA 1UV6A 4FRRA 5TVCA 3RIAA 4ILAA 5SYOA 3WTJA 4IL4A 2WZYA 4IREA 2W8FA 3GUAA 2XQAA 5AFMA 2BR7A 2Y7YA 3U8LA 5AFHA 3EI0A 3TLUA 2UZ6A 3TLVA 5FJVA 3UQ7A 4LMJA 5J0ZA 5J5HA 2XQ4A 3U8NA 5AINA 4ZJTA 4HFHA 2BYQA 5BW2A 4AFTA 2ZJUA 2YN6A 3UU4A 5CO5A 2XQ8A 3U8MA 2BYPA 4X5TA 2YOEA 3SH1A 3RQWA 5LG3A 2XNTA 4ZK4A 5J5FA 2WN9A 2XZ5A 4AFGA 4HQPA 3TLWA 2XNVA 4ZZCA 2BJ0A 2VL0A 4UM1A 4UY2A 4ZR6A 5L4HA 2XYTA 4UM3P 4AFHA 3UU5A 4ZRUA 5HEOA 2XQ5A 2BR8A 4ZK1A 3WTIA 3RHWA 4HFIA 3T4MA 3UQ4A 2XQ9A 2XQ7A 5CFBA 5KE4A 4QH1A 3ZDHA 4ILCA 5AFNA 3ZKRA 5AFKA 4D01A 2Y57A 4HFCA 4LMKA 4LMLA 4TWHA 3U8KA 4HFEA 5BRXA 5J5IA 3TLSA 5HEJA 3LSVA 3U8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQT A;  4BFQ A;  1I9B A;  5LXB A;  2PGZ A;  2BG9 E;  4UM3 A;  4F8H A;  3C84 A;  3C79 A;  4Z90 A;  5JME A;  2WNC A;  5HCM A;  3WTN A;  4COF A;  4ILB A;  2BYR A;  4ZJS A;  4WV9 A;  3UU6 A;  4TWD A;  2BG9 B;  5HEH A;  2YMD A;  3JAF A;  3WTM A;  3WTH A;  3TLT A;  4NZB A;  3SQ6 A;  5BP0 A;  3SIO A;  2C9T A;  3UUB A;  3RI5 A;  3EHZ A;  3UU3 A;  2BYN A;  4UXU A;  4QH4 A;  3SQ9 A;  5L4E A;  3ZDG A;  2XNU A;  2BYS A;  2YKS A;  2XQ6 A;  3P4W A;  2W8G A;  4QAB A;  3WTL A;  4EZ1 A;  2XZ6 A;  3WIP A;  2XYS A;  4TNW A;  4Z91 A;  2WNL A;  5AFM B;  5AFL A;  4QAA A;  5HEU A;  2Y54 A;  2Y58 A;  2XQ3 A;  2PH9 A;  4QAC A;  3EAM A;  2X00 A;  4XK9 A;  3P50 A;  2ZJV A;  3IGQ A;  3PEO A;  4HFB A;  4UM3 S;  4QH5 A;  3WTO A;  3PMZ A;  2BG9 C;  1UW6 A;  4HFD A;  3RIF A;  4TNV A;  2QC1 B;  4A98 A;  5J5G A;  4TWF A;  4B5D A;  5IUX A;  2YME A;  4XHE A;  2WNJ A;  4A97 A;  4DBM A;  3JAD A;  4PIR A;  2BG9 A;  2X00 D;  5KZU A;  5L47 A;  3JAE A;  1UX2 A;  2Y56 A;  4NPP A;  3UU8 A;  5AFJ A;  5HEG A;  5HCJ A;  4IL9 A;  3WTK A;  4ALX A;  4ZZB A;  3RQU A;  1UV6 A;  4FRR A;  5TVC A;  3RIA A;  4ILA A;  5SYO A;  3WTJ A;  4IL4 A;  2WZY A;  4IRE A;  2W8F A;  3GUA A;  2XQA A;  5AFM A;  2BR7 A;  2Y7Y A;  3U8L A;  5AFH A;  3EI0 A;  3TLU A;  2UZ6 A;  3TLV A;  5FJV A;  3UQ7 A;  4LMJ A;  5J0Z A;  5J5H A;  2XQ4 A;  3U8N A;  5AIN A;  4ZJT A;  4HFH A;  2BYQ A;  5BW2 A;  4AFT A;  2ZJU A;  2YN6 A;  3UU4 A;  5CO5 A;  2XQ8 A;  3U8M A;  2BYP A;  4X5T A;  2YOE A;  3SH1 A;  3RQW A;  5LG3 A;  2XNT A;  4ZK4 A;  5J5F A;  2WN9 A;  2XZ5 A;  4AFG A;  4HQP A;  3TLW A;  2XNV A;  4ZZC A;  2BJ0 A;  2VL0 A;  4UM1 A;  4UY2 A;  4ZR6 A;  5L4H A;  2XYT A;  4UM3 P;  4AFH A;  3UU5 A;  4ZRU A;  5HEO A;  2XQ5 A;  2BR8 A;  4ZK1 A;  3WTI A;  3RHW A;  4HFI A;  3T4M A;  3UQ4 A;  2XQ9 A;  2XQ7 A;  5CFB A;  5KE4 A;  4QH1 A;  3ZDH A;  4ILC A;  5AFN A;  3ZKR A;  5AFK A;  4D01 A;  2Y57 A;  4HFC A;  4LMK A;  4LML A;  4TWH A;  3U8K A;  4HFE A;  5BRX A;  5J5I A;  3TLS A;  5HEJ A;  3LSV A;  3U8J A; 
#chains in the Genus database with same CATH topology
 4BQT A;  4BFQ A;  1I9B A;  5LXB A;  2PGZ A;  2BG9 E;  4UM3 A;  4F8H A;  3C84 A;  3C79 A;  4Z90 A;  5JME A;  2WNC A;  5HCM A;  3WTN A;  4COF A;  4ILB A;  2BYR A;  4ZJS A;  4WV9 A;  3UU6 A;  4TWD A;  2BG9 B;  5HEH A;  2YMD A;  3JAF A;  3WTM A;  3WTH A;  3TLT A;  4NZB A;  3SQ6 A;  5BP0 A;  3SIO A;  2C9T A;  3UUB A;  3RI5 A;  3EHZ A;  3UU3 A;  2BYN A;  4UXU A;  4QH4 A;  3SQ9 A;  5L4E A;  3ZDG A;  2XNU A;  2BYS A;  2YKS A;  2XQ6 A;  3P4W A;  2W8G A;  4QAB A;  3WTL A;  4EZ1 A;  2XZ6 A;  3WIP A;  2XYS A;  4TNW A;  4Z91 A;  2WNL A;  5AFM B;  5AFL A;  4QAA A;  5HEU A;  2Y54 A;  2Y58 A;  2XQ3 A;  2PH9 A;  4QAC A;  3EAM A;  2X00 A;  4XK9 A;  3P50 A;  2ZJV A;  3IGQ A;  3PEO A;  4HFB A;  4UM3 S;  4QH5 A;  3WTO A;  3PMZ A;  2BG9 C;  1UW6 A;  4HFD A;  3RIF A;  4TNV A;  2QC1 B;  4A98 A;  5J5G A;  4TWF A;  4B5D A;  5IUX A;  2YME A;  4XHE A;  2WNJ A;  4A97 A;  4DBM A;  3JAD A;  4PIR A;  2BG9 A;  2X00 D;  5KZU A;  5L47 A;  3JAE A;  1UX2 A;  2Y56 A;  4NPP A;  3UU8 A;  5AFJ A;  5HEG A;  5HCJ A;  4IL9 A;  3WTK A;  4ALX A;  4ZZB A;  3RQU A;  1UV6 A;  4FRR A;  5TVC A;  3RIA A;  4ILA A;  5SYO A;  3WTJ A;  4IL4 A;  2WZY A;  4IRE A;  2W8F A;  3GUA A;  2XQA A;  5AFM A;  2BR7 A;  2Y7Y A;  3U8L A;  5AFH A;  3EI0 A;  3TLU A;  2UZ6 A;  3TLV A;  5FJV A;  3UQ7 A;  4LMJ A;  5J0Z A;  5J5H A;  2XQ4 A;  3U8N A;  5AIN A;  4ZJT A;  4HFH A;  2BYQ A;  5BW2 A;  4AFT A;  2ZJU A;  2YN6 A;  3UU4 A;  5CO5 A;  2XQ8 A;  3U8M A;  2BYP A;  4X5T A;  2YOE A;  3SH1 A;  3RQW A;  5LG3 A;  2XNT A;  4ZK4 A;  5J5F A;  2WN9 A;  2XZ5 A;  4AFG A;  4HQP A;  3TLW A;  2XNV A;  4ZZC A;  2BJ0 A;  2VL0 A;  4UM1 A;  4UY2 A;  4ZR6 A;  5L4H A;  2XYT A;  4UM3 P;  4AFH A;  3UU5 A;  4ZRU A;  5HEO A;  2XQ5 A;  2BR8 A;  4ZK1 A;  3WTI A;  3RHW A;  4HFI A;  3T4M A;  3UQ4 A;  2XQ9 A;  2XQ7 A;  5CFB A;  5KE4 A;  4QH1 A;  3ZDH A;  4ILC A;  5AFN A;  3ZKR A;  5AFK A;  4D01 A;  2Y57 A;  4HFC A;  4LMK A;  4LML A;  4TWH A;  3U8K A;  4HFE A;  5BRX A;  5J5I A;  3TLS A;  5HEJ A;  3LSV A;  3U8J A; 
#chains in the Genus database with same CATH homology
 4BQT A;  4BFQ A;  1I9B A;  5LXB A;  2PGZ A;  2BG9 E;  4UM3 A;  4F8H A;  3C84 A;  3C79 A;  4Z90 A;  5JME A;  2WNC A;  5HCM A;  3WTN A;  4COF A;  4ILB A;  2BYR A;  4ZJS A;  4WV9 A;  3UU6 A;  4TWD A;  2BG9 B;  5HEH A;  2YMD A;  3JAF A;  3WTM A;  3WTH A;  3TLT A;  4NZB A;  3SQ6 A;  5BP0 A;  3SIO A;  2C9T A;  3UUB A;  3RI5 A;  3EHZ A;  3UU3 A;  2BYN A;  4UXU A;  4QH4 A;  3SQ9 A;  5L4E A;  3ZDG A;  2XNU A;  2BYS A;  2YKS A;  2XQ6 A;  3P4W A;  2W8G A;  4QAB A;  3WTL A;  4EZ1 A;  2XZ6 A;  3WIP A;  2XYS A;  4TNW A;  4Z91 A;  2WNL A;  5AFM B;  5AFL A;  4QAA A;  5HEU A;  2Y54 A;  2Y58 A;  2XQ3 A;  2PH9 A;  4QAC A;  3EAM A;  2X00 A;  4XK9 A;  3P50 A;  2ZJV A;  3IGQ A;  3PEO A;  4HFB A;  4UM3 S;  4QH5 A;  3WTO A;  3PMZ A;  2BG9 C;  1UW6 A;  4HFD A;  3RIF A;  4TNV A;  2QC1 B;  4A98 A;  5J5G A;  4TWF A;  4B5D A;  5IUX A;  2YME A;  4XHE A;  2WNJ A;  4A97 A;  4DBM A;  3JAD A;  4PIR A;  2BG9 A;  2X00 D;  5KZU A;  5L47 A;  3JAE A;  1UX2 A;  2Y56 A;  4NPP A;  3UU8 A;  5AFJ A;  5HEG A;  5HCJ A;  4IL9 A;  3WTK A;  4ALX A;  4ZZB A;  3RQU A;  1UV6 A;  4FRR A;  5TVC A;  3RIA A;  4ILA A;  5SYO A;  3WTJ A;  4IL4 A;  2WZY A;  4IRE A;  2W8F A;  3GUA A;  2XQA A;  5AFM A;  2BR7 A;  2Y7Y A;  3U8L A;  5AFH A;  3EI0 A;  3TLU A;  2UZ6 A;  3TLV A;  5FJV A;  3UQ7 A;  4LMJ A;  5J0Z A;  5J5H A;  2XQ4 A;  3U8N A;  5AIN A;  4ZJT A;  4HFH A;  2BYQ A;  5BW2 A;  4AFT A;  2ZJU A;  2YN6 A;  3UU4 A;  5CO5 A;  2XQ8 A;  3U8M A;  2BYP A;  4X5T A;  2YOE A;  3SH1 A;  3RQW A;  5LG3 A;  2XNT A;  4ZK4 A;  5J5F A;  2WN9 A;  2XZ5 A;  4AFG A;  4HQP A;  3TLW A;  2XNV A;  4ZZC A;  2BJ0 A;  2VL0 A;  4UM1 A;  4UY2 A;  4ZR6 A;  5L4H A;  2XYT A;  4UM3 P;  4AFH A;  3UU5 A;  4ZRU A;  5HEO A;  2XQ5 A;  2BR8 A;  4ZK1 A;  3WTI A;  3RHW A;  4HFI A;  3T4M A;  3UQ4 A;  2XQ9 A;  2XQ7 A;  5CFB A;  5KE4 A;  4QH1 A;  3ZDH A;  4ILC A;  5AFN A;  3ZKR A;  5AFK A;  4D01 A;  2Y57 A;  4HFC A;  4LMK A;  4LML A;  4TWH A;  3U8K A;  4HFE A;  5BRX A;  5J5I A;  3TLS A;  5HEJ A;  3LSV A;  3U8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...