2XNVA

Acetylcholine binding protein (achbp) as template for hierarchical in silico screening procedures to identify structurally novel ligands for the nicotinic receptors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Acetylcholine Binding Protein (Achbp) as Template for Hierarchical in Silico Screening Procedures to Identify Structurally Novel Ligands for the Nicotinic Receptors.
pubmed doi rcsb
source organism Aplysia californica
total genus 48
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xnvA00
3RIFA 4TWDA 2XQ7A 5AFJA 3WTLA 3WTJA 1I9BA 3PEOA 4A98A 4D01A 3RQWA 2BJ0A 2XZ6A 5HCMA 4AFGA 2BG9A 2WZYA 3TLVA 5J5HA 4ZZBA 4XK9A 4XHEA 3UU4A 4ILAA 5KE4A 3IGQA 5J5GA 2Y58A 4HFCA 3SH1A 4BFQA 3U8LA 2XYTA 2WNLA 4TNWA 4UM3A 5LXBA 4HFBA 2YOEA 4QH4A 5JMEA 2X00D 2ZJUA 2XQ3A 3P4WA 3TLTA 3RHWA 5AINA 4NZBA 5IUXA 5AFLA 3TLSA 3WTIA 4FRRA 2XNVA 5BP0A 5L4HA 5L47A 4ZK4A 4HFEA 4BQTA 4EZ1A 4ZRUA 5SYOA 2BG9C 2WN9A 5HCJA 3JAFA 4UM3S 2PGZA 4ZK1A 2BG9B 3UU6A 5HEJA 5J5IA 2XQAA 3EAMA 3GUAA 2Y54A 3U8KA 2YN6A 4TNVA 3WTNA 4HFHA 3WTKA 3TLWA 3WTOA 5J5FA 5AFMA 3EI0A 4Z90A 2WNJA 3JADA 3SQ9A 1UV6A 2VL0A 1UX2A 4X5TA 2YKSA 2XQ4A 4A97A 4LMJA 5HEHA 4UM3P 5L4EA 2BYPA 2XQ5A 2XQ8A 4HFIA 3SIOA 4B5DA 3JAEA 2XYSA 4IREA 5AFNA 4UM1A 3U8NA 2X00A 2C9TA 2YMEA 4F8HA 3UQ7A 3UU5A 4ZR6A 3WIPA 4Z91A 2QC1B 2BYNA 4ALXA 3UU3A 3WTMA 5J0ZA 4LMKA 3PMZA 5BW2A 2XNTA 3RI5A 3P50A 3UU8A 5AFMB 3ZDGA 3C84A 2BYRA 3U8JA 2Y7YA 5BRXA 4ZJSA 3SQ6A 4QABA 5CFBA 4TWHA 4AFHA 5LG3A 1UW6A 4DBMA 2XQ9A 2BYSA 5FJVA 4COFA 3EHZA 3LSVA 3C79A 2UZ6A 3RQUA 3WTHA 2WNCA 2BR8A 2Y57A 2XZ5A 2YMDA 4QH1A 2W8FA 5TVCA 4NPPA 4UXUA 4ILBA 5HEGA 4AFTA 3U8MA 4LMLA 4ZZCA 5KZUA 2BYQA 2W8GA 2ZJVA 2XNUA 3UQ4A 2BR7A 4PIRA 4QAAA 5HEOA 5HEUA 4QH5A 3T4MA 4QACA 3ZDHA 4TWFA 4HQPA 4ILCA 2PH9A 5AFKA 3RIAA 4IL9A 4UY2A 5AFHA 3UUBA 2Y56A 4IL4A 4ZJTA 5CO5A 3ZKRA 2XQ6A 4WV9A 2BG9E 3TLUA 4HFDA
chains in the Genus database with same CATH superfamily
3RIFA 4TWDA 2XQ7A 5AFJA 3WTLA 3WTJA 1I9BA 3PEOA 4A98A 4D01A 3RQWA 2BJ0A 2XZ6A 5HCMA 4AFGA 2BG9A 2WZYA 3TLVA 5J5HA 4ZZBA 4XK9A 4XHEA 3UU4A 4ILAA 5KE4A 3IGQA 5J5GA 2Y58A 4HFCA 3SH1A 4BFQA 3U8LA 2XYTA 2WNLA 4TNWA 4UM3A 5LXBA 4HFBA 2YOEA 4QH4A 5JMEA 2X00D 2ZJUA 2XQ3A 3P4WA 3TLTA 3RHWA 5AINA 4NZBA 5IUXA 5AFLA 3TLSA 3WTIA 4FRRA 2XNVA 5BP0A 5L4HA 5L47A 4ZK4A 4HFEA 4BQTA 4EZ1A 4ZRUA 5SYOA 2BG9C 2WN9A 5HCJA 3JAFA 4UM3S 2PGZA 4ZK1A 2BG9B 3UU6A 5HEJA 5J5IA 2XQAA 3EAMA 3GUAA 2Y54A 3U8KA 2YN6A 4TNVA 3WTNA 4HFHA 3WTKA 3TLWA 3WTOA 5J5FA 5AFMA 3EI0A 4Z90A 2WNJA 3JADA 3SQ9A 1UV6A 2VL0A 1UX2A 4X5TA 2YKSA 2XQ4A 4A97A 4LMJA 5HEHA 4UM3P 5L4EA 2BYPA 2XQ5A 2XQ8A 4HFIA 3SIOA 4B5DA 3JAEA 2XYSA 4IREA 5AFNA 4UM1A 3U8NA 2X00A 2C9TA 2YMEA 4F8HA 3UQ7A 3UU5A 4ZR6A 3WIPA 4Z91A 2QC1B 2BYNA 4ALXA 3UU3A 3WTMA 5J0ZA 4LMKA 3PMZA 5BW2A 2XNTA 3RI5A 3P50A 3UU8A 5AFMB 3ZDGA 3C84A 2BYRA 3U8JA 2Y7YA 5BRXA 4ZJSA 3SQ6A 4QABA 5CFBA 4TWHA 4AFHA 5LG3A 1UW6A 4DBMA 2XQ9A 2BYSA 5FJVA 4COFA 3EHZA 3LSVA 3C79A 2UZ6A 3RQUA 3WTHA 2WNCA 2BR8A 2Y57A 2XZ5A 2YMDA 4QH1A 2W8FA 5TVCA 4NPPA 4UXUA 4ILBA 5HEGA 4AFTA 3U8MA 4LMLA 4ZZCA 5KZUA 2BYQA 2W8GA 2ZJVA 2XNUA 3UQ4A 2BR7A 4PIRA 4QAAA 5HEOA 5HEUA 4QH5A 3T4MA 4QACA 3ZDHA 4TWFA 4HQPA 4ILCA 2PH9A 5AFKA 3RIAA 4IL9A 4UY2A 5AFHA 3UUBA 2Y56A 4IL4A 4ZJTA 5CO5A 3ZKRA 2XQ6A 4WV9A 2BG9E 3TLUA 4HFDA
chains in the Genus database with same CATH topology
3RIFA 4TWDA 2XQ7A 5AFJA 3WTLA 3WTJA 1I9BA 3PEOA 4A98A 4D01A 3RQWA 2BJ0A 2XZ6A 5HCMA 4AFGA 2BG9A 2WZYA 3TLVA 5J5HA 4ZZBA 4XK9A 4XHEA 3UU4A 4ILAA 5KE4A 3IGQA 5J5GA 2Y58A 4HFCA 3SH1A 4BFQA 3U8LA 2XYTA 2WNLA 4TNWA 4UM3A 5LXBA 4HFBA 2YOEA 4QH4A 5JMEA 2X00D 2ZJUA 2XQ3A 3P4WA 3TLTA 3RHWA 5AINA 4NZBA 5IUXA 5AFLA 3TLSA 3WTIA 4FRRA 2XNVA 5BP0A 5L4HA 5L47A 4ZK4A 4HFEA 4BQTA 4EZ1A 4ZRUA 5SYOA 2BG9C 2WN9A 5HCJA 3JAFA 4UM3S 2PGZA 4ZK1A 2BG9B 3UU6A 5HEJA 5J5IA 2XQAA 3EAMA 3GUAA 2Y54A 3U8KA 2YN6A 4TNVA 3WTNA 4HFHA 3WTKA 3TLWA 3WTOA 5J5FA 5AFMA 3EI0A 4Z90A 2WNJA 3JADA 3SQ9A 1UV6A 2VL0A 1UX2A 4X5TA 2YKSA 2XQ4A 4A97A 4LMJA 5HEHA 4UM3P 5L4EA 2BYPA 2XQ5A 2XQ8A 4HFIA 3SIOA 4B5DA 3JAEA 2XYSA 4IREA 5AFNA 4UM1A 3U8NA 2X00A 2C9TA 2YMEA 4F8HA 3UQ7A 3UU5A 4ZR6A 3WIPA 4Z91A 2QC1B 2BYNA 4ALXA 3UU3A 3WTMA 5J0ZA 4LMKA 3PMZA 5BW2A 2XNTA 3RI5A 3P50A 3UU8A 5AFMB 3ZDGA 3C84A 2BYRA 3U8JA 2Y7YA 5BRXA 4ZJSA 3SQ6A 4QABA 5CFBA 4TWHA 4AFHA 5LG3A 1UW6A 4DBMA 2XQ9A 2BYSA 5FJVA 4COFA 3EHZA 3LSVA 3C79A 2UZ6A 3RQUA 3WTHA 2WNCA 2BR8A 2Y57A 2XZ5A 2YMDA 4QH1A 2W8FA 5TVCA 4NPPA 4UXUA 4ILBA 5HEGA 4AFTA 3U8MA 4LMLA 4ZZCA 5KZUA 2BYQA 2W8GA 2ZJVA 2XNUA 3UQ4A 2BR7A 4PIRA 4QAAA 5HEOA 5HEUA 4QH5A 3T4MA 4QACA 3ZDHA 4TWFA 4HQPA 4ILCA 2PH9A 5AFKA 3RIAA 4IL9A 4UY2A 5AFHA 3UUBA 2Y56A 4IL4A 4ZJTA 5CO5A 3ZKRA 2XQ6A 4WV9A 2BG9E 3TLUA 4HFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIF A;  4TWD A;  2XQ7 A;  5AFJ A;  3WTL A;  3WTJ A;  1I9B A;  3PEO A;  4A98 A;  4D01 A;  3RQW A;  2BJ0 A;  2XZ6 A;  5HCM A;  4AFG A;  2BG9 A;  2WZY A;  3TLV A;  5J5H A;  4ZZB A;  4XK9 A;  4XHE A;  3UU4 A;  4ILA A;  5KE4 A;  3IGQ A;  5J5G A;  2Y58 A;  4HFC A;  3SH1 A;  4BFQ A;  3U8L A;  2XYT A;  2WNL A;  4TNW A;  4UM3 A;  5LXB A;  4HFB A;  2YOE A;  4QH4 A;  5JME A;  2X00 D;  2ZJU A;  2XQ3 A;  3P4W A;  3TLT A;  3RHW A;  5AIN A;  4NZB A;  5IUX A;  5AFL A;  3TLS A;  3WTI A;  4FRR A;  2XNV A;  5BP0 A;  5L4H A;  5L47 A;  4ZK4 A;  4HFE A;  4BQT A;  4EZ1 A;  4ZRU A;  5SYO A;  2BG9 C;  2WN9 A;  5HCJ A;  3JAF A;  4UM3 S;  2PGZ A;  4ZK1 A;  2BG9 B;  3UU6 A;  5HEJ A;  5J5I A;  2XQA A;  3EAM A;  3GUA A;  2Y54 A;  3U8K A;  2YN6 A;  4TNV A;  3WTN A;  4HFH A;  3WTK A;  3TLW A;  3WTO A;  5J5F A;  5AFM A;  3EI0 A;  4Z90 A;  2WNJ A;  3JAD A;  3SQ9 A;  1UV6 A;  2VL0 A;  1UX2 A;  4X5T A;  2YKS A;  2XQ4 A;  4A97 A;  4LMJ A;  5HEH A;  4UM3 P;  5L4E A;  2BYP A;  2XQ5 A;  2XQ8 A;  4HFI A;  3SIO A;  4B5D A;  3JAE A;  2XYS A;  4IRE A;  5AFN A;  4UM1 A;  3U8N A;  2X00 A;  2C9T A;  2YME A;  4F8H A;  3UQ7 A;  3UU5 A;  4ZR6 A;  3WIP A;  4Z91 A;  2QC1 B;  2BYN A;  4ALX A;  3UU3 A;  3WTM A;  5J0Z A;  4LMK A;  3PMZ A;  5BW2 A;  2XNT A;  3RI5 A;  3P50 A;  3UU8 A;  5AFM B;  3ZDG A;  3C84 A;  2BYR A;  3U8J A;  2Y7Y A;  5BRX A;  4ZJS A;  3SQ6 A;  4QAB A;  5CFB A;  4TWH A;  4AFH A;  5LG3 A;  1UW6 A;  4DBM A;  2XQ9 A;  2BYS A;  5FJV A;  4COF A;  3EHZ A;  3LSV A;  3C79 A;  2UZ6 A;  3RQU A;  3WTH A;  2WNC A;  2BR8 A;  2Y57 A;  2XZ5 A;  2YMD A;  4QH1 A;  2W8F A;  5TVC A;  4NPP A;  4UXU A;  4ILB A;  5HEG A;  4AFT A;  3U8M A;  4LML A;  4ZZC A;  5KZU A;  2BYQ A;  2W8G A;  2ZJV A;  2XNU A;  3UQ4 A;  2BR7 A;  4PIR A;  4QAA A;  5HEO A;  5HEU A;  4QH5 A;  3T4M A;  4QAC A;  3ZDH A;  4TWF A;  4HQP A;  4ILC A;  2PH9 A;  5AFK A;  3RIA A;  4IL9 A;  4UY2 A;  5AFH A;  3UUB A;  2Y56 A;  4IL4 A;  4ZJT A;  5CO5 A;  3ZKR A;  2XQ6 A;  4WV9 A;  2BG9 E;  3TLU A;  4HFD A; 
#chains in the Genus database with same CATH topology
 3RIF A;  4TWD A;  2XQ7 A;  5AFJ A;  3WTL A;  3WTJ A;  1I9B A;  3PEO A;  4A98 A;  4D01 A;  3RQW A;  2BJ0 A;  2XZ6 A;  5HCM A;  4AFG A;  2BG9 A;  2WZY A;  3TLV A;  5J5H A;  4ZZB A;  4XK9 A;  4XHE A;  3UU4 A;  4ILA A;  5KE4 A;  3IGQ A;  5J5G A;  2Y58 A;  4HFC A;  3SH1 A;  4BFQ A;  3U8L A;  2XYT A;  2WNL A;  4TNW A;  4UM3 A;  5LXB A;  4HFB A;  2YOE A;  4QH4 A;  5JME A;  2X00 D;  2ZJU A;  2XQ3 A;  3P4W A;  3TLT A;  3RHW A;  5AIN A;  4NZB A;  5IUX A;  5AFL A;  3TLS A;  3WTI A;  4FRR A;  2XNV A;  5BP0 A;  5L4H A;  5L47 A;  4ZK4 A;  4HFE A;  4BQT A;  4EZ1 A;  4ZRU A;  5SYO A;  2BG9 C;  2WN9 A;  5HCJ A;  3JAF A;  4UM3 S;  2PGZ A;  4ZK1 A;  2BG9 B;  3UU6 A;  5HEJ A;  5J5I A;  2XQA A;  3EAM A;  3GUA A;  2Y54 A;  3U8K A;  2YN6 A;  4TNV A;  3WTN A;  4HFH A;  3WTK A;  3TLW A;  3WTO A;  5J5F A;  5AFM A;  3EI0 A;  4Z90 A;  2WNJ A;  3JAD A;  3SQ9 A;  1UV6 A;  2VL0 A;  1UX2 A;  4X5T A;  2YKS A;  2XQ4 A;  4A97 A;  4LMJ A;  5HEH A;  4UM3 P;  5L4E A;  2BYP A;  2XQ5 A;  2XQ8 A;  4HFI A;  3SIO A;  4B5D A;  3JAE A;  2XYS A;  4IRE A;  5AFN A;  4UM1 A;  3U8N A;  2X00 A;  2C9T A;  2YME A;  4F8H A;  3UQ7 A;  3UU5 A;  4ZR6 A;  3WIP A;  4Z91 A;  2QC1 B;  2BYN A;  4ALX A;  3UU3 A;  3WTM A;  5J0Z A;  4LMK A;  3PMZ A;  5BW2 A;  2XNT A;  3RI5 A;  3P50 A;  3UU8 A;  5AFM B;  3ZDG A;  3C84 A;  2BYR A;  3U8J A;  2Y7Y A;  5BRX A;  4ZJS A;  3SQ6 A;  4QAB A;  5CFB A;  4TWH A;  4AFH A;  5LG3 A;  1UW6 A;  4DBM A;  2XQ9 A;  2BYS A;  5FJV A;  4COF A;  3EHZ A;  3LSV A;  3C79 A;  2UZ6 A;  3RQU A;  3WTH A;  2WNC A;  2BR8 A;  2Y57 A;  2XZ5 A;  2YMD A;  4QH1 A;  2W8F A;  5TVC A;  4NPP A;  4UXU A;  4ILB A;  5HEG A;  4AFT A;  3U8M A;  4LML A;  4ZZC A;  5KZU A;  2BYQ A;  2W8G A;  2ZJV A;  2XNU A;  3UQ4 A;  2BR7 A;  4PIR A;  4QAA A;  5HEO A;  5HEU A;  4QH5 A;  3T4M A;  4QAC A;  3ZDH A;  4TWF A;  4HQP A;  4ILC A;  2PH9 A;  5AFK A;  3RIA A;  4IL9 A;  4UY2 A;  5AFH A;  3UUB A;  2Y56 A;  4IL4 A;  4ZJT A;  5CO5 A;  3ZKR A;  2XQ6 A;  4WV9 A;  2BG9 E;  3TLU A;  4HFD A; 
#chains in the Genus database with same CATH homology
 3RIF A;  4TWD A;  2XQ7 A;  5AFJ A;  3WTL A;  3WTJ A;  1I9B A;  3PEO A;  4A98 A;  4D01 A;  3RQW A;  2BJ0 A;  2XZ6 A;  5HCM A;  4AFG A;  2BG9 A;  2WZY A;  3TLV A;  5J5H A;  4ZZB A;  4XK9 A;  4XHE A;  3UU4 A;  4ILA A;  5KE4 A;  3IGQ A;  5J5G A;  2Y58 A;  4HFC A;  3SH1 A;  4BFQ A;  3U8L A;  2XYT A;  2WNL A;  4TNW A;  4UM3 A;  5LXB A;  4HFB A;  2YOE A;  4QH4 A;  5JME A;  2X00 D;  2ZJU A;  2XQ3 A;  3P4W A;  3TLT A;  3RHW A;  5AIN A;  4NZB A;  5IUX A;  5AFL A;  3TLS A;  3WTI A;  4FRR A;  2XNV A;  5BP0 A;  5L4H A;  5L47 A;  4ZK4 A;  4HFE A;  4BQT A;  4EZ1 A;  4ZRU A;  5SYO A;  2BG9 C;  2WN9 A;  5HCJ A;  3JAF A;  4UM3 S;  2PGZ A;  4ZK1 A;  2BG9 B;  3UU6 A;  5HEJ A;  5J5I A;  2XQA A;  3EAM A;  3GUA A;  2Y54 A;  3U8K A;  2YN6 A;  4TNV A;  3WTN A;  4HFH A;  3WTK A;  3TLW A;  3WTO A;  5J5F A;  5AFM A;  3EI0 A;  4Z90 A;  2WNJ A;  3JAD A;  3SQ9 A;  1UV6 A;  2VL0 A;  1UX2 A;  4X5T A;  2YKS A;  2XQ4 A;  4A97 A;  4LMJ A;  5HEH A;  4UM3 P;  5L4E A;  2BYP A;  2XQ5 A;  2XQ8 A;  4HFI A;  3SIO A;  4B5D A;  3JAE A;  2XYS A;  4IRE A;  5AFN A;  4UM1 A;  3U8N A;  2X00 A;  2C9T A;  2YME A;  4F8H A;  3UQ7 A;  3UU5 A;  4ZR6 A;  3WIP A;  4Z91 A;  2QC1 B;  2BYN A;  4ALX A;  3UU3 A;  3WTM A;  5J0Z A;  4LMK A;  3PMZ A;  5BW2 A;  2XNT A;  3RI5 A;  3P50 A;  3UU8 A;  5AFM B;  3ZDG A;  3C84 A;  2BYR A;  3U8J A;  2Y7Y A;  5BRX A;  4ZJS A;  3SQ6 A;  4QAB A;  5CFB A;  4TWH A;  4AFH A;  5LG3 A;  1UW6 A;  4DBM A;  2XQ9 A;  2BYS A;  5FJV A;  4COF A;  3EHZ A;  3LSV A;  3C79 A;  2UZ6 A;  3RQU A;  3WTH A;  2WNC A;  2BR8 A;  2Y57 A;  2XZ5 A;  2YMD A;  4QH1 A;  2W8F A;  5TVC A;  4NPP A;  4UXU A;  4ILB A;  5HEG A;  4AFT A;  3U8M A;  4LML A;  4ZZC A;  5KZU A;  2BYQ A;  2W8G A;  2ZJV A;  2XNU A;  3UQ4 A;  2BR7 A;  4PIR A;  4QAA A;  5HEO A;  5HEU A;  4QH5 A;  3T4M A;  4QAC A;  3ZDH A;  4TWF A;  4HQP A;  4ILC A;  2PH9 A;  5AFK A;  3RIA A;  4IL9 A;  4UY2 A;  5AFH A;  3UUB A;  2Y56 A;  4IL4 A;  4ZJT A;  5CO5 A;  3ZKR A;  2XQ6 A;  4WV9 A;  2BG9 E;  3TLU A;  4HFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...