3WTOA

Crystal structure of lymnaea stagnalis acetylcholine-binding protein q55r mutant complexed with desnitro-imidacloprid
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
206
structure length
206
Chain Sequence
AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQRTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 51
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wtoA00
3UU8A 4IL4A 5KZUA 2ZJUA 2BYSA 5LXBA 4LMLA 3JAEA 3TLTA 2Y57A 4F8HA 3LSVA 3RQWA 5TVCA 3U8LA 5AFKA 2VL0A 2XNVA 3UQ4A 5J5FA 2XZ5A 3UUBA 3WTIA 2BYPA 3UU4A 4QAAA 4ZJSA 4A98A 3TLUA 3UU3A 5KE4A 3GUAA 3SIOA 4EZ1A 2UZ6A 4LMJA 4BFQA 3UU6A 2XNUA 2WNLA 2Y54A 5BP0A 2YOEA 4ILAA 3TLVA 2BR7A 2ZJVA 5HEUA 5L4EA 2XQAA 2YKSA 2X00D 4XHEA 3EI0A 2YMEA 2XQ9A 2Y58A 2YN6A 4ZZCA 5HCJA 2XQ7A 3SH1A 2WNJA 2Y7YA 4ILBA 4UXUA 1UX2A 4ALXA 3PMZA 3RIAA 2X00A 4TWHA 4TWDA 5HEJA 5CFBA 5J5IA 4BQTA 3SQ6A 3T4MA 5L4HA 3WTOA 4NZBA 5BRXA 3WTKA 2W8GA 2BJ0A 5HEGA 4HFIA 4AFTA 1UW6A 4QABA 3EHZA 4HFEA 5AFMB 2XYSA 5J5GA 3WTNA 3WTLA 2XQ3A 4UM3P 5J5HA 4ZR6A 2XQ4A 4UY2A 3TLSA 3WTMA 2WN9A 2XZ6A 4IREA 3C84A 3U8KA 4PIRA 4ZK4A 2BG9C 4ZK1A 4HFHA 3TLWA 5FJVA 2BG9B 2XQ5A 4HFDA 4B5DA 4LMKA 3RIFA 5AINA 5L47A 3P50A 2QC1B 4TNVA 5AFJA 5LG3A 3ZDGA 5AFHA 2BYQA 5HEOA 4X5TA 2WZYA 3PEOA 4DBMA 3IGQA 2XQ8A 4QH4A 3JADA 4D01A 5AFMA 4NPPA 4ZRUA 3ZDHA 4Z90A 5HEHA 2BG9E 4ZZBA 4UM3S 4A97A 2WNCA 1UV6A 3JAFA 2PGZA 3U8JA 5BW2A 5HCMA 2XNTA 4QACA 3U8MA 3WTJA 4QH1A 4COFA 4FRRA 4TWFA 2BYRA 2BG9A 4HQPA 2XQ6A 2BYNA 5J0ZA 5AFNA 4HFCA 4WV9A 4XK9A 3C79A 4AFGA 2BR8A 4UM3A 3RI5A 3SQ9A 4UM1A 2XYTA 2Y56A 4ZJTA 3ZKRA 3WTHA 4ILCA 4TNWA 5JMEA 2YMDA 3U8NA 5IUXA 4QH5A 3UQ7A 2PH9A 5SYOA 4AFHA 2C9TA 5CO5A 3UU5A 4Z91A 4HFBA 3EAMA 3P4WA 4IL9A 3RHWA 2W8FA 3RQUA 1I9BA 5AFLA 3WIPA
chains in the Genus database with same CATH superfamily
3UU8A 4IL4A 5KZUA 2ZJUA 2BYSA 5LXBA 4LMLA 3JAEA 3TLTA 2Y57A 4F8HA 3LSVA 3RQWA 5TVCA 3U8LA 5AFKA 2VL0A 2XNVA 3UQ4A 5J5FA 2XZ5A 3UUBA 3WTIA 2BYPA 3UU4A 4QAAA 4ZJSA 4A98A 3TLUA 3UU3A 5KE4A 3GUAA 3SIOA 4EZ1A 2UZ6A 4LMJA 4BFQA 3UU6A 2XNUA 2WNLA 2Y54A 5BP0A 2YOEA 4ILAA 3TLVA 2BR7A 2ZJVA 5HEUA 5L4EA 2XQAA 2YKSA 2X00D 4XHEA 3EI0A 2YMEA 2XQ9A 2Y58A 2YN6A 4ZZCA 5HCJA 2XQ7A 3SH1A 2WNJA 2Y7YA 4ILBA 4UXUA 1UX2A 4ALXA 3PMZA 3RIAA 2X00A 4TWHA 4TWDA 5HEJA 5CFBA 5J5IA 4BQTA 3SQ6A 3T4MA 5L4HA 3WTOA 4NZBA 5BRXA 3WTKA 2W8GA 2BJ0A 5HEGA 4HFIA 4AFTA 1UW6A 4QABA 3EHZA 4HFEA 5AFMB 2XYSA 5J5GA 3WTNA 3WTLA 2XQ3A 4UM3P 5J5HA 4ZR6A 2XQ4A 4UY2A 3TLSA 3WTMA 2WN9A 2XZ6A 4IREA 3C84A 3U8KA 4PIRA 4ZK4A 2BG9C 4ZK1A 4HFHA 3TLWA 5FJVA 2BG9B 2XQ5A 4HFDA 4B5DA 4LMKA 3RIFA 5AINA 5L47A 3P50A 2QC1B 4TNVA 5AFJA 5LG3A 3ZDGA 5AFHA 2BYQA 5HEOA 4X5TA 2WZYA 3PEOA 4DBMA 3IGQA 2XQ8A 4QH4A 3JADA 4D01A 5AFMA 4NPPA 4ZRUA 3ZDHA 4Z90A 5HEHA 2BG9E 4ZZBA 4UM3S 4A97A 2WNCA 1UV6A 3JAFA 2PGZA 3U8JA 5BW2A 5HCMA 2XNTA 4QACA 3U8MA 3WTJA 4QH1A 4COFA 4FRRA 4TWFA 2BYRA 2BG9A 4HQPA 2XQ6A 2BYNA 5J0ZA 5AFNA 4HFCA 4WV9A 4XK9A 3C79A 4AFGA 2BR8A 4UM3A 3RI5A 3SQ9A 4UM1A 2XYTA 2Y56A 4ZJTA 3ZKRA 3WTHA 4ILCA 4TNWA 5JMEA 2YMDA 3U8NA 5IUXA 4QH5A 3UQ7A 2PH9A 5SYOA 4AFHA 2C9TA 5CO5A 3UU5A 4Z91A 4HFBA 3EAMA 3P4WA 4IL9A 3RHWA 2W8FA 3RQUA 1I9BA 5AFLA 3WIPA
chains in the Genus database with same CATH topology
3UU8A 4IL4A 5KZUA 2ZJUA 2BYSA 5LXBA 4LMLA 3JAEA 3TLTA 2Y57A 4F8HA 3LSVA 3RQWA 5TVCA 3U8LA 5AFKA 2VL0A 2XNVA 3UQ4A 5J5FA 2XZ5A 3UUBA 3WTIA 2BYPA 3UU4A 4QAAA 4ZJSA 4A98A 3TLUA 3UU3A 5KE4A 3GUAA 3SIOA 4EZ1A 2UZ6A 4LMJA 4BFQA 3UU6A 2XNUA 2WNLA 2Y54A 5BP0A 2YOEA 4ILAA 3TLVA 2BR7A 2ZJVA 5HEUA 5L4EA 2XQAA 2YKSA 2X00D 4XHEA 3EI0A 2YMEA 2XQ9A 2Y58A 2YN6A 4ZZCA 5HCJA 2XQ7A 3SH1A 2WNJA 2Y7YA 4ILBA 4UXUA 1UX2A 4ALXA 3PMZA 3RIAA 2X00A 4TWHA 4TWDA 5HEJA 5CFBA 5J5IA 4BQTA 3SQ6A 3T4MA 5L4HA 3WTOA 4NZBA 5BRXA 3WTKA 2W8GA 2BJ0A 5HEGA 4HFIA 4AFTA 1UW6A 4QABA 3EHZA 4HFEA 5AFMB 2XYSA 5J5GA 3WTNA 3WTLA 2XQ3A 4UM3P 5J5HA 4ZR6A 2XQ4A 4UY2A 3TLSA 3WTMA 2WN9A 2XZ6A 4IREA 3C84A 3U8KA 4PIRA 4ZK4A 2BG9C 4ZK1A 4HFHA 3TLWA 5FJVA 2BG9B 2XQ5A 4HFDA 4B5DA 4LMKA 3RIFA 5AINA 5L47A 3P50A 2QC1B 4TNVA 5AFJA 5LG3A 3ZDGA 5AFHA 2BYQA 5HEOA 4X5TA 2WZYA 3PEOA 4DBMA 3IGQA 2XQ8A 4QH4A 3JADA 4D01A 5AFMA 4NPPA 4ZRUA 3ZDHA 4Z90A 5HEHA 2BG9E 4ZZBA 4UM3S 4A97A 2WNCA 1UV6A 3JAFA 2PGZA 3U8JA 5BW2A 5HCMA 2XNTA 4QACA 3U8MA 3WTJA 4QH1A 4COFA 4FRRA 4TWFA 2BYRA 2BG9A 4HQPA 2XQ6A 2BYNA 5J0ZA 5AFNA 4HFCA 4WV9A 4XK9A 3C79A 4AFGA 2BR8A 4UM3A 3RI5A 3SQ9A 4UM1A 2XYTA 2Y56A 4ZJTA 3ZKRA 3WTHA 4ILCA 4TNWA 5JMEA 2YMDA 3U8NA 5IUXA 4QH5A 3UQ7A 2PH9A 5SYOA 4AFHA 2C9TA 5CO5A 3UU5A 4Z91A 4HFBA 3EAMA 3P4WA 4IL9A 3RHWA 2W8FA 3RQUA 1I9BA 5AFLA 3WIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU8 A;  4IL4 A;  5KZU A;  2ZJU A;  2BYS A;  5LXB A;  4LML A;  3JAE A;  3TLT A;  2Y57 A;  4F8H A;  3LSV A;  3RQW A;  5TVC A;  3U8L A;  5AFK A;  2VL0 A;  2XNV A;  3UQ4 A;  5J5F A;  2XZ5 A;  3UUB A;  3WTI A;  2BYP A;  3UU4 A;  4QAA A;  4ZJS A;  4A98 A;  3TLU A;  3UU3 A;  5KE4 A;  3GUA A;  3SIO A;  4EZ1 A;  2UZ6 A;  4LMJ A;  4BFQ A;  3UU6 A;  2XNU A;  2WNL A;  2Y54 A;  5BP0 A;  2YOE A;  4ILA A;  3TLV A;  2BR7 A;  2ZJV A;  5HEU A;  5L4E A;  2XQA A;  2YKS A;  2X00 D;  4XHE A;  3EI0 A;  2YME A;  2XQ9 A;  2Y58 A;  2YN6 A;  4ZZC A;  5HCJ A;  2XQ7 A;  3SH1 A;  2WNJ A;  2Y7Y A;  4ILB A;  4UXU A;  1UX2 A;  4ALX A;  3PMZ A;  3RIA A;  2X00 A;  4TWH A;  4TWD A;  5HEJ A;  5CFB A;  5J5I A;  4BQT A;  3SQ6 A;  3T4M A;  5L4H A;  3WTO A;  4NZB A;  5BRX A;  3WTK A;  2W8G A;  2BJ0 A;  5HEG A;  4HFI A;  4AFT A;  1UW6 A;  4QAB A;  3EHZ A;  4HFE A;  5AFM B;  2XYS A;  5J5G A;  3WTN A;  3WTL A;  2XQ3 A;  4UM3 P;  5J5H A;  4ZR6 A;  2XQ4 A;  4UY2 A;  3TLS A;  3WTM A;  2WN9 A;  2XZ6 A;  4IRE A;  3C84 A;  3U8K A;  4PIR A;  4ZK4 A;  2BG9 C;  4ZK1 A;  4HFH A;  3TLW A;  5FJV A;  2BG9 B;  2XQ5 A;  4HFD A;  4B5D A;  4LMK A;  3RIF A;  5AIN A;  5L47 A;  3P50 A;  2QC1 B;  4TNV A;  5AFJ A;  5LG3 A;  3ZDG A;  5AFH A;  2BYQ A;  5HEO A;  4X5T A;  2WZY A;  3PEO A;  4DBM A;  3IGQ A;  2XQ8 A;  4QH4 A;  3JAD A;  4D01 A;  5AFM A;  4NPP A;  4ZRU A;  3ZDH A;  4Z90 A;  5HEH A;  2BG9 E;  4ZZB A;  4UM3 S;  4A97 A;  2WNC A;  1UV6 A;  3JAF A;  2PGZ A;  3U8J A;  5BW2 A;  5HCM A;  2XNT A;  4QAC A;  3U8M A;  3WTJ A;  4QH1 A;  4COF A;  4FRR A;  4TWF A;  2BYR A;  2BG9 A;  4HQP A;  2XQ6 A;  2BYN A;  5J0Z A;  5AFN A;  4HFC A;  4WV9 A;  4XK9 A;  3C79 A;  4AFG A;  2BR8 A;  4UM3 A;  3RI5 A;  3SQ9 A;  4UM1 A;  2XYT A;  2Y56 A;  4ZJT A;  3ZKR A;  3WTH A;  4ILC A;  4TNW A;  5JME A;  2YMD A;  3U8N A;  5IUX A;  4QH5 A;  3UQ7 A;  2PH9 A;  5SYO A;  4AFH A;  2C9T A;  5CO5 A;  3UU5 A;  4Z91 A;  4HFB A;  3EAM A;  3P4W A;  4IL9 A;  3RHW A;  2W8F A;  3RQU A;  1I9B A;  5AFL A;  3WIP A; 
#chains in the Genus database with same CATH topology
 3UU8 A;  4IL4 A;  5KZU A;  2ZJU A;  2BYS A;  5LXB A;  4LML A;  3JAE A;  3TLT A;  2Y57 A;  4F8H A;  3LSV A;  3RQW A;  5TVC A;  3U8L A;  5AFK A;  2VL0 A;  2XNV A;  3UQ4 A;  5J5F A;  2XZ5 A;  3UUB A;  3WTI A;  2BYP A;  3UU4 A;  4QAA A;  4ZJS A;  4A98 A;  3TLU A;  3UU3 A;  5KE4 A;  3GUA A;  3SIO A;  4EZ1 A;  2UZ6 A;  4LMJ A;  4BFQ A;  3UU6 A;  2XNU A;  2WNL A;  2Y54 A;  5BP0 A;  2YOE A;  4ILA A;  3TLV A;  2BR7 A;  2ZJV A;  5HEU A;  5L4E A;  2XQA A;  2YKS A;  2X00 D;  4XHE A;  3EI0 A;  2YME A;  2XQ9 A;  2Y58 A;  2YN6 A;  4ZZC A;  5HCJ A;  2XQ7 A;  3SH1 A;  2WNJ A;  2Y7Y A;  4ILB A;  4UXU A;  1UX2 A;  4ALX A;  3PMZ A;  3RIA A;  2X00 A;  4TWH A;  4TWD A;  5HEJ A;  5CFB A;  5J5I A;  4BQT A;  3SQ6 A;  3T4M A;  5L4H A;  3WTO A;  4NZB A;  5BRX A;  3WTK A;  2W8G A;  2BJ0 A;  5HEG A;  4HFI A;  4AFT A;  1UW6 A;  4QAB A;  3EHZ A;  4HFE A;  5AFM B;  2XYS A;  5J5G A;  3WTN A;  3WTL A;  2XQ3 A;  4UM3 P;  5J5H A;  4ZR6 A;  2XQ4 A;  4UY2 A;  3TLS A;  3WTM A;  2WN9 A;  2XZ6 A;  4IRE A;  3C84 A;  3U8K A;  4PIR A;  4ZK4 A;  2BG9 C;  4ZK1 A;  4HFH A;  3TLW A;  5FJV A;  2BG9 B;  2XQ5 A;  4HFD A;  4B5D A;  4LMK A;  3RIF A;  5AIN A;  5L47 A;  3P50 A;  2QC1 B;  4TNV A;  5AFJ A;  5LG3 A;  3ZDG A;  5AFH A;  2BYQ A;  5HEO A;  4X5T A;  2WZY A;  3PEO A;  4DBM A;  3IGQ A;  2XQ8 A;  4QH4 A;  3JAD A;  4D01 A;  5AFM A;  4NPP A;  4ZRU A;  3ZDH A;  4Z90 A;  5HEH A;  2BG9 E;  4ZZB A;  4UM3 S;  4A97 A;  2WNC A;  1UV6 A;  3JAF A;  2PGZ A;  3U8J A;  5BW2 A;  5HCM A;  2XNT A;  4QAC A;  3U8M A;  3WTJ A;  4QH1 A;  4COF A;  4FRR A;  4TWF A;  2BYR A;  2BG9 A;  4HQP A;  2XQ6 A;  2BYN A;  5J0Z A;  5AFN A;  4HFC A;  4WV9 A;  4XK9 A;  3C79 A;  4AFG A;  2BR8 A;  4UM3 A;  3RI5 A;  3SQ9 A;  4UM1 A;  2XYT A;  2Y56 A;  4ZJT A;  3ZKR A;  3WTH A;  4ILC A;  4TNW A;  5JME A;  2YMD A;  3U8N A;  5IUX A;  4QH5 A;  3UQ7 A;  2PH9 A;  5SYO A;  4AFH A;  2C9T A;  5CO5 A;  3UU5 A;  4Z91 A;  4HFB A;  3EAM A;  3P4W A;  4IL9 A;  3RHW A;  2W8F A;  3RQU A;  1I9B A;  5AFL A;  3WIP A; 
#chains in the Genus database with same CATH homology
 3UU8 A;  4IL4 A;  5KZU A;  2ZJU A;  2BYS A;  5LXB A;  4LML A;  3JAE A;  3TLT A;  2Y57 A;  4F8H A;  3LSV A;  3RQW A;  5TVC A;  3U8L A;  5AFK A;  2VL0 A;  2XNV A;  3UQ4 A;  5J5F A;  2XZ5 A;  3UUB A;  3WTI A;  2BYP A;  3UU4 A;  4QAA A;  4ZJS A;  4A98 A;  3TLU A;  3UU3 A;  5KE4 A;  3GUA A;  3SIO A;  4EZ1 A;  2UZ6 A;  4LMJ A;  4BFQ A;  3UU6 A;  2XNU A;  2WNL A;  2Y54 A;  5BP0 A;  2YOE A;  4ILA A;  3TLV A;  2BR7 A;  2ZJV A;  5HEU A;  5L4E A;  2XQA A;  2YKS A;  2X00 D;  4XHE A;  3EI0 A;  2YME A;  2XQ9 A;  2Y58 A;  2YN6 A;  4ZZC A;  5HCJ A;  2XQ7 A;  3SH1 A;  2WNJ A;  2Y7Y A;  4ILB A;  4UXU A;  1UX2 A;  4ALX A;  3PMZ A;  3RIA A;  2X00 A;  4TWH A;  4TWD A;  5HEJ A;  5CFB A;  5J5I A;  4BQT A;  3SQ6 A;  3T4M A;  5L4H A;  3WTO A;  4NZB A;  5BRX A;  3WTK A;  2W8G A;  2BJ0 A;  5HEG A;  4HFI A;  4AFT A;  1UW6 A;  4QAB A;  3EHZ A;  4HFE A;  5AFM B;  2XYS A;  5J5G A;  3WTN A;  3WTL A;  2XQ3 A;  4UM3 P;  5J5H A;  4ZR6 A;  2XQ4 A;  4UY2 A;  3TLS A;  3WTM A;  2WN9 A;  2XZ6 A;  4IRE A;  3C84 A;  3U8K A;  4PIR A;  4ZK4 A;  2BG9 C;  4ZK1 A;  4HFH A;  3TLW A;  5FJV A;  2BG9 B;  2XQ5 A;  4HFD A;  4B5D A;  4LMK A;  3RIF A;  5AIN A;  5L47 A;  3P50 A;  2QC1 B;  4TNV A;  5AFJ A;  5LG3 A;  3ZDG A;  5AFH A;  2BYQ A;  5HEO A;  4X5T A;  2WZY A;  3PEO A;  4DBM A;  3IGQ A;  2XQ8 A;  4QH4 A;  3JAD A;  4D01 A;  5AFM A;  4NPP A;  4ZRU A;  3ZDH A;  4Z90 A;  5HEH A;  2BG9 E;  4ZZB A;  4UM3 S;  4A97 A;  2WNC A;  1UV6 A;  3JAF A;  2PGZ A;  3U8J A;  5BW2 A;  5HCM A;  2XNT A;  4QAC A;  3U8M A;  3WTJ A;  4QH1 A;  4COF A;  4FRR A;  4TWF A;  2BYR A;  2BG9 A;  4HQP A;  2XQ6 A;  2BYN A;  5J0Z A;  5AFN A;  4HFC A;  4WV9 A;  4XK9 A;  3C79 A;  4AFG A;  2BR8 A;  4UM3 A;  3RI5 A;  3SQ9 A;  4UM1 A;  2XYT A;  2Y56 A;  4ZJT A;  3ZKR A;  3WTH A;  4ILC A;  4TNW A;  5JME A;  2YMD A;  3U8N A;  5IUX A;  4QH5 A;  3UQ7 A;  2PH9 A;  5SYO A;  4AFH A;  2C9T A;  5CO5 A;  3UU5 A;  4Z91 A;  4HFB A;  3EAM A;  3P4W A;  4IL9 A;  3RHW A;  2W8F A;  3RQU A;  1I9B A;  5AFL A;  3WIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...