5HCJA

Cationic ligand-gated ion channel
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Sites of Anesthetic Inhibitory Action on a Cationic Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hcjA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hcjA01
3EHZA 4IREA 5LG3A 5HCMA 5BW2A 5HEJA 5AFJA 4ALXA 3WTNA 2XQ7A 3WTLA 2XNTA 2BYRA 5CO5A 2YOEA 2KSRA 4ZK1A 3SH1A 4TWFA 3UQ4A 3UU3A 3U8NA 4ZZBA 4HFCA 2YN6A 4HFBA 2YMEA 5AINA 3ZKRA 3WTHA 2W8FA 3TLSA 3EAMA 3U8KA 4ILCA 3UU5A 4EZ1A 5AFNA 4ILBA 4TWHA 4IL4A 4FRRA 4LMJA 2BYNA 2PGZA 3WTJA 2BYPA 3GUAA 5BRXA 4ZJTA 2XQ6A 4QH1A 3TLWA 5CFBA 4NZBA 4QH5A 3UU8A 2BG9A 3LSVA 3RI5A 3ZDGA 1UW6A 2ZJUA 5J0ZA 4XHEA 4LMLA 5KE4A 5IUXA 3WTKA 5TVCA 3PEOA 2Y56A 4HFDA 4AFTA 2BYQA 2MAWA 4PIRA 2LKGA 5FJVA 3TLUA 3WIPA 4F8HA 2ZJVA 4ZK4A 3T4MA 3U8JA 4QAAA 5AFMB 2XQAA 2BYSA 4LMKA 3SQ9A 5AFLA 3SIOA 5HEGA 5L47A 4X5TA 1I9BA 3WTMA 3RHWA 2BJ0A 2BG9C 3UU4A 2WNJA 4UM3P 4TNWA 2XQ8A 1OEDA 5AFMA 2PH9A 2XQ4A 5HEUA 4COFA 2VL0A 4WV9A 3C79A 4QACA 4UM1A 2XYTA 4ZJSA 4ZRUA 2XZ6A 4IL9A 4TWDA 4D01A 2BR8A 4UXUA 3RQUA 3RIFA 2YMDA 3TLVA 3PMZA 5BP0A 5L4EA 3RIAA 3C84A 4AFHA 4BQTA 4UY2A 2LLYA 2Y58A 4ZR6A 3U8MA 4HFHA 2XNUA 2BR7A 2BG9E 4ZZCA 2LM2A 3TLTA 3UQ7A 2WNCA 3U8LA 4DBMA 2M6BA 4NPPA 1UV6A 2UZ6A 4A97A 5HEOA 4TNVA 2BG9B 2QC1B 5AFHA 5J5FA 2C9TA 1OEDC 1UX2A 3UU6A 4QH4A 2XQ9A 5AFKA 3JADA 2WZYA 2YKSA 2Y57A 2Y7YA 3RQWA 2WN9A 2XNVA 3ZDHA 5SYOA 4A98A 3WTOA 3P50A 3UUBA 4UM3S 3JAEA 2XQ5A 2Y54A 2W8GA 5L4HA 5J5GA 2M6IA 3P4WA 4HFIA 2XYSA 4Z91A 4HQPA 5J5HA 3SQ6A 4UM3A 2X00A 2WNLA 4QABA 3EI0A 5KZUA 4ILAA 3IGQA 2XZ5A 4Z90A 1OEDE 5HCJA 4AFGA 4XK9A 4B5DA 2X00D 5JMEA 4HFEA 2XQ3A 5HEHA 3WTIA 4BFQA 5J5IA 1OEDB 5LXBA 3JAFA 2LKHA
chains in the Genus database with same CATH superfamily
3FBLA 4O8SA 3NBXX 4DV6T 2FJEA 4MBQA 2Y48B 4HFCA 1YXRA 1SUMB 5KMGP 5J2UE 3U8KA 1SHZC 3OPCA 4UR9A 4XAXB 4LMJA 2BYNA 2WU2A 4B6XA 5C2TA 2WAUA 4EYYR 4YY3T 2XAFB 2V7MA 1FMWA 5J0ZA 4X66T 3SWHA 2X0HA 3ZMUB 5AQFB 2Y56A 3I9YA 3PUWF 5FKYA 2LKGA 4XZCA 3AXJB 5LNKA 3SQ9A 4L0RA 5AQOB 3ETUA 4LF9T 3WTMA 4FI5A 3SOLA 2WMOA 2QYWA 3FHNA 4WZXA 3C4XA 1H7CA 3PTRB 2JQ9A 2LSJA 3CMLA 5FVLA 5ABHA 2CWOA 2V26A 1HR0T 2UUBT 3U8MA 4U72A 4HFHA 3UQ7A 2M6BA 3DJBA 2HPLA 3CK6A 1HF8A 4BJNA 1HTJF 1CUNA 2BBHA 2PBIA 3PJAJ 3P4WA 3SQ6A 1BR1A 4ILAA 2I0MA 4XK9A 4J2CA 5HEHA 5AFMB 3GN5B 3JAFA 2LKHA 4ILUA 5HCMA 3IF8B 2I59A 2A72A 3AECA 4JBWF 3N9QA 4JI5T 4OFZA 2NWBA 3CIRA 3Q2MA 2H88A 2XM2A 4PW8A 4HWFA 4WBOA 3CVRA 2IW5B 2XASB 4EOZB 1E2AA 5AQNB 2CXLA 3AEEA 4KHPT 4DNDA 4ZJTA 1NAFA 4PJLA 2Z6EA 3NVOA 2E8IA 4O2BE 3Q5DA 3UU8A 2ES0A 4JLEA 4F6RC 2ZJUA 2X9WA 5FVKA 5KE4A 4WW0A 3RGLA 2CCQA 1KNRA 4HWDA 2YU2A 3EUHA 4KHZF 5FY7A 5JQGE 4DV2T 4GKKT 1Y01A 2E5VA 1U4QA 4H9QC 5ABGA 3SRZA 1MMDA 4ZJSA 4TN7B 3VKHA 3WAJA 4U7YA 2X0LB 2B1EA 2YMDA 5BP0A 2C5IT 3C84A 4HWIB 5EZYE 1KFYA 5HEOA 5J5FA 5LMNT 3RQWA 3P50A 1WR6A 3H37A 3AA7B 5CGMA 3L8RA 3F2EA 3UFEA 4JI1T 3NZQA 1OEDE 3H3MA 2CM0A 3A7MA 3TKLB 2FJBA 5HEJA 2VL8A 2LOPA 2BYRA 4AXPA 4H9PC 4AISA 1E1HB 5HAXA 2YINA 3PUXF 1T8BA 5TAOA 2FUPA 5FNVE 1BR2A 5AQKB 4LF7T 2WDQA 2XQ6A 3AAEB 4YSZA 2W66A 4AKLA 1KEYA 2P9BA 4TUYE 1G8XA 5LB7B 3GWHA 3C50A 2C5KT 3ONLC 3BQLA 3I0QA 5ETWA 4DO0A 3AE2A 4OYKA 5KX5E 3K3QC 2WNJA 1J1JA 4ANJA 5CJ5A 4YSYA 1BR0A 1VCSA 4CN6A 1S94A 1VCTA 4IL9A 3ONXA 4HWCA 4O4IE 4ZS3A 4UELA 2LSIA 3MK7C 3KBTA 4NPPA 5C3JA 2ZMAA 3P4QA 3P4SA 2V1DB 4B3RT 3RKOA 3JADA 2WZYA 3RPUA 2W61A 3UFGA 4YT0A 3ZMVB 2X00A 2CXDA 3KVBA 3VR9A 2VB6A 1US7B 2NW8A 4WBNE 1LRZA 3WTNA 3AXJA 4GYRA 3P4PA 3C64A 5L3DB 3U8NA 3GMIA 3N9OA 4H9NC 4PK5A 2CXFA 4YTMA 2QGSA 4IL4A 4ADZA 2WDVA 4Q25A 3FXEB 5AQRB 4EB6E 5H6RB 4LF4T 4AKRB 5AQMB 2CMRA 3ZDGA 1L0VA 2L3LA 2DI4A 4JV5T 4AQYT 5TVCA 5ADXL 3N9MA 2JMHA 2UXDT 4U33A 4IE4A 3KV9A 4KUMB 4GYSA 1I9BA 2BKOA 3UU4A 2XQ8A 3O1JA 5AFMA 3GN5A 3E0ZA 1LVKA 4ZRUA 2XZ6A 5FXXA 4IDPA 2LHNA 4UXUA 4UV9B 3RQUA 2CPTA 3LDQB 3RIFA 4DV0T 4AFHA 2Y58A 3C4WA 2VURA 5AQLB 2V8SV 2BG9B 4A5XA 3NZPA 4CQIA 3UU6A 4QH4A 2DLRA 2WDRA 5SYOA 1XNQT 4EXTA 4JI4T 4Z8XA 5AFJA 3Q9DA 4CXWA 1HG5A 1W9RA 4DR4T 3ZJ2A 5C8YE 5LCYA 3UU3A 5JRCB 2IMLA 2YMEA 4JEUB 4ILCA 1MNEA 4XBFB 4DR2T 5AQQB 4ILBA 4HKAA 2PG8A 4YJ3E 3HKEE 5LA6E 3WTJA 3LBXB 4DBQA 3RC8A 3A5XA 2VK9A 1N33T 3DP7A 1EZ3A 4QXHB 1Z0PA 1MMGA 3PV0F 3J9X1 2DNXA 4KBMB 4YHHT 4NUUA 3AE4A 2W0GA 4HEAA 2MAWA 5JDMA 3AAIA 3QB5A 3PJAA 2UXCT 3WIPA 4H9RC 2NW9A 3RLFF 2ZJVA 2EHOC 4U2ZA 3SIOA 2KWHA 4DIDB 3OVUA 5ABFA 3M3ZB 4DR5T 4COFA 4EGWA 3I0OA 3RX6A 5L4EA 3U8LA 2X9YA 3RYFE 1T72A 4IHJE 3L09A 2RPAA 5AFKA 4I50E 3O9XA 1VOMA 4DV1T 2XJ7A 4Z91A 5F5WA 5CB4E 2XZ5A 4ZI2C 3RRCA 4AFGA 3O1IA 5JMEA 4TZ4C 3CX8B 3N2GE 4L9IA 4O2AE 5JDQA 4G2AA 2CRBA 2X0YA 2XQ7A 2XTLA 3N5LA 4HFBA 2E9XB 2LE8A 2KNDA 3MACA 2CEAA 4X65T 4P1NA 4IIJE 2ACZA 2EHOA 1HCIA 1X9BA 3TLWA 5FY0A 2MTQA 3KVAA 3WI3A 2QVAA 3QNUA 3MKDA 3RYHE 2Y6XA 4HFDA 3AEBA 2CBIA 3AA0B 2SPCA 4ZK4A 3AE7A 1XZYA 3FZHB 5J2TE 2RA1A 2BG9C 4BJMA 2WM9A 5LHGB 2YDSA 5HWXA 3LK3B 4DR7T 4UV8B 2XHEB 1XNRT 2XNUA 2LM2A 2RP4A 3ANWB 2QC1B 1VRBA 1UURA 1UX2A 4HGAA 3W15B 2XY8B 1KK7A 4JI2T 3OYZA 1S35A 2XUEA 4TV8E 3CQCB 2VKOA 5HCJA 2X67A 3ZCJA 4HE8A 1OEDB 2W63A 3C51A 2WWUA 2LRLA 2WBLA 4ZK1A 5L3GB 5LJMA 4BA9A 5AFNA 5L3FB 1QSDA 4ZHQE 2PGZA 3RRWA 5A1LA 4X20E 1HNWT 4EEDA 1YD8G 4M1PA 2XQYA 4JI8T 4NZBA 2DL1A 4DVDA 4DUZT 2IAKA 3QC9A 2BG9A 2VKDA 2D0UA 2J62A 2WQYA 2IC6A 4I4TE 4HTEA 5KDMC 3VU7H 2K5BB 5FYMA 1NEKA 4AQGA 2XZEA 1YKHB 1D0XA 5DABA 3EDVA 2XAGB 5LGTB 5J1GA 4GIWA 1HFAA 1MMNA 2KXPB 5JRCA 2N1GA 5AQVB 1NENA 2GK9A 4ZZCA 2CLYB 4IT4A 4PNIA 2DCFA 2WN9A 2XNVA 3LBXA 4UVCB 4HQPA 2ODUA 4GOUA 4MLKA 2E9XC 4QX7B 5IHYA 4DV4T 4QABA 3EI0A 3FXDB 5AQPB 2OA5A 3BQKA 5LMUT 4GK5E 4DV5T 2V6YA 4I0UA 2H3RA 2UXXB 3PUZF 5M4YA 3ZCIA 2FBWA 3L39A 4KMCA 2UXBT 2E2AA 3ZKRA 1IBLT 3RC3A 2V7LA 3UU5A 3IA3A 5L3CB 2A3DA 4N78D 3RH3A 5AQUB 5ABFB 1CHUA 3E22E 2BS2A 3MA9A 2BDEA 4EZHA 2YDRA 4XHEA 5HYAA 4LFAT 4QWNB 2JPFA 5IUXA 2BZBA 1NWMX 2LHRA 2PTFA 4ISSA 4U74A 4H9OC 4TV9E 3LJCA 1HG2A 1D1BA 4IE0A 3TLUA 4QXCB 4IE7A 5JTGA 2MOZA 2X66A 2Q9QB 4X5TA 2WMNA 4UM3P 3ONJA 4TNWA 3SS1A 5HXRA 4ZEYA 3N2OA 5JVDE 2VL0A 3RIUC 4QACA 3C4ZA 5HXEA 4CZZB 4LF6T 3TLVA 4QXBB 2IIUA 1ZP0A 2E9XA 5ABEA 2K48A 2YK0A 1OEDC 3Q5EA 2XSBA 2WP9A 1HS7A 3AAAB 1XMOT 3OJAA 4PJNA 4UF0B 3ZPOA 4MFRA 5KZUA 2VVSA 4O4JE 2EHOB 2QRXA 2V5CA 2WCAA 4IREA 4OHFA 1FJGT 4YSXA 4PFPA 3UUXB 3AEFA 5JR9C 1WYCA 4AKGA 4CI1B 4DMWA 3EAMA 3VRAA 1MMAA 4EZ1A 2NTXA 4QHOA 2D5UA 2J4GA 2UUCT 4X1IE 3SFDA 2LSGA 2NR4A 5DJQC 3ANWA 1MIYA 3J7Yq 1WFDA 3CPZA 3ETVA 2JQQA 3RIUA 5FMNA 1ZOYA 2NP9A 3ZYMA 2XSAA 1IJ5A 3JCFA 3B5MA 2XQAA 2MYSA 3AVRA 5AQSB 5HEGA 2CLYC 2ZM2A 4DMVA 1UK5A 1OEDA 4EYUA 3DTOA 5AQGB 1KNZA 1WLXA 3V5UA 5E0OA 3PMZA 5LHHB 2LLYA 5IYZE 2BR7A 1WYBA 5FL1A 2UZ6A 1X79A 5AFHA 2YKSA 2D9DA 4X62T 3JAEA 4I55E 3L3PA 1HX1B 4UVBB 3IBPA 2M6IA 2XYSA 1UGOA 4EV6A 3LK42 2VASA 4HN9A 5JR9A 3X1DA 5AFUL 3ZT6A 1MIVA 4B5DA 5LBQB 4BFQA 2IUBA 2ODVA 3FBZA 4DUYT 2A2FX 2WB5A 1T7SA 3R6NA 1XWMA 1XDOA 1KF6A 3ZC1A 4TWFA 2C0SA 4ZZBA 4H9SE 2DHRA 1WR0A 2FJDA 4NUVA 5LG4A 5JREA 1W0BA 1XMQT 4OK0A 3ZN1B 1LKXA 2BKPA 3ZLIA 5HXSA 2FJAA 3LG7A 2Q9QC 2YEVC 4U3CA 2VKJA 4QH5A 2CHOA 3P8CD 2A9UA 3WTKA 1IBKT 5HWYA 5LOVE 3UULA 3A8YC 4E7SA 5FJVA 5CA0E 4P0BA 4F8HA 2L8KA 1M62A 4IDQA 3S4UA 2X51A 3JC6C 1N36T 2PH9A 2XQ4A 3AA1B 2H89A 2PJQA 2AXDS 2NW7A 2N9DA 2WU5A 1ZEEA 1R8IA 4EAHA 2MBGA 4NXMT 3VR8A 4EEBA 2V6YB 2VKHA 2YU1A 5DQWA 1SE7A 1UCUA 1MNDA 5F3JA 2BKNA 3H3AA 5EK3A 5AQJB 4A98A 3VRBA 2HHHT 3QOFA 2ZM8A 3BK9A 5J5HA 3ZYLA 4HFEA 3HR0A 4ZI7E 3WTIA 5J5IA 1HNZT 1YW0A 2LJLA 2VVNA 3M65A 4LF8T 4IDZA 2XNTA 2L9QA 2BBJA 2Q9QA 4IDNA 5FP3A 5CA1E 3N9LA 2W2UA 3N2KE 4IGUA 3CX6B 4ZXLA 4AKIA 2V6XA 2JMKA 3AE9A 2C5JA 3RYCE 3LSVA 4V1Av 4CN1A 1UW6A 4PJJA 4GKJT 3EDUA 2KLQA 2ZM6T 4AFTA 3NRXA 2JQKA 4X1YE 3K1SA 3T4MA 1OWAA 4UF0A 2WZHA 2BYSA 3HI2A 2E9XD 1JNZA 3RHWA 1ZKEA 1KNPA 4NIQA 1JNRA 3RYIE 5LGUB 3MJXA 3C79A 3ZN0B 5FL0A 4TWDA 3G06A 1UX5A 3Q5WA 4BQTA 2AE9A 3KBUA 4DBMA 3VKGA 2G0UA 2XPKA 2C9TA 2LT3A 4AIUA 5BR8T 4DBRA 5AQIB 4JEHB 2JJ9A 2UU9T 4HWHA 3P7IA 3AEDA 3ZT5A 4DR3T 2X00D 2QA7A 2LM9A 2XM1A 4H63V 4UM3S 3LFMA 2X9HA 3WTLA 2M67A 3N9PA 4MALA 3AE3A 2VQET 3SH1A 3SFEA 3QB5K 5LBMA 5L3EB 3CQXC 3IHRA 4DR6T 4E7ZA 1J5ET 4L5GA 4QH1A 1I6ZA 5LJNA 2W67A 3KV5A 1IZNB 4NXNT 3AE6A 4CI2B 4B3TT 3K3OA 3OYXA 4YJ2E 2HH7A 4YTNA 4LMKA 1B7TA 4LF5T 4AI6A 1IAPA 3T8OA 3CQGB 2CHNA 2X68A 5JR9B 1QLBA 3B57A 4AQFC 2ZM0A 4TX5A 3EABA 3BQIA 3TLTA 3RKGA 2KINB 4UIGA 1U5PA 4X64T 2W00A 4AKHA 3ZYKA 2D2SA 1AJ3A 1LVFA 2X9XA 2XQ5A 3ZJ1A 4HFVA 5LYJE 3F57A 2WNLA 4CI3B 2IC9A 2V7KA 2K3WA 2CBJA 4GK0E 4A56A 2Y54A 5LG3A 4ALXA 1HX8A 3R84B 3FB2A 4EIWA 1Y64B 4ZI3C 2KSRA 3VHLA 3PU3A 3UQ4A 1IBMT 2J1DG 2W8FA 5FXVA 2BVMA 2XAJB 2F4VT 1FMVA 3N9NA 3ZMTB 3Q5XA 3MZKB 3HKDE 5EK2A 2BYPA 3EVYA 1W09A 4PAGA 5L3BB 3CX7B 4K0KT 4QKNA 2YDQA 2LSYA 3U3IA 2CE7A 2DWGA 4AQFA 3U8JA 3FZMB 4LFBT 2LEHA 5AFLA 3NKZA 4PK4A 1M7KA 2LRKA 2JQHA 2WSSV 2IHR1 5F8PA 3IEEA 3RIAA 4YFSA 4UY2A 1O3XA 4CXXA 4WYVA 1UV6A 3OBVE 3O1HA 2R6GF 1SA0E 5HXHA 2XQ9A 2Y57A 3ZDHA 3T1YT 3WTOA 4JI3T 2Q9QD 1W0AA 4YTPA 4UM3A 3PDYA 4Z90A 1DU2A 2HN1A 5DQVA 5FXWA 5AQHB 3EHZA 5BW2A 5HXCA 3ZMZB 4ASKA 5CO5A 1XDPA 3PUQA 3JC6D 3T1HT 2YN6A 3LK2B 2CA5A 3K8PC 1IJ6A 3C98B 2KZ7B 2NOXA 1ZV4X 1GQEA 5BRXA 2K24A 2EHOD 5BMVE 2D0TA 3RI5A 2CWYA 3NRYA 5LGNB 1MIWA 5LHIB 3PEOA 3PUSA 3UUNA 3I9WA 2B76A 4KI0F 1OXZA 1E7PA 4YLHA 4PIRA 3OKQA 1N34T 2I6HA 4G63A 4ERRA 2BS4A 4C90A 3ABVA 4WV9A 2XAHB 4UEMA 2XYTA 4PJMA 4DV3T 2KMFA 2BR8A 4JI6T 4PK6A 1YQ4A 4P0AA 1QUUA 2WNCA 4A97A 2PFVA 2XAQB 4TNVA 2HPJA 3KDSE 3ZSTA 4U7IA 4ZI2D 3UTKA 2ACXA 3UUBA 5JDLA 2JIWA 2KWIB 1N32T 5J5GA 3WAKA 5FXZA 2DWKA 5FY1A 3PUYF 4KP3C 1WCRA 3KINB 4BAYB 5LXBA 5JDNA 3HA4A 3AA6B 3K3NA 1UX4A 4QX8B 4ISTA 4DR1T 3QK6A 4IE5A 3I1AA 3WTHA 1FIOA 3TLSA 4CN4A 3AEAA 4LFCT 2Y8DA 3QUJA 4U2YA 5CFBA 2WY2A 2OV9A 2HN2A 4U31A 2BYQA 5JDHA 2BS3A 4PFOA 4YXDA 4MHCA 3PU8A 4O4LE 1J5WA 2LOSA 2BJ0A 2BVLA 3FZKB 4X1KE 3AE8A 4IE6A 4UM1A 4OX9T 3HKCE 3NWIA 3FZLB 2KT9A 2ZLYA 4B3ST 1Z8UA 1D1AA 3KV4A 2E5LT 2WZIA 5EK4A 1FEWA 3AE5A 3CKDA 4I43B 2Y7YA 3ZSSA 5AQTB 4HFIA 4IDOA 4CXYA 4ZOLE 4EZ4A 3AB3B 2V5DA 3ZT7A 3IGQA 3PURA 3PE0A 3KV6A 2MPKA 3ZMSB 2XQ3A 3E08A 3OTOT 4JYAT 3V5SA 2V7JA 2YOEA 4YHJA 5JDGA 5H6QB 4H63H 2NTYA 4WNKA 5AINA 1YKEB 1V9DA 4FJOA 3UUMA 5GONE 1D1CA 4TWHA 3GA8A 5L2LA 5JH7E 4FRRA 2VWAA 3RF1A 3ZEFB 3O4XE 3F31A 2OLTA 3GUAA 4B3MT 1BR4A 3PUGA 3AEGA 1G73A 4DV7T 3ESLA 4LMLA 4JUYA 4JI0T 3MXZA 2WS3A 2VQFT 4K0UA 2WWVA 5IWAT 4C91A 4QAAA 2J47A 3AVSA 4ZS2A 5L47A 3KFWX 3ZC0A 5LP6E 3UT5E 3CWZB 2V7IA 5HEUA 3HKBE 4KX6A 3B13A 3D0TA 2LSKA 4D01A 5JDFA 1WRDA 4P09A 2UXNB 3FZFB 4ZI3D 5LXTE 1T98A 4OYJA 4ZR6A 1YQ3A 2BG9E 3P4RA 2W4XA 2IDOB 4O4HE 1ZHCA 4UXNB 3U78A 2JRKA 2N2NA 4UVAB 5KXJA 2W8GA 5L4HA 2H7VC 2W62A 3PUAA 3HL6A 1I94T 2K9AA 2H7OA 1HNXT 3AE1A 1D0YA 2UUAT 3PUVF 4JI7T 1D0ZA 1UUSA
chains in the Genus database with same CATH topology
3EHZA 4IREA 5LG3A 5HCMA 5BW2A 5HEJA 5AFJA 4ALXA 3WTNA 2XQ7A 3WTLA 2XNTA 2BYRA 5CO5A 2YOEA 2KSRA 4ZK1A 3SH1A 4TWFA 3UQ4A 3UU3A 3U8NA 4ZZBA 4HFCA 2YN6A 4HFBA 2YMEA 5AINA 3ZKRA 3WTHA 2W8FA 3TLSA 3EAMA 3U8KA 4ILCA 3UU5A 4EZ1A 5AFNA 4ILBA 4TWHA 4IL4A 4FRRA 4LMJA 2BYNA 2PGZA 3WTJA 2BYPA 3GUAA 5BRXA 4ZJTA 2XQ6A 4QH1A 3TLWA 5CFBA 4NZBA 4QH5A 3UU8A 2BG9A 3LSVA 3RI5A 3ZDGA 1UW6A 2ZJUA 5J0ZA 4XHEA 4LMLA 5KE4A 5IUXA 3WTKA 5TVCA 3PEOA 2Y56A 4HFDA 4AFTA 2BYQA 2MAWA 4PIRA 2LKGA 5FJVA 3TLUA 3WIPA 4F8HA 2ZJVA 4ZK4A 3T4MA 3U8JA 4QAAA 5AFMB 2XQAA 2BYSA 4LMKA 3SQ9A 5AFLA 3SIOA 5HEGA 5L47A 4X5TA 1I9BA 3WTMA 3RHWA 2BJ0A 2BG9C 3UU4A 2WNJA 4UM3P 4TNWA 2XQ8A 1OEDA 5AFMA 2PH9A 2XQ4A 5HEUA 4COFA 2VL0A 4WV9A 3C79A 4QACA 4UM1A 2XYTA 4ZJSA 4ZRUA 2XZ6A 4IL9A 4TWDA 4D01A 2BR8A 4UXUA 3RQUA 3RIFA 2YMDA 3TLVA 3PMZA 5BP0A 5L4EA 3RIAA 3C84A 4AFHA 4BQTA 4UY2A 2LLYA 2Y58A 4ZR6A 3U8MA 4HFHA 2XNUA 2BR7A 2BG9E 4ZZCA 2LM2A 3TLTA 3UQ7A 2WNCA 3U8LA 4DBMA 2M6BA 4NPPA 1UV6A 2UZ6A 4A97A 5HEOA 4TNVA 2BG9B 2QC1B 5AFHA 5J5FA 2C9TA 1OEDC 1UX2A 3UU6A 4QH4A 2XQ9A 5AFKA 3JADA 2WZYA 2YKSA 2Y57A 2Y7YA 3RQWA 2WN9A 2XNVA 3ZDHA 5SYOA 4A98A 3WTOA 3P50A 3UUBA 4UM3S 3JAEA 2XQ5A 2Y54A 2W8GA 5L4HA 5J5GA 2M6IA 3P4WA 4HFIA 2XYSA 4Z91A 4HQPA 5J5HA 3SQ6A 4UM3A 2X00A 2WNLA 4QABA 3EI0A 5KZUA 4ILAA 3IGQA 2XZ5A 4Z90A 1OEDE 5HCJA 4AFGA 4XK9A 4B5DA 2X00D 5JMEA 4HFEA 2XQ3A 5HEHA 3WTIA 4BFQA 5J5IA 1OEDB 5LXBA 3JAFA 2LKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHZ A;  4IRE A;  5LG3 A;  5HCM A;  5BW2 A;  5HEJ A;  5AFJ A;  4ALX A;  3WTN A;  2XQ7 A;  3WTL A;  2XNT A;  2BYR A;  5CO5 A;  2YOE A;  2KSR A;  4ZK1 A;  3SH1 A;  4TWF A;  3UQ4 A;  3UU3 A;  3U8N A;  4ZZB A;  4HFC A;  2YN6 A;  4HFB A;  2YME A;  5AIN A;  3ZKR A;  3WTH A;  2W8F A;  3TLS A;  3EAM A;  3U8K A;  4ILC A;  3UU5 A;  4EZ1 A;  5AFN A;  4ILB A;  4TWH A;  4IL4 A;  4FRR A;  4LMJ A;  2BYN A;  2PGZ A;  3WTJ A;  2BYP A;  3GUA A;  5BRX A;  4ZJT A;  2XQ6 A;  4QH1 A;  3TLW A;  5CFB A;  4NZB A;  4QH5 A;  3UU8 A;  2BG9 A;  3LSV A;  3RI5 A;  3ZDG A;  1UW6 A;  2ZJU A;  5J0Z A;  4XHE A;  4LML A;  5KE4 A;  5IUX A;  3WTK A;  5TVC A;  3PEO A;  2Y56 A;  4HFD A;  4AFT A;  2BYQ A;  2MAW A;  4PIR A;  2LKG A;  5FJV A;  3TLU A;  3WIP A;  4F8H A;  2ZJV A;  4ZK4 A;  3T4M A;  3U8J A;  4QAA A;  5AFM B;  2XQA A;  2BYS A;  4LMK A;  3SQ9 A;  5AFL A;  3SIO A;  5HEG A;  5L47 A;  4X5T A;  1I9B A;  3WTM A;  3RHW A;  2BJ0 A;  2BG9 C;  3UU4 A;  2WNJ A;  4UM3 P;  4TNW A;  2XQ8 A;  1OED A;  5AFM A;  2PH9 A;  2XQ4 A;  5HEU A;  4COF A;  2VL0 A;  4WV9 A;  3C79 A;  4QAC A;  4UM1 A;  2XYT A;  4ZJS A;  4ZRU A;  2XZ6 A;  4IL9 A;  4TWD A;  4D01 A;  2BR8 A;  4UXU A;  3RQU A;  3RIF A;  2YMD A;  3TLV A;  3PMZ A;  5BP0 A;  5L4E A;  3RIA A;  3C84 A;  4AFH A;  4BQT A;  4UY2 A;  2LLY A;  2Y58 A;  4ZR6 A;  3U8M A;  4HFH A;  2XNU A;  2BR7 A;  2BG9 E;  4ZZC A;  2LM2 A;  3TLT A;  3UQ7 A;  2WNC A;  3U8L A;  4DBM A;  2M6B A;  4NPP A;  1UV6 A;  2UZ6 A;  4A97 A;  5HEO A;  4TNV A;  2BG9 B;  2QC1 B;  5AFH A;  5J5F A;  2C9T A;  1OED C;  1UX2 A;  3UU6 A;  4QH4 A;  2XQ9 A;  5AFK A;  3JAD A;  2WZY A;  2YKS A;  2Y57 A;  2Y7Y A;  3RQW A;  2WN9 A;  2XNV A;  3ZDH A;  5SYO A;  4A98 A;  3WTO A;  3P50 A;  3UUB A;  4UM3 S;  3JAE A;  2XQ5 A;  2Y54 A;  2W8G A;  5L4H A;  5J5G A;  2M6I A;  3P4W A;  4HFI A;  2XYS A;  4Z91 A;  4HQP A;  5J5H A;  3SQ6 A;  4UM3 A;  2X00 A;  2WNL A;  4QAB A;  3EI0 A;  5KZU A;  4ILA A;  3IGQ A;  2XZ5 A;  4Z90 A;  1OED E;  5HCJ A;  4AFG A;  4XK9 A;  4B5D A;  2X00 D;  5JME A;  4HFE A;  2XQ3 A;  5HEH A;  3WTI A;  4BFQ A;  5J5I A;  1OED B;  5LXB A;  3JAF A;  2LKH A; 
#chains in the Genus database with same CATH topology
 3FBL A;  4O8S A;  3NBX X;  4DV6 T;  2FJE A;  4MBQ A;  2Y48 B;  4HFC A;  1YXR A;  1SUM B;  5KMG P;  5J2U E;  3U8K A;  1SHZ C;  3OPC A;  4UR9 A;  4XAX B;  4LMJ A;  2BYN A;  2WU2 A;  4B6X A;  5C2T A;  2WAU A;  4EYY R;  4YY3 T;  2XAF B;  2V7M A;  1FMW A;  5J0Z A;  4X66 T;  3SWH A;  2X0H A;  3ZMU B;  5AQF B;  2Y56 A;  3I9Y A;  3PUW F;  5FKY A;  2LKG A;  4XZC A;  3AXJ B;  5LNK A;  3SQ9 A;  4L0R A;  5AQO B;  3ETU A;  4LF9 T;  3WTM A;  4FI5 A;  3SOL A;  2WMO A;  2QYW A;  3FHN A;  4WZX A;  3C4X A;  1H7C A;  3PTR B;  2JQ9 A;  2LSJ A;  3CML A;  5FVL A;  5ABH A;  2CWO A;  2V26 A;  1HR0 T;  2UUB T;  3U8M A;  4U72 A;  4HFH A;  3UQ7 A;  2M6B A;  3DJB A;  2HPL A;  3CK6 A;  1HF8 A;  4BJN A;  1HTJ F;  1CUN A;  2BBH A;  2PBI A;  3PJA J;  3P4W A;  3SQ6 A;  1BR1 A;  4ILA A;  2I0M A;  4XK9 A;  4J2C A;  5HEH A;  5AFM B;  3GN5 B;  3JAF A;  2LKH A;  4ILU A;  5HCM A;  3IF8 B;  2I59 A;  2A72 A;  3AEC A;  4JBW F;  3N9Q A;  4JI5 T;  4OFZ A;  2NWB A;  3CIR A;  3Q2M A;  2H88 A;  2XM2 A;  4PW8 A;  4HWF A;  4WBO A;  3CVR A;  2IW5 B;  2XAS B;  4EOZ B;  1E2A A;  5AQN B;  2CXL A;  3AEE A;  4KHP T;  4DND A;  4ZJT A;  1NAF A;  4PJL A;  2Z6E A;  3NVO A;  2E8I A;  4O2B E;  3Q5D A;  3UU8 A;  2ES0 A;  4JLE A;  4F6R C;  2ZJU A;  2X9W A;  5FVK A;  5KE4 A;  4WW0 A;  3RGL A;  2CCQ A;  1KNR A;  4HWD A;  2YU2 A;  3EUH A;  4KHZ F;  5FY7 A;  5JQG E;  4DV2 T;  4GKK T;  1Y01 A;  2E5V A;  1U4Q A;  4H9Q C;  5ABG A;  3SRZ A;  1MMD A;  4ZJS A;  4TN7 B;  3VKH A;  3WAJ A;  4U7Y A;  2X0L B;  2B1E A;  2YMD A;  5BP0 A;  2C5I T;  3C84 A;  4HWI B;  5EZY E;  1KFY A;  5HEO A;  5J5F A;  5LMN T;  3RQW A;  3P50 A;  1WR6 A;  3H37 A;  3AA7 B;  5CGM A;  3L8R A;  3F2E A;  3UFE A;  4JI1 T;  3NZQ A;  1OED E;  3H3M A;  2CM0 A;  3A7M A;  3TKL B;  2FJB A;  5HEJ A;  2VL8 A;  2LOP A;  2BYR A;  4AXP A;  4H9P C;  4AIS A;  1E1H B;  5HAX A;  2YIN A;  3PUX F;  1T8B A;  5TAO A;  2FUP A;  5FNV E;  1BR2 A;  5AQK B;  4LF7 T;  2WDQ A;  2XQ6 A;  3AAE B;  4YSZ A;  2W66 A;  4AKL A;  1KEY A;  2P9B A;  4TUY E;  1G8X A;  5LB7 B;  3GWH A;  3C50 A;  2C5K T;  3ONL C;  3BQL A;  3I0Q A;  5ETW A;  4DO0 A;  3AE2 A;  4OYK A;  5KX5 E;  3K3Q C;  2WNJ A;  1J1J A;  4ANJ A;  5CJ5 A;  4YSY A;  1BR0 A;  1VCS A;  4CN6 A;  1S94 A;  1VCT A;  4IL9 A;  3ONX A;  4HWC A;  4O4I E;  4ZS3 A;  4UEL A;  2LSI A;  3MK7 C;  3KBT A;  4NPP A;  5C3J A;  2ZMA A;  3P4Q A;  3P4S A;  2V1D B;  4B3R T;  3RKO A;  3JAD A;  2WZY A;  3RPU A;  2W61 A;  3UFG A;  4YT0 A;  3ZMV B;  2X00 A;  2CXD A;  3KVB A;  3VR9 A;  2VB6 A;  1US7 B;  2NW8 A;  4WBN E;  1LRZ A;  3WTN A;  3AXJ A;  4GYR A;  3P4P A;  3C64 A;  5L3D B;  3U8N A;  3GMI A;  3N9O A;  4H9N C;  4PK5 A;  2CXF A;  4YTM A;  2QGS A;  4IL4 A;  4ADZ A;  2WDV A;  4Q25 A;  3FXE B;  5AQR B;  4EB6 E;  5H6R B;  4LF4 T;  4AKR B;  5AQM B;  2CMR A;  3ZDG A;  1L0V A;  2L3L A;  2DI4 A;  4JV5 T;  4AQY T;  5TVC A;  5ADX L;  3N9M A;  2JMH A;  2UXD T;  4U33 A;  4IE4 A;  3KV9 A;  4KUM B;  4GYS A;  1I9B A;  2BKO A;  3UU4 A;  2XQ8 A;  3O1J A;  5AFM A;  3GN5 A;  3E0Z A;  1LVK A;  4ZRU A;  2XZ6 A;  5FXX A;  4IDP A;  2LHN A;  4UXU A;  4UV9 B;  3RQU A;  2CPT A;  3LDQ B;  3RIF A;  4DV0 T;  4AFH A;  2Y58 A;  3C4W A;  2VUR A;  5AQL B;  2V8S V;  2BG9 B;  4A5X A;  3NZP A;  4CQI A;  3UU6 A;  4QH4 A;  2DLR A;  2WDR A;  5SYO A;  1XNQ T;  4EXT A;  4JI4 T;  4Z8X A;  5AFJ A;  3Q9D A;  4CXW A;  1HG5 A;  1W9R A;  4DR4 T;  3ZJ2 A;  5C8Y E;  5LCY A;  3UU3 A;  5JRC B;  2IML A;  2YME A;  4JEU B;  4ILC A;  1MNE A;  4XBF B;  4DR2 T;  5AQQ B;  4ILB A;  4HKA A;  2PG8 A;  4YJ3 E;  3HKE E;  5LA6 E;  3WTJ A;  3LBX B;  4DBQ A;  3RC8 A;  3A5X A;  2VK9 A;  1N33 T;  3DP7 A;  1EZ3 A;  4QXH B;  1Z0P A;  1MMG A;  3PV0 F;  3J9X 1;  2DNX A;  4KBM B;  4YHH T;  4NUU A;  3AE4 A;  2W0G A;  4HEA A;  2MAW A;  5JDM A;  3AAI A;  3QB5 A;  3PJA A;  2UXC T;  3WIP A;  4H9R C;  2NW9 A;  3RLF F;  2ZJV A;  2EHO C;  4U2Z A;  3SIO A;  2KWH A;  4DID B;  3OVU A;  5ABF A;  3M3Z B;  4DR5 T;  4COF A;  4EGW A;  3I0O A;  3RX6 A;  5L4E A;  3U8L A;  2X9Y A;  3RYF E;  1T72 A;  4IHJ E;  3L09 A;  2RPA A;  5AFK A;  4I50 E;  3O9X A;  1VOM A;  4DV1 T;  2XJ7 A;  4Z91 A;  5F5W A;  5CB4 E;  2XZ5 A;  4ZI2 C;  3RRC A;  4AFG A;  3O1I A;  5JME A;  4TZ4 C;  3CX8 B;  3N2G E;  4L9I A;  4O2A E;  5JDQ A;  4G2A A;  2CRB A;  2X0Y A;  2XQ7 A;  2XTL A;  3N5L A;  4HFB A;  2E9X B;  2LE8 A;  2KND A;  3MAC A;  2CEA A;  4X65 T;  4P1N A;  4IIJ E;  2ACZ A;  2EHO A;  1HCI A;  1X9B A;  3TLW A;  5FY0 A;  2MTQ A;  3KVA A;  3WI3 A;  2QVA A;  3QNU A;  3MKD A;  3RYH E;  2Y6X A;  4HFD A;  3AEB A;  2CBI A;  3AA0 B;  2SPC A;  4ZK4 A;  3AE7 A;  1XZY A;  3FZH B;  5J2T E;  2RA1 A;  2BG9 C;  4BJM A;  2WM9 A;  5LHG B;  2YDS A;  5HWX A;  3LK3 B;  4DR7 T;  4UV8 B;  2XHE B;  1XNR T;  2XNU A;  2LM2 A;  2RP4 A;  3ANW B;  2QC1 B;  1VRB A;  1UUR A;  1UX2 A;  4HGA A;  3W15 B;  2XY8 B;  1KK7 A;  4JI2 T;  3OYZ A;  1S35 A;  2XUE A;  4TV8 E;  3CQC B;  2VKO A;  5HCJ A;  2X67 A;  3ZCJ A;  4HE8 A;  1OED B;  2W63 A;  3C51 A;  2WWU A;  2LRL A;  2WBL A;  4ZK1 A;  5L3G B;  5LJM A;  4BA9 A;  5AFN A;  5L3F B;  1QSD A;  4ZHQ E;  2PGZ A;  3RRW A;  5A1L A;  4X20 E;  1HNW T;  4EED A;  1YD8 G;  4M1P A;  2XQY A;  4JI8 T;  4NZB A;  2DL1 A;  4DVD A;  4DUZ T;  2IAK A;  3QC9 A;  2BG9 A;  2VKD A;  2D0U A;  2J62 A;  2WQY A;  2IC6 A;  4I4T E;  4HTE A;  5KDM C;  3VU7 H;  2K5B B;  5FYM A;  1NEK A;  4AQG A;  2XZE A;  1YKH B;  1D0X A;  5DAB A;  3EDV A;  2XAG B;  5LGT B;  5J1G A;  4GIW A;  1HFA A;  1MMN A;  2KXP B;  5JRC A;  2N1G A;  5AQV B;  1NEN A;  2GK9 A;  4ZZC A;  2CLY B;  4IT4 A;  4PNI A;  2DCF A;  2WN9 A;  2XNV A;  3LBX A;  4UVC B;  4HQP A;  2ODU A;  4GOU A;  4MLK A;  2E9X C;  4QX7 B;  5IHY A;  4DV4 T;  4QAB A;  3EI0 A;  3FXD B;  5AQP B;  2OA5 A;  3BQK A;  5LMU T;  4GK5 E;  4DV5 T;  2V6Y A;  4I0U A;  2H3R A;  2UXX B;  3PUZ F;  5M4Y A;  3ZCI A;  2FBW A;  3L39 A;  4KMC A;  2UXB T;  2E2A A;  3ZKR A;  1IBL T;  3RC3 A;  2V7L A;  3UU5 A;  3IA3 A;  5L3C B;  2A3D A;  4N78 D;  3RH3 A;  5AQU B;  5ABF B;  1CHU A;  3E22 E;  2BS2 A;  3MA9 A;  2BDE A;  4EZH A;  2YDR A;  4XHE A;  5HYA A;  4LFA T;  4QWN B;  2JPF A;  5IUX A;  2BZB A;  1NWM X;  2LHR A;  2PTF A;  4ISS A;  4U74 A;  4H9O C;  4TV9 E;  3LJC A;  1HG2 A;  1D1B A;  4IE0 A;  3TLU A;  4QXC B;  4IE7 A;  5JTG A;  2MOZ A;  2X66 A;  2Q9Q B;  4X5T A;  2WMN A;  4UM3 P;  3ONJ A;  4TNW A;  3SS1 A;  5HXR A;  4ZEY A;  3N2O A;  5JVD E;  2VL0 A;  3RIU C;  4QAC A;  3C4Z A;  5HXE A;  4CZZ B;  4LF6 T;  3TLV A;  4QXB B;  2IIU A;  1ZP0 A;  2E9X A;  5ABE A;  2K48 A;  2YK0 A;  1OED C;  3Q5E A;  2XSB A;  2WP9 A;  1HS7 A;  3AAA B;  1XMO T;  3OJA A;  4PJN A;  4UF0 B;  3ZPO A;  4MFR A;  5KZU A;  2VVS A;  4O4J E;  2EHO B;  2QRX A;  2V5C A;  2WCA A;  4IRE A;  4OHF A;  1FJG T;  4YSX A;  4PFP A;  3UUX B;  3AEF A;  5JR9 C;  1WYC A;  4AKG A;  4CI1 B;  4DMW A;  3EAM A;  3VRA A;  1MMA A;  4EZ1 A;  2NTX A;  4QHO A;  2D5U A;  2J4G A;  2UUC T;  4X1I E;  3SFD A;  2LSG A;  2NR4 A;  5DJQ C;  3ANW A;  1MIY A;  3J7Y q;  1WFD A;  3CPZ A;  3ETV A;  2JQQ A;  3RIU A;  5FMN A;  1ZOY A;  2NP9 A;  3ZYM A;  2XSA A;  1IJ5 A;  3JCF A;  3B5M A;  2XQA A;  2MYS A;  3AVR A;  5AQS B;  5HEG A;  2CLY C;  2ZM2 A;  4DMV A;  1UK5 A;  1OED A;  4EYU A;  3DTO A;  5AQG B;  1KNZ A;  1WLX A;  3V5U A;  5E0O A;  3PMZ A;  5LHH B;  2LLY A;  5IYZ E;  2BR7 A;  1WYB A;  5FL1 A;  2UZ6 A;  1X79 A;  5AFH A;  2YKS A;  2D9D A;  4X62 T;  3JAE A;  4I55 E;  3L3P A;  1HX1 B;  4UVB B;  3IBP A;  2M6I A;  2XYS A;  1UGO A;  4EV6 A;  3LK4 2;  2VAS A;  4HN9 A;  5JR9 A;  3X1D A;  5AFU L;  3ZT6 A;  1MIV A;  4B5D A;  5LBQ B;  4BFQ A;  2IUB A;  2ODV A;  3FBZ A;  4DUY T;  2A2F X;  2WB5 A;  1T7S A;  3R6N A;  1XWM A;  1XDO A;  1KF6 A;  3ZC1 A;  4TWF A;  2C0S A;  4ZZB A;  4H9S E;  2DHR A;  1WR0 A;  2FJD A;  4NUV A;  5LG4 A;  5JRE A;  1W0B A;  1XMQ T;  4OK0 A;  3ZN1 B;  1LKX A;  2BKP A;  3ZLI A;  5HXS A;  2FJA A;  3LG7 A;  2Q9Q C;  2YEV C;  4U3C A;  2VKJ A;  4QH5 A;  2CHO A;  3P8C D;  2A9U A;  3WTK A;  1IBK T;  5HWY A;  5LOV E;  3UUL A;  3A8Y C;  4E7S A;  5FJV A;  5CA0 E;  4P0B A;  4F8H A;  2L8K A;  1M62 A;  4IDQ A;  3S4U A;  2X51 A;  3JC6 C;  1N36 T;  2PH9 A;  2XQ4 A;  3AA1 B;  2H89 A;  2PJQ A;  2AXD S;  2NW7 A;  2N9D A;  2WU5 A;  1ZEE A;  1R8I A;  4EAH A;  2MBG A;  4NXM T;  3VR8 A;  4EEB A;  2V6Y B;  2VKH A;  2YU1 A;  5DQW A;  1SE7 A;  1UCU A;  1MND A;  5F3J A;  2BKN A;  3H3A A;  5EK3 A;  5AQJ B;  4A98 A;  3VRB A;  2HHH T;  3QOF A;  2ZM8 A;  3BK9 A;  5J5H A;  3ZYL A;  4HFE A;  3HR0 A;  4ZI7 E;  3WTI A;  5J5I A;  1HNZ T;  1YW0 A;  2LJL A;  2VVN A;  3M65 A;  4LF8 T;  4IDZ A;  2XNT A;  2L9Q A;  2BBJ A;  2Q9Q A;  4IDN A;  5FP3 A;  5CA1 E;  3N9L A;  2W2U A;  3N2K E;  4IGU A;  3CX6 B;  4ZXL A;  4AKI A;  2V6X A;  2JMK A;  3AE9 A;  2C5J A;  3RYC E;  3LSV A;  4V1A v;  4CN1 A;  1UW6 A;  4PJJ A;  4GKJ T;  3EDU A;  2KLQ A;  2ZM6 T;  4AFT A;  3NRX A;  2JQK A;  4X1Y E;  3K1S A;  3T4M A;  1OWA A;  4UF0 A;  2WZH A;  2BYS A;  3HI2 A;  2E9X D;  1JNZ A;  3RHW A;  1ZKE A;  1KNP A;  4NIQ A;  1JNR A;  3RYI E;  5LGU B;  3MJX A;  3C79 A;  3ZN0 B;  5FL0 A;  4TWD A;  3G06 A;  1UX5 A;  3Q5W A;  4BQT A;  2AE9 A;  3KBU A;  4DBM A;  3VKG A;  2G0U A;  2XPK A;  2C9T A;  2LT3 A;  4AIU A;  5BR8 T;  4DBR A;  5AQI B;  4JEH B;  2JJ9 A;  2UU9 T;  4HWH A;  3P7I A;  3AED A;  3ZT5 A;  4DR3 T;  2X00 D;  2QA7 A;  2LM9 A;  2XM1 A;  4H63 V;  4UM3 S;  3LFM A;  2X9H A;  3WTL A;  2M67 A;  3N9P A;  4MAL A;  3AE3 A;  2VQE T;  3SH1 A;  3SFE A;  3QB5 K;  5LBM A;  5L3E B;  3CQX C;  3IHR A;  4DR6 T;  4E7Z A;  1J5E T;  4L5G A;  4QH1 A;  1I6Z A;  5LJN A;  2W67 A;  3KV5 A;  1IZN B;  4NXN T;  3AE6 A;  4CI2 B;  4B3T T;  3K3O A;  3OYX A;  4YJ2 E;  2HH7 A;  4YTN A;  4LMK A;  1B7T A;  4LF5 T;  4AI6 A;  1IAP A;  3T8O A;  3CQG B;  2CHN A;  2X68 A;  5JR9 B;  1QLB A;  3B57 A;  4AQF C;  2ZM0 A;  4TX5 A;  3EAB A;  3BQI A;  3TLT A;  3RKG A;  2KIN B;  4UIG A;  1U5P A;  4X64 T;  2W00 A;  4AKH A;  3ZYK A;  2D2S A;  1AJ3 A;  1LVF A;  2X9X A;  2XQ5 A;  3ZJ1 A;  4HFV A;  5LYJ E;  3F57 A;  2WNL A;  4CI3 B;  2IC9 A;  2V7K A;  2K3W A;  2CBJ A;  4GK0 E;  4A56 A;  2Y54 A;  5LG3 A;  4ALX A;  1HX8 A;  3R84 B;  3FB2 A;  4EIW A;  1Y64 B;  4ZI3 C;  2KSR A;  3VHL A;  3PU3 A;  3UQ4 A;  1IBM T;  2J1D G;  2W8F A;  5FXV A;  2BVM A;  2XAJ B;  2F4V T;  1FMV A;  3N9N A;  3ZMT B;  3Q5X A;  3MZK B;  3HKD E;  5EK2 A;  2BYP A;  3EVY A;  1W09 A;  4PAG A;  5L3B B;  3CX7 B;  4K0K T;  4QKN A;  2YDQ A;  2LSY A;  3U3I A;  2CE7 A;  2DWG A;  4AQF A;  3U8J A;  3FZM B;  4LFB T;  2LEH A;  5AFL A;  3NKZ A;  4PK4 A;  1M7K A;  2LRK A;  2JQH A;  2WSS V;  2IHR 1;  5F8P A;  3IEE A;  3RIA A;  4YFS A;  4UY2 A;  1O3X A;  4CXX A;  4WYV A;  1UV6 A;  3OBV E;  3O1H A;  2R6G F;  1SA0 E;  5HXH A;  2XQ9 A;  2Y57 A;  3ZDH A;  3T1Y T;  3WTO A;  4JI3 T;  2Q9Q D;  1W0A A;  4YTP A;  4UM3 A;  3PDY A;  4Z90 A;  1DU2 A;  2HN1 A;  5DQV A;  5FXW A;  5AQH B;  3EHZ A;  5BW2 A;  5HXC A;  3ZMZ B;  4ASK A;  5CO5 A;  1XDP A;  3PUQ A;  3JC6 D;  3T1H T;  2YN6 A;  3LK2 B;  2CA5 A;  3K8P C;  1IJ6 A;  3C98 B;  2KZ7 B;  2NOX A;  1ZV4 X;  1GQE A;  5BRX A;  2K24 A;  2EHO D;  5BMV E;  2D0T A;  3RI5 A;  2CWY A;  3NRY A;  5LGN B;  1MIW A;  5LHI B;  3PEO A;  3PUS A;  3UUN A;  3I9W A;  2B76 A;  4KI0 F;  1OXZ A;  1E7P A;  4YLH A;  4PIR A;  3OKQ A;  1N34 T;  2I6H A;  4G63 A;  4ERR A;  2BS4 A;  4C90 A;  3ABV A;  4WV9 A;  2XAH B;  4UEM A;  2XYT A;  4PJM A;  4DV3 T;  2KMF A;  2BR8 A;  4JI6 T;  4PK6 A;  1YQ4 A;  4P0A A;  1QUU A;  2WNC A;  4A97 A;  2PFV A;  2XAQ B;  4TNV A;  2HPJ A;  3KDS E;  3ZST A;  4U7I A;  4ZI2 D;  3UTK A;  2ACX A;  3UUB A;  5JDL A;  2JIW A;  2KWI B;  1N32 T;  5J5G A;  3WAK A;  5FXZ A;  2DWK A;  5FY1 A;  3PUY F;  4KP3 C;  1WCR A;  3KIN B;  4BAY B;  5LXB A;  5JDN A;  3HA4 A;  3AA6 B;  3K3N A;  1UX4 A;  4QX8 B;  4IST A;  4DR1 T;  3QK6 A;  4IE5 A;  3I1A A;  3WTH A;  1FIO A;  3TLS A;  4CN4 A;  3AEA A;  4LFC T;  2Y8D A;  3QUJ A;  4U2Y A;  5CFB A;  2WY2 A;  2OV9 A;  2HN2 A;  4U31 A;  2BYQ A;  5JDH A;  2BS3 A;  4PFO A;  4YXD A;  4MHC A;  3PU8 A;  4O4L E;  1J5W A;  2LOS A;  2BJ0 A;  2BVL A;  3FZK B;  4X1K E;  3AE8 A;  4IE6 A;  4UM1 A;  4OX9 T;  3HKC E;  3NWI A;  3FZL B;  2KT9 A;  2ZLY A;  4B3S T;  1Z8U A;  1D1A A;  3KV4 A;  2E5L T;  2WZI A;  5EK4 A;  1FEW A;  3AE5 A;  3CKD A;  4I43 B;  2Y7Y A;  3ZSS A;  5AQT B;  4HFI A;  4IDO A;  4CXY A;  4ZOL E;  4EZ4 A;  3AB3 B;  2V5D A;  3ZT7 A;  3IGQ A;  3PUR A;  3PE0 A;  3KV6 A;  2MPK A;  3ZMS B;  2XQ3 A;  3E08 A;  3OTO T;  4JYA T;  3V5S A;  2V7J A;  2YOE A;  4YHJ A;  5JDG A;  5H6Q B;  4H63 H;  2NTY A;  4WNK A;  5AIN A;  1YKE B;  1V9D A;  4FJO A;  3UUM A;  5GON E;  1D1C A;  4TWH A;  3GA8 A;  5L2L A;  5JH7 E;  4FRR A;  2VWA A;  3RF1 A;  3ZEF B;  3O4X E;  3F31 A;  2OLT A;  3GUA A;  4B3M T;  1BR4 A;  3PUG A;  3AEG A;  1G73 A;  4DV7 T;  3ESL A;  4LML A;  4JUY A;  4JI0 T;  3MXZ A;  2WS3 A;  2VQF T;  4K0U A;  2WWV A;  5IWA T;  4C91 A;  4QAA A;  2J47 A;  3AVS A;  4ZS2 A;  5L47 A;  3KFW X;  3ZC0 A;  5LP6 E;  3UT5 E;  3CWZ B;  2V7I A;  5HEU A;  3HKB E;  4KX6 A;  3B13 A;  3D0T A;  2LSK A;  4D01 A;  5JDF A;  1WRD A;  4P09 A;  2UXN B;  3FZF B;  4ZI3 D;  5LXT E;  1T98 A;  4OYJ A;  4ZR6 A;  1YQ3 A;  2BG9 E;  3P4R A;  2W4X A;  2IDO B;  4O4H E;  1ZHC A;  4UXN B;  3U78 A;  2JRK A;  2N2N A;  4UVA B;  5KXJ A;  2W8G A;  5L4H A;  2H7V C;  2W62 A;  3PUA A;  3HL6 A;  1I94 T;  2K9A A;  2H7O A;  1HNX T;  3AE1 A;  1D0Y A;  2UUA T;  3PUV F;  4JI7 T;  1D0Z A;  1UUS A; 
#chains in the Genus database with same CATH homology
 3EHZ A;  4IRE A;  5LG3 A;  5HCM A;  5BW2 A;  5HEJ A;  5AFJ A;  4ALX A;  3WTN A;  2XQ7 A;  3WTL A;  2XNT A;  2BYR A;  5CO5 A;  2YOE A;  2KSR A;  4ZK1 A;  3SH1 A;  4TWF A;  3UQ4 A;  3UU3 A;  3U8N A;  4ZZB A;  4HFC A;  2YN6 A;  4HFB A;  2YME A;  5AIN A;  3ZKR A;  3WTH A;  2W8F A;  3TLS A;  3EAM A;  3U8K A;  4ILC A;  3UU5 A;  4EZ1 A;  5AFN A;  4ILB A;  4TWH A;  4IL4 A;  4FRR A;  4LMJ A;  2BYN A;  2PGZ A;  3WTJ A;  2BYP A;  3GUA A;  5BRX A;  4ZJT A;  2XQ6 A;  4QH1 A;  3TLW A;  5CFB A;  4NZB A;  4QH5 A;  3UU8 A;  2BG9 A;  3LSV A;  3RI5 A;  3ZDG A;  1UW6 A;  2ZJU A;  5J0Z A;  4XHE A;  4LML A;  5KE4 A;  5IUX A;  3WTK A;  5TVC A;  3PEO A;  2Y56 A;  4HFD A;  4AFT A;  2BYQ A;  2MAW A;  4PIR A;  2LKG A;  5FJV A;  3TLU A;  3WIP A;  4F8H A;  2ZJV A;  4ZK4 A;  3T4M A;  3U8J A;  4QAA A;  5AFM B;  2XQA A;  2BYS A;  4LMK A;  3SQ9 A;  5AFL A;  3SIO A;  5HEG A;  5L47 A;  4X5T A;  1I9B A;  3WTM A;  3RHW A;  2BJ0 A;  2BG9 C;  3UU4 A;  2WNJ A;  4UM3 P;  4TNW A;  2XQ8 A;  1OED A;  5AFM A;  2PH9 A;  2XQ4 A;  5HEU A;  4COF A;  2VL0 A;  4WV9 A;  3C79 A;  4QAC A;  4UM1 A;  2XYT A;  4ZJS A;  4ZRU A;  2XZ6 A;  4IL9 A;  4TWD A;  4D01 A;  2BR8 A;  4UXU A;  3RQU A;  3RIF A;  2YMD A;  3TLV A;  3PMZ A;  5BP0 A;  5L4E A;  3RIA A;  3C84 A;  4AFH A;  4BQT A;  4UY2 A;  2LLY A;  2Y58 A;  4ZR6 A;  3U8M A;  4HFH A;  2XNU A;  2BR7 A;  2BG9 E;  4ZZC A;  2LM2 A;  3TLT A;  3UQ7 A;  2WNC A;  3U8L A;  4DBM A;  2M6B A;  4NPP A;  1UV6 A;  2UZ6 A;  4A97 A;  5HEO A;  4TNV A;  2BG9 B;  2QC1 B;  5AFH A;  5J5F A;  2C9T A;  1OED C;  1UX2 A;  3UU6 A;  4QH4 A;  2XQ9 A;  5AFK A;  3JAD A;  2WZY A;  2YKS A;  2Y57 A;  2Y7Y A;  3RQW A;  2WN9 A;  2XNV A;  3ZDH A;  5SYO A;  4A98 A;  3WTO A;  3P50 A;  3UUB A;  4UM3 S;  3JAE A;  2XQ5 A;  2Y54 A;  2W8G A;  5L4H A;  5J5G A;  2M6I A;  3P4W A;  4HFI A;  2XYS A;  4Z91 A;  4HQP A;  5J5H A;  3SQ6 A;  4UM3 A;  2X00 A;  2WNL A;  4QAB A;  3EI0 A;  5KZU A;  4ILA A;  3IGQ A;  2XZ5 A;  4Z90 A;  1OED E;  5HCJ A;  4AFG A;  4XK9 A;  4B5D A;  2X00 D;  5JME A;  4HFE A;  2XQ3 A;  5HEH A;  3WTI A;  4BFQ A;  5J5I A;  1OED B;  5LXB A;  3JAF A;  2LKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...