5HCJA

Cationic ligand-gated ion channel
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Sites of Anesthetic Inhibitory Action on a Cationic Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hcjA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hcjA01
5CFBA 2BR7A 2PH9A 3U8NA 3PEOA 2M6BA 3WTKA 4LMKA 4QH4A 4AFGA 2LM2A 4TWHA 4ILAA 3TLVA 3SIOA 4A97A 4ZZCA 3P4WA 3JAEA 2VL0A 5J5HA 2YMEA 3RIFA 5AFKA 4Z91A 4ZJSA 4QAAA 4BQTA 2MAWA 3RIAA 4LMJA 2XNVA 2UZ6A 2X00D 2Y56A 3ZDHA 2XZ6A 3PMZA 3RQUA 3U8JA 2ZJUA 3GUAA 4HFIA 2WZYA 4HFDA 2BYPA 4XHEA 4UM3S 4NPPA 4IL9A 2XQ5A 2XQAA 2LLYA 5J5FA 5AFJA 2W8GA 2M6IA 4TWFA 4FRRA 3WTNA 3UU4A 3EHZA 4HQPA 3WTOA 5L4EA 2LKHA 2XQ3A 3JADA 4QACA 3EAMA 4D01A 4NZBA 5AFHA 2XNUA 4ZR6A 5LG3A 2X00A 2WNCA 4ZK4A 4BFQA 4QH5A 2XQ7A 4ZJTA 3WIPA 5AFLA 3SQ9A 3TLUA 5IUXA 4HFCA 2XNTA 4B5DA 5L4HA 5FJVA 3SH1A 5BW2A 4UXUA 4PIRA 4XK9A 5KE4A 4AFTA 3TLWA 5J5GA 2Y54A 5HEOA 3U8KA 3ZDGA 4ZK1A 5HEJA 2BYRA 2XQ6A 2XYSA 2Y57A 4Z90A 5AFMB 3TLTA 2KSRA 5HCJA 3U8LA 4ALXA 2WNJA 4ZRUA 4AFHA 4A98A 4UY2A 5AFMA 1UX2A 2BYNA 1OEDE 2BJ0A 5KZUA 5L47A 3T4MA 3JAFA 2ZJVA 5J5IA 3UU8A 1OEDC 2PGZA 1OEDB 3C79A 2XYTA 5HEUA 4F8HA 5LXBA 2C9TA 4ZZBA 3UQ4A 1UW6A 5SYOA 5JMEA 3UUBA 2WNLA 5HCMA 3UU5A 3UQ7A 3WTMA 2BG9C 3P50A 3U8MA 3LSVA 2YMDA 4QABA 2Y58A 2YN6A 2BR8A 4QH1A 2BYSA 2XQ9A 5AINA 1UV6A 3WTHA 2QC1B 4UM1A 4ILBA 4WV9A 2XQ4A 4HFBA 4IL4A 3RI5A 4TNWA 3RHWA 5J0ZA 2BYQA 4DBMA 3WTLA 3WTIA 3IGQA 5HEHA 3UU3A 2LKGA 4HFHA 4HFEA 3EI0A 2YKSA 4COFA 4IREA 3RQWA 2WN9A 2W8FA 5BP0A 4UM3P 4TWDA 2BG9E 4LMLA 2XZ5A 2YOEA 3ZKRA 2Y7YA 5AFNA 2XQ8A 5CO5A 1OEDA 3UU6A 3WTJA 2BG9B 5HEGA 3TLSA 3C84A 3SQ6A 4EZ1A 4TNVA 4X5TA 4UM3A 5BRXA 5TVCA 1I9BA 2BG9A 4ILCA
chains in the Genus database with same CATH superfamily
2LSKA 2E5VA 3OTOT 4NUVA 4KHPT 4YHJA 3JAEA 4M1PA 3P8CD 2VB6A 3CX7B 1J5ET 3GA8A 2BVLA 1XMQT 2EHOD 3D0TA 4O4LE 3C4WA 1Z0PA 3KV9A 2LLYA 1D0ZA 2X0YA 4HTEA 5FNVE 3UU4A 4BAYB 4BFQA 4JEUB 3WIPA 5C2TA 4ISSA 3AEDA 2VQET 2WY2A 5JRCB 2V7LA 2WWVA 4JYAT 3TLTA 2Y6XA 4A98A 3ZEFB 3PUVF 4U2YA 1M62A 3PUQA 3C98B 2NP9A 2V1DB 1D1CA 2YU1A 3PJAJ 5FL1A 4YSXA 2V8SV 2ZM2A 1L0VA 2HN1A 5HYAA 2OV9A 4N78D 3RYIE 3RKOA 4HWDA 3PUSA 4ILBA 4IT4A 5AQRB 4AKLA 4NXNT 4JEHB 1YW0A 2JIWA 4DV6T 2YKSA 4H9PC 3RQWA 5FXWA 3KV5A 3AA6B 4JBWF 2C0SA 1UK5A 4LF9T 5CO5A 2X9XA 2QRXA 5AQLB 5HEGA 1Z8UA 2VQFT 4QXHB 4HGAA 3AE7A 4DO0A 4F6RC 2LSYA 2MBGA 5JR9A 2PH9A 1S35A 2LOSA 2VL8A 1IJ5A 4ZHQE 1E2AA 2C5JA 2BBHA 5AQHB 2H7VC 2CRBA 3MZKB 2X66A 5KX5E 3CX6B 1XDOA 3P4SA 2N1GA 1ZP0A 5AQPB 2A2FX 2WNCA 4L9IA 5LHGB 2WM9A 3MXZA 4DV0T 4UXUA 3WAKA 2LRLA 4HWHA 1YXRA 3PUGA 4DIDB 3L39A 5HCJA 3QB5A 3V5UA 4OYJA 3UFGA 5LGUB 1E7PA 2BVMA 5KZUA 4B3RT 5SYOA 5FXVA 2YDRA 4QX7B 4DV7T 5HCMA 1WYCA 5JREA 3ESLA 2YN6A 2BR8A 3ETVA 4LF7T 1KNPA 3HL6A 4U72A 2NW9A 4NUUA 1NENA 3ZCJA 5C8YE 3UTKA 5JDFA 4EOZB 3ZPOA 2XSAA 5ETWA 2V5CA 4PFOA 4PK6A 5AFNA 4WYVA 2MOZA 3UUXB 3C84A 4G63A 5F3JA 4ILCA 1NEKA 1SA0E 1MMNA 1NAFA 2LOPA 4TWHA 3H3AA 2HHHT 3PUAA 2V7KA 4UV9B 4AKRB 4QWNB 3ONXA 3KVBA 3I0OA 1XNQT 1WRDA 4ANJA 2XAHB 1HS7A 3K3NA 4GYSA 5AQGB 4XZCA 4GKKT 5ABFA 1W09A 3RF1A 4I4TE 4QH5A 2H3RA 3PUYF 2XQ7A 4ZJTA 5AFLA 4HFCA 4QXBB 2XHEB 5J2UE 3RC3A 4WNKA 5LXTE 3AVRA 2KINB 3OYZA 1MMDA 4DR7T 1HTJF 5H6QB 5L3DB 3BQLA 3FZFB 4H9QC 3UU8A 2WB5A 4H63V 2IC9A 2I0MA 3ZJ1A 2B76A 2LSJA 5HXHA 3MACA 4LFBT 1ZOYA 5HEHA 3EI0A 2M67A 1G73A 4CN6A 3P4QA 4GOUA 3O1JA 2YOEA 2Y7YA 4AQYT 2BKNA 1HG2A 4CXYA 1I9BA 3HR0A 3EVYA 3ANWA 2BS2A 1HX8A 3U8NA 3PEOA 3CPZA 4B3ST 1YKEB 2VL0A 2UXXB 1VCTA 4AQGA 1QLBA 2IDOB 4DR5T 2WQYA 2Q9QA 1D1BA 3CX8B 2X00D 2E9XA 3E22E 2IIUA 3MKDA 3GUAA 2WZYA 3HI2A 1ZEEA 4NPPA 3UT5E 3FHNA 2XQAA 1HFAA 3E08A 3A8YC 3WTNA 5LP6E 2JMKA 3ZT7A 3WTOA 3PDYA 2WDVA 5FP3A 3ZMUB 1CUNA 3H37A 3IHRA 5IUXA 5ADXL 5JDQA 2KMFA 4PW8A 2RPAA 2XUEA 2BS3A 1HNWT 2LSIA 3U8LA 4QXCB 4X62T 3G06A 3N9LA 3C79A 2K9AA 4ZZBA 3MA9A 3CK6A 4DV3T 5JR9C 3UQ7A 3P50A 3U8MA 5ABHA 4QABA 1WR6A 2H89A 2JMHA 4IL4A 5LCYA 3RI5A 4L5GA 3WTLA 1WR0A 2ODUA 2UUBT 4CI1B 1IBMT 5LBQB 2VURA 3BQKA 5BP0A 3A5XA 3PTRB 4P0BA 4UV8B 5FY7A 2VWAA 4GK0E 2YU2A 4H9OC 4UM3A 2N2NA 5ABFB 2J62A 4QH4A 3SRZA 3TLVA 3L09A 3Q5DA 3N9QA 3J7Yq 5FY0A 2OA5A 2ZM8A 2VKDA 3O1HA 5IWAT 3RQUA 4YJ3E 3AAEB 1YD8G 3FXDB 2SPCA 1N32T 4PJMA 1BR4A 1N36T 3IA3A 2XNUA 1VOMA 2UXNB 5HXRA 2QA7A 5L4HA 3SH1A 2IUBA 3VHLA 1T7SA 4ZOLE 4IDOA 5FL0A 4KHZF 5KDMC 3H3MA 2X9WA 2KZ7B 5CA1E 1UW6A 5AQUB 5FVLA 3BK9A 5BR8T 3ANWB 3NZQA 5L3FB 2I6HA 2JQHA 3QNUA 4JI8T 1IBLT 3ZMTB 3ZMZB 4EYYR 4YSZA 1I6ZA 3RGLA 4DBMA 4CXXA 5EK2A 2Q9QB 4EZ4A 4UM3P 3C51A 2XQ8A 2DHRA 5AQKB 3KINB 4UVAB 3LFMA 3MJXA 2KXPB 1UX4A 5TAOA 1MMGA 4WZXA 3BQIA 2AE9A 1GQEA 3AE5A 4XBFB 1U5PA 1MNEA 2L3LA 4BQTA 3AE1A 4ISTA 5ABGA 2UZ6A 3ZDHA 3RIUA 2CA5A 3SOLA 4GIWA 2NR4A 5J5FA 1Y01A 3QC9A 3DTOA 4EIWA 4HQPA 3EAMA 4X65T 1HX1B 3FZKB 4YXDA 5KE4A 5J5GA 3AXJB 4ZK1A 4IE6A 2IC6A 1AJ3A 2E8IA 2PTFA 4UY2A 4KP3C 3B5MA 2K3WA 3PU3A 1QUUA 3NWIA 3UUBA 2FJDA 3WTMA 4KX6A 1YQ3A 4PK4A 1XDPA 3C4ZA 1HF8A 4QH1A 3M65A 2W67A 3O9XA 1I94T 2L9QA 5L3CB 3LDQB 2BKOA 2WDQA 3NRXA 5EK4A 3KV4A 2J47A 2Q9QC 4CI3B 4OYKA 3PV0F 3ZYKA 2W8FA 2E9XC 2CWYA 4A5XA 4TUYE 2W2UA 3K3QC 2WU5A 4U74A 4H9NC 2XASB 3WTKA 4LMKA 4BA9A 4U33A 3ZYMA 4O4HE 1LVFA 4WBNE 5KMGP 1XMOT 2V7IA 5JDMA 2BYPA 4UM3S 2J4GA 3AA0B 1XWMA 4HWIB 5CB4E 5JQGE 1BR2A 4U2ZA 1YQ4A 1FIOA 3AEBA 4AFTA 3NBXX 4BJMA 2XJ7A 3ZC0A 4YT0A 2QVAA 2Y57A 2XYSA 1US7B 4Z90A 2W61A 1LRZA 2QGSA 3PU8A 5AFMA 3VKHA 1UX2A 4UELA 1IAPA 3LJCA 3F31A 2XAJB 3WI3A 3EDUA 1UURA 4P09A 5LJMA 3AA7B 3PUZF 3LSVA 3HKCE 2XAQB 4IIJE 1VRBA 2NWBA 5L3BB 4UM1A 1HNZT 2ODVA 4YJ2E 5L3EB 3WTIA 3P4PA 2NW7A 3UU3A 4ZXLA 2VKJA 4UF0A 4HN9A 2WU2A 4DUZT 5AQNB 3FB2A 4MALA 3RRCA 2FJEA 2CPTA 4HFVA 2XZ5A 3Q2MA 1BR1A 3TLSA 2DLRA 5JDGA 5TVCA 2WP9A 4AKIA 4PNIA 2Q9QD 5CFBA 2IMLA 2E9XD 3AVSA 2WZIA 4YSYA 1OXZA 2JQKA 5F5WA 2DL1A 2EHOA 5FYMA 3OPCA 5JDHA 5HXCA 4Z8XA 2MAWA 4LFAT 3O4XE 4O8SA 5IHYA 4AQFA 5AQOB 5AFJA 3IF8B 2LKHA 4QACA 2X0LB 4ZR6A 1CHUA 3RRWA 1LVKA 3KFWX 3AEAA 4OHFA 3CWZB 2V6XA 2ACXA 3ONJA 2BDEA 5JDLA 1VCSA 4JUYA 2UU9T 3U8KA 4EEDA 4LF4T 4YTNA 1JNZA 3ZN0B 2V5DA 2VVSA 2K24A 2BBJA 5AQIB 2D0UA 4DR1T 4AISA 5LXBA 4B3TT 4C91A 4HE8A 1OWAA 2BYSA 3PE0A 3I9YA 5AINA 4DV1T 3LK3B 3RHWA 3C4XA 2FUPA 1UX5A 2WWUA 2P9BA 1T98A 4EXTA 4MBQA 3RIUC 4CI2B 3UU6A 5JR9B 2LRKA 2WMNA 1O3XA 1D0YA 3B13A 5JTGA 5LYJE 3AAAB 2CWOA 1J1JA 4AKHA 4HWCA 4CN1A 3CQCB 3SIOA 3OKQA 3ZC1A 3SWHA 3CMLA 4OFZA 4DV2T 2C5KT 4H9RC 3FBLA 4P1NA 4DBQA 3O1IA 3PMZA 3ZYLA 2KNDA 3DP7A 2ZJUA 2WDRA 1HR0T 2LE8A 4DNDA 4JI7T 2W8GA 4FRRA 4C90A 4D01A 4PJJA 5L4EA 5AFHA 3NKZA 4NIQA 2VK9A 3AE8A 4EEBA 5LMUT 2CHNA 3LG7A 2UUAT 1T8BA 2BYRA 3ZSSA 4DMVA 4AFHA 1SE7A 2V6YA 4WBOA 4DV5T 4IHJE 4JI1T 5L47A 4YTMA 2YK0A 4IGUA 3I0QA 2C9TA 3UQ4A 5JMEA 3R6NA 5FY1A 3AE3A 4DR3T 2JRKA 2Y58A 3DJBA 2XQ9A 2CMRA 4O4JE 2XM2A 2CLYB 4COFA 3GWHA 2W62A 5CJ5A 2R6GF 3C50A 2H88A 2BS4A 2BG9A 3N9MA 3FXEB 1MIYA 4MLKA 4J2CA 1JNRA 4I50E 4DMWA 4O2BE 2UUCT 4LF8T 4BJNA 3CQXC 2UXBT 2Y56A 3ZN1B 2XZ6A 2X67A 5C3JA 3T1YT 3F57A 3N2KE 3Q9DA 4XHEA 2XQ5A 5CGMA 2F4VT 3KVAA 4CQIA 3Q5WA 5HXEA 3FZLB 2KT9A 2XTLA 5AQJB 3LK42 4X1YE 3SQ9A 1FJGT 1X79A 5AQVB 4EB6E 4PIRA 2W0GA 3TLWA 1XNRT 2LM9A 2PG8A 2IHR1 2QYWA 3QK6A 2DWGA 1OEDE 3AE9A 2PGZA 2IW5B 1XZYA 5JDNA 2A9UA 5JH7E 3RYHE 2VVNA 4UR9A 2EHOC 5EK3A 1W9RA 4YFSA 2CLYC 3ZMVB 2B1EA 4TN7B 4AQFC 4B6XA 3K3OA 2G0UA 4HKAA 5BMVE 4TNVA 1N34T 3HKDE 3FZMB 2M6BA 5LG4A 3OYXA 4AFGA 2CE7A 3CQGB 4DVDA 2KWHA 4Z91A 4ZJSA 2KLQA 2E9XB 2BKPA 2VKOA 1D0XA 3NZPA 2LHRA 4U31A 3ZLIA 2V6YB 3RYFE 4IL9A 4TWFA 2Y48B 2D0TA 2YEVC 3C64A 2W4XA 2E2AA 2CBIA 4MHCA 5L2LA 3VRAA 4DUYT 1MNDA 5BW2A 4E7ZA 2YDSA 2Y54A 1UGOA 1MIVA 2PBIA 2YDQA 4G2AA 4FI5A 2XQ6A 2LHNA 4UIGA 2D2SA 4AIUA 1IJ6A 4KBMB 5HXSA 2WS3A 5AQTB 5HEUA 3UUMA 5LGNB 1MMAA 4EYUA 2DWKA 2WMOA 2KWIB 4ADZA 1BR0A 1E1HB 2QC1B 2Y8DA 3CIRA 2Z6EA 4EGWA 3ZSTA 2K5BB 2CXDA 2NOXA 2X0HA 5LA6E 4GK5E 3AEGA 4L0RA 4X1IE 1OEDA 3GN5A 3RH3A 4EZ1A 5BRXA 1SHZC 2CEAA 2BR7A 3ABVA 3L8RA 3IBPA 1FMWA 2LM2A 2VKHA 5F8PA 5FVKA 1W0AA 3W15B 2X9YA 4QAAA 2OLTA 4Q25A 3RIAA 4IE5A 2X51A 3I9WA 2ZM0A 1UUSA 4HFIA 4X64T 2IAKA 5LGTB 5LJNA 2UXCT 5LG3A 1T72A 1MIWA 4JI5T 1NWMX 5FJVA 2ZM6T 2C5IT 1N33T 2FBWA 2HN2A 2KSRA 3ZT6A 2WNJA 4ZRUA 5ABEA 3KBUA 1FMVA 2V7JA 3OBVE 2V26A 4UXNB 2XZEA 3AE2A 4F8HA 2W63A 3UU5A 2BG9C 3U78A 2MTQA 4AXPA 3ONLC 1H7CA 4ZI7E 4AKGA 2XQ4A 5J0ZA 4HFBA 4TNWA 3EUHA 4ZS3A 2RP4A 4IREA 1EZ3A 2LJLA 4QKNA 4TWDA 2JPFA 4U7IA 4ZI2C 2RA1A 3R84B 3WTJA 3RC8A 2ACZA 2AXDS 4V1Av 5LMNT 3SQ6A 3Q5XA 2CM0A 4DR6T 2LKGA 1KNZA 3WAJA 3ZCIA 4ILAA 4PJNA 2XAFB 2CHOA 3F2EA 5LBMA 2YMEA 3RIFA 3EDVA 1ZHCA 2FJBA 5LB7B 3PJAA 2L8KA 2HH7A 2WBLA 3N9PA 3SS1A 4YHHT 5AQFB 4GYRA 4YY3T 3PUWF 1IBKT 3U3IA 2ZLYA 3K1SA 3JC6C 4TZ4C 5L3GB 2MPKA 2XQ3A 3JADA 4NZBA 3JCFA 3AA1B 2W00A 4JV5T 3FZHB 5M4YA 5J2TE 3E0ZA 2LSGA 4IDNA 4JLEA 4H9SE 3VR8A 4NXMT 2JQ9A 5HEJA 2W66A 2VASA 3N2GE 3ZJ2A 4X66T 3N2OA 3QB5K 4LF6T 4CZZB 3PURA 2BYNA 3T4MA 1SUMB 3JAFA 2ZJVA 1OEDB 3GN5B 1KNRA 4UVCB 1G8XA 2WNLA 5FKYA 2WZHA 4IDPA 2YMDA 2NTXA 4LFCT 4WW0A 2CXLA 3HKBE 4XAXB 1UV6A 4AI6A 4WV9A 4H63H 4P0AA 3RPUA 2XPKA 4HFEA 1WFDA 2XSBA 4ZS2A 2YINA 4O2AE 3IEEA 1ZKEA 1S94A 4KI0F 3ETUA 2BG9E 4PFPA 4DBRA 5KXJA 3VKGA 4IE4A 4X5TA 3KDSE 3LBXA 2PJQA 4B3MT 4QX8B 5DQVA 3N5LA 4ZI2D 4KUMB 4A97A 1WLXA 4EV6A 3NRYA 2NTYA 5AFKA 2CBJA 4PAGA 4IDZA 3KBTA 5FXXA 2MYSA 4HWFA 5H6RB 3TKLB 5DQWA 3U8JA 3T1HT 1M7KA 2XQYA 4HFDA 4I55E 2DNXA 4TV8E 2JQQA 1Y64B 5LHIB 3K8PC 2K48A 1HNXT 4OK0A 3RKGA 4ZK4A 4ASKA 2ES0A 5DJQC 4DR4T 3V5SA 5HWYA 3JC6D 4U3CA 3OVUA 4FJOA 3ZDGA 4U7YA 2WSSV 3HA4A 3ZT5A 3QOFA 5AFMB 2PFVA 1FEWA 4K0UA 4KMCA 4CXWA 4IE0A 2BJ0A 5J5IA 1WYBA 1OEDC 2XYTA 4QHOA 5J1GA 3GMIA 3RLFF 3UULA 2XM1A 5FXZA 3N9OA 4JI6T 2JJ9A 3MK7C 4ILUA 4UF0B 3IGQA 4E7SA 3ZMSB 5E0OA 2D9DA 3T8OA 4ZI3C 1W0BA 3ZKRA 4IDQA 4GKJT 1KK7A 3OJAA 2ZMAA 2BZBA 1WCRA 3J9X1 1KEYA 2EHOB 3P4WA 4UVBB 2WCAA 4ZEYA 3AEEA 2WAUA 1LKXA 4LMJA 5LHHB 3AE4A 3VR9A 4I43B 2D5UA 5GONE 4X1KE 4PJLA 2CXFA 4JI2T 1KF6A 2M6IA 2X68A 4ERRA 2X9HA 3AEFA 3SFEA 3TLUA 3I1AA 4B5DA 3HKEE 5LNKA 4XK9A 1IZNB 4IE7A 4DR2T 5HEOA 3P4RA 3N9NA 3AXJA 5IYZE 4ALXA 3KV6A 2N9DA 3SFDA 1DU2A 3AE6A 3NVOA 4CN4A 5EZYE 3LBXB 2DI4A 3AB3B 5HWXA 4I0UA 5LOVE 5JVDE 4TX5A 2LEHA 4K0KT 2BYQA 5JRCA 2HPLA 3FBZA 4HEAA 2DCFA 3A7MA 1B7TA 2HPJA 4JI4T 3Q5EA 1UCUA 2A3DA 3AECA 3P7IA 1QSDA 5AFUL 3RX6A 4DV4T 4ZI3D 2A72A 3CVRA 1KFYA 4TV9E 4ZZCA 5J5HA 3L3PA 3M3ZB 4X20E 4OX9T 3AAIA 3CKDA 2XNVA 2XY8B 4O4IE 5DABA 1HCIA 1U4QA 4JI0T 2NW8A 4YLHA 2J1DG 3EHZA 2X00A 3EABA 2XNTA 5CA0E 2UXDT 2GK9A 1ZV4X 3VRBA 1V9DA 3UUNA 5AQMB 1YKHB 3QUJA 4A56A 4UEMA 1D1AA 4JI3T 1J5WA 3X1DA 1R8IA 3S4UA 4MFRA 4EAHA 4EZHA 4YTPA 2FJAA 1X9BA 3RYCE 2XAGB 1HG5A 4PK5A 3B57A 4LF5T 2E5LT 3WTHA 2LT3A 5FMNA 3VU7H 4HFHA 5AQQB 2I59A 2WN9A 2H7OA 5HAXA 4LMLA 5AQSB 5A1LA 2BG9B 3PUXF 3UFEA 2V7MA 2CCQA 3LK2B
chains in the Genus database with same CATH topology
5CFBA 2BR7A 2PH9A 3U8NA 3PEOA 2M6BA 3WTKA 4LMKA 4QH4A 4AFGA 2LM2A 4TWHA 4ILAA 3TLVA 3SIOA 4A97A 4ZZCA 3P4WA 3JAEA 2VL0A 5J5HA 2YMEA 3RIFA 5AFKA 4Z91A 4ZJSA 4QAAA 4BQTA 2MAWA 3RIAA 4LMJA 2XNVA 2UZ6A 2X00D 2Y56A 3ZDHA 2XZ6A 3PMZA 3RQUA 3U8JA 2ZJUA 3GUAA 4HFIA 2WZYA 4HFDA 2BYPA 4XHEA 4UM3S 4NPPA 4IL9A 2XQ5A 2XQAA 2LLYA 5J5FA 5AFJA 2W8GA 2M6IA 4TWFA 4FRRA 3WTNA 3UU4A 3EHZA 4HQPA 3WTOA 5L4EA 2LKHA 2XQ3A 3JADA 4QACA 3EAMA 4D01A 4NZBA 5AFHA 2XNUA 4ZR6A 5LG3A 2X00A 2WNCA 4ZK4A 4BFQA 4QH5A 2XQ7A 4ZJTA 3WIPA 5AFLA 3SQ9A 3TLUA 5IUXA 4HFCA 2XNTA 4B5DA 5L4HA 5FJVA 3SH1A 5BW2A 4UXUA 4PIRA 4XK9A 5KE4A 4AFTA 3TLWA 5J5GA 2Y54A 5HEOA 3U8KA 3ZDGA 4ZK1A 5HEJA 2BYRA 2XQ6A 2XYSA 2Y57A 4Z90A 5AFMB 3TLTA 2KSRA 5HCJA 3U8LA 4ALXA 2WNJA 4ZRUA 4AFHA 4A98A 4UY2A 5AFMA 1UX2A 2BYNA 1OEDE 2BJ0A 5KZUA 5L47A 3T4MA 3JAFA 2ZJVA 5J5IA 3UU8A 1OEDC 2PGZA 1OEDB 3C79A 2XYTA 5HEUA 4F8HA 5LXBA 2C9TA 4ZZBA 3UQ4A 1UW6A 5SYOA 5JMEA 3UUBA 2WNLA 5HCMA 3UU5A 3UQ7A 3WTMA 2BG9C 3P50A 3U8MA 3LSVA 2YMDA 4QABA 2Y58A 2YN6A 2BR8A 4QH1A 2BYSA 2XQ9A 5AINA 1UV6A 3WTHA 2QC1B 4UM1A 4ILBA 4WV9A 2XQ4A 4HFBA 4IL4A 3RI5A 4TNWA 3RHWA 5J0ZA 2BYQA 4DBMA 3WTLA 3WTIA 3IGQA 5HEHA 3UU3A 2LKGA 4HFHA 4HFEA 3EI0A 2YKSA 4COFA 4IREA 3RQWA 2WN9A 2W8FA 5BP0A 4UM3P 4TWDA 2BG9E 4LMLA 2XZ5A 2YOEA 3ZKRA 2Y7YA 5AFNA 2XQ8A 5CO5A 1OEDA 3UU6A 3WTJA 2BG9B 5HEGA 3TLSA 3C84A 3SQ6A 4EZ1A 4TNVA 4X5TA 4UM3A 5BRXA 5TVCA 1I9BA 2BG9A 4ILCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFB A;  2BR7 A;  2PH9 A;  3U8N A;  3PEO A;  2M6B A;  3WTK A;  4LMK A;  4QH4 A;  4AFG A;  2LM2 A;  4TWH A;  4ILA A;  3TLV A;  3SIO A;  4A97 A;  4ZZC A;  3P4W A;  3JAE A;  2VL0 A;  5J5H A;  2YME A;  3RIF A;  5AFK A;  4Z91 A;  4ZJS A;  4QAA A;  4BQT A;  2MAW A;  3RIA A;  4LMJ A;  2XNV A;  2UZ6 A;  2X00 D;  2Y56 A;  3ZDH A;  2XZ6 A;  3PMZ A;  3RQU A;  3U8J A;  2ZJU A;  3GUA A;  4HFI A;  2WZY A;  4HFD A;  2BYP A;  4XHE A;  4UM3 S;  4NPP A;  4IL9 A;  2XQ5 A;  2XQA A;  2LLY A;  5J5F A;  5AFJ A;  2W8G A;  2M6I A;  4TWF A;  4FRR A;  3WTN A;  3UU4 A;  3EHZ A;  4HQP A;  3WTO A;  5L4E A;  2LKH A;  2XQ3 A;  3JAD A;  4QAC A;  3EAM A;  4D01 A;  4NZB A;  5AFH A;  2XNU A;  4ZR6 A;  5LG3 A;  2X00 A;  2WNC A;  4ZK4 A;  4BFQ A;  4QH5 A;  2XQ7 A;  4ZJT A;  3WIP A;  5AFL A;  3SQ9 A;  3TLU A;  5IUX A;  4HFC A;  2XNT A;  4B5D A;  5L4H A;  5FJV A;  3SH1 A;  5BW2 A;  4UXU A;  4PIR A;  4XK9 A;  5KE4 A;  4AFT A;  3TLW A;  5J5G A;  2Y54 A;  5HEO A;  3U8K A;  3ZDG A;  4ZK1 A;  5HEJ A;  2BYR A;  2XQ6 A;  2XYS A;  2Y57 A;  4Z90 A;  5AFM B;  3TLT A;  2KSR A;  5HCJ A;  3U8L A;  4ALX A;  2WNJ A;  4ZRU A;  4AFH A;  4A98 A;  4UY2 A;  5AFM A;  1UX2 A;  2BYN A;  1OED E;  2BJ0 A;  5KZU A;  5L47 A;  3T4M A;  3JAF A;  2ZJV A;  5J5I A;  3UU8 A;  1OED C;  2PGZ A;  1OED B;  3C79 A;  2XYT A;  5HEU A;  4F8H A;  5LXB A;  2C9T A;  4ZZB A;  3UQ4 A;  1UW6 A;  5SYO A;  5JME A;  3UUB A;  2WNL A;  5HCM A;  3UU5 A;  3UQ7 A;  3WTM A;  2BG9 C;  3P50 A;  3U8M A;  3LSV A;  2YMD A;  4QAB A;  2Y58 A;  2YN6 A;  2BR8 A;  4QH1 A;  2BYS A;  2XQ9 A;  5AIN A;  1UV6 A;  3WTH A;  2QC1 B;  4UM1 A;  4ILB A;  4WV9 A;  2XQ4 A;  4HFB A;  4IL4 A;  3RI5 A;  4TNW A;  3RHW A;  5J0Z A;  2BYQ A;  4DBM A;  3WTL A;  3WTI A;  3IGQ A;  5HEH A;  3UU3 A;  2LKG A;  4HFH A;  4HFE A;  3EI0 A;  2YKS A;  4COF A;  4IRE A;  3RQW A;  2WN9 A;  2W8F A;  5BP0 A;  4UM3 P;  4TWD A;  2BG9 E;  4LML A;  2XZ5 A;  2YOE A;  3ZKR A;  2Y7Y A;  5AFN A;  2XQ8 A;  5CO5 A;  1OED A;  3UU6 A;  3WTJ A;  2BG9 B;  5HEG A;  3TLS A;  3C84 A;  3SQ6 A;  4EZ1 A;  4TNV A;  4X5T A;  4UM3 A;  5BRX A;  5TVC A;  1I9B A;  2BG9 A;  4ILC A; 
#chains in the Genus database with same CATH topology
 2LSK A;  2E5V A;  3OTO T;  4NUV A;  4KHP T;  4YHJ A;  3JAE A;  4M1P A;  3P8C D;  2VB6 A;  3CX7 B;  1J5E T;  3GA8 A;  2BVL A;  1XMQ T;  2EHO D;  3D0T A;  4O4L E;  3C4W A;  1Z0P A;  3KV9 A;  2LLY A;  1D0Z A;  2X0Y A;  4HTE A;  5FNV E;  3UU4 A;  4BAY B;  4BFQ A;  4JEU B;  3WIP A;  5C2T A;  4ISS A;  3AED A;  2VQE T;  2WY2 A;  5JRC B;  2V7L A;  2WWV A;  4JYA T;  3TLT A;  2Y6X A;  4A98 A;  3ZEF B;  3PUV F;  4U2Y A;  1M62 A;  3PUQ A;  3C98 B;  2NP9 A;  2V1D B;  1D1C A;  2YU1 A;  3PJA J;  5FL1 A;  4YSX A;  2V8S V;  2ZM2 A;  1L0V A;  2HN1 A;  5HYA A;  2OV9 A;  4N78 D;  3RYI E;  3RKO A;  4HWD A;  3PUS A;  4ILB A;  4IT4 A;  5AQR B;  4AKL A;  4NXN T;  4JEH B;  1YW0 A;  2JIW A;  4DV6 T;  2YKS A;  4H9P C;  3RQW A;  5FXW A;  3KV5 A;  3AA6 B;  4JBW F;  2C0S A;  1UK5 A;  4LF9 T;  5CO5 A;  2X9X A;  2QRX A;  5AQL B;  5HEG A;  1Z8U A;  2VQF T;  4QXH B;  4HGA A;  3AE7 A;  4DO0 A;  4F6R C;  2LSY A;  2MBG A;  5JR9 A;  2PH9 A;  1S35 A;  2LOS A;  2VL8 A;  1IJ5 A;  4ZHQ E;  1E2A A;  2C5J A;  2BBH A;  5AQH B;  2H7V C;  2CRB A;  3MZK B;  2X66 A;  5KX5 E;  3CX6 B;  1XDO A;  3P4S A;  2N1G A;  1ZP0 A;  5AQP B;  2A2F X;  2WNC A;  4L9I A;  5LHG B;  2WM9 A;  3MXZ A;  4DV0 T;  4UXU A;  3WAK A;  2LRL A;  4HWH A;  1YXR A;  3PUG A;  4DID B;  3L39 A;  5HCJ A;  3QB5 A;  3V5U A;  4OYJ A;  3UFG A;  5LGU B;  1E7P A;  2BVM A;  5KZU A;  4B3R T;  5SYO A;  5FXV A;  2YDR A;  4QX7 B;  4DV7 T;  5HCM A;  1WYC A;  5JRE A;  3ESL A;  2YN6 A;  2BR8 A;  3ETV A;  4LF7 T;  1KNP A;  3HL6 A;  4U72 A;  2NW9 A;  4NUU A;  1NEN A;  3ZCJ A;  5C8Y E;  3UTK A;  5JDF A;  4EOZ B;  3ZPO A;  2XSA A;  5ETW A;  2V5C A;  4PFO A;  4PK6 A;  5AFN A;  4WYV A;  2MOZ A;  3UUX B;  3C84 A;  4G63 A;  5F3J A;  4ILC A;  1NEK A;  1SA0 E;  1MMN A;  1NAF A;  2LOP A;  4TWH A;  3H3A A;  2HHH T;  3PUA A;  2V7K A;  4UV9 B;  4AKR B;  4QWN B;  3ONX A;  3KVB A;  3I0O A;  1XNQ T;  1WRD A;  4ANJ A;  2XAH B;  1HS7 A;  3K3N A;  4GYS A;  5AQG B;  4XZC A;  4GKK T;  5ABF A;  1W09 A;  3RF1 A;  4I4T E;  4QH5 A;  2H3R A;  3PUY F;  2XQ7 A;  4ZJT A;  5AFL A;  4HFC A;  4QXB B;  2XHE B;  5J2U E;  3RC3 A;  4WNK A;  5LXT E;  3AVR A;  2KIN B;  3OYZ A;  1MMD A;  4DR7 T;  1HTJ F;  5H6Q B;  5L3D B;  3BQL A;  3FZF B;  4H9Q C;  3UU8 A;  2WB5 A;  4H63 V;  2IC9 A;  2I0M A;  3ZJ1 A;  2B76 A;  2LSJ A;  5HXH A;  3MAC A;  4LFB T;  1ZOY A;  5HEH A;  3EI0 A;  2M67 A;  1G73 A;  4CN6 A;  3P4Q A;  4GOU A;  3O1J A;  2YOE A;  2Y7Y A;  4AQY T;  2BKN A;  1HG2 A;  4CXY A;  1I9B A;  3HR0 A;  3EVY A;  3ANW A;  2BS2 A;  1HX8 A;  3U8N A;  3PEO A;  3CPZ A;  4B3S T;  1YKE B;  2VL0 A;  2UXX B;  1VCT A;  4AQG A;  1QLB A;  2IDO B;  4DR5 T;  2WQY A;  2Q9Q A;  1D1B A;  3CX8 B;  2X00 D;  2E9X A;  3E22 E;  2IIU A;  3MKD A;  3GUA A;  2WZY A;  3HI2 A;  1ZEE A;  4NPP A;  3UT5 E;  3FHN A;  2XQA A;  1HFA A;  3E08 A;  3A8Y C;  3WTN A;  5LP6 E;  2JMK A;  3ZT7 A;  3WTO A;  3PDY A;  2WDV A;  5FP3 A;  3ZMU B;  1CUN A;  3H37 A;  3IHR A;  5IUX A;  5ADX L;  5JDQ A;  2KMF A;  4PW8 A;  2RPA A;  2XUE A;  2BS3 A;  1HNW T;  2LSI A;  3U8L A;  4QXC B;  4X62 T;  3G06 A;  3N9L A;  3C79 A;  2K9A A;  4ZZB A;  3MA9 A;  3CK6 A;  4DV3 T;  5JR9 C;  3UQ7 A;  3P50 A;  3U8M A;  5ABH A;  4QAB A;  1WR6 A;  2H89 A;  2JMH A;  4IL4 A;  5LCY A;  3RI5 A;  4L5G A;  3WTL A;  1WR0 A;  2ODU A;  2UUB T;  4CI1 B;  1IBM T;  5LBQ B;  2VUR A;  3BQK A;  5BP0 A;  3A5X A;  3PTR B;  4P0B A;  4UV8 B;  5FY7 A;  2VWA A;  4GK0 E;  2YU2 A;  4H9O C;  4UM3 A;  2N2N A;  5ABF B;  2J62 A;  4QH4 A;  3SRZ A;  3TLV A;  3L09 A;  3Q5D A;  3N9Q A;  3J7Y q;  5FY0 A;  2OA5 A;  2ZM8 A;  2VKD A;  3O1H A;  5IWA T;  3RQU A;  4YJ3 E;  3AAE B;  1YD8 G;  3FXD B;  2SPC A;  1N32 T;  4PJM A;  1BR4 A;  1N36 T;  3IA3 A;  2XNU A;  1VOM A;  2UXN B;  5HXR A;  2QA7 A;  5L4H A;  3SH1 A;  2IUB A;  3VHL A;  1T7S A;  4ZOL E;  4IDO A;  5FL0 A;  4KHZ F;  5KDM C;  3H3M A;  2X9W A;  2KZ7 B;  5CA1 E;  1UW6 A;  5AQU B;  5FVL A;  3BK9 A;  5BR8 T;  3ANW B;  3NZQ A;  5L3F B;  2I6H A;  2JQH A;  3QNU A;  4JI8 T;  1IBL T;  3ZMT B;  3ZMZ B;  4EYY R;  4YSZ A;  1I6Z A;  3RGL A;  4DBM A;  4CXX A;  5EK2 A;  2Q9Q B;  4EZ4 A;  4UM3 P;  3C51 A;  2XQ8 A;  2DHR A;  5AQK B;  3KIN B;  4UVA B;  3LFM A;  3MJX A;  2KXP B;  1UX4 A;  5TAO A;  1MMG A;  4WZX A;  3BQI A;  2AE9 A;  1GQE A;  3AE5 A;  4XBF B;  1U5P A;  1MNE A;  2L3L A;  4BQT A;  3AE1 A;  4IST A;  5ABG A;  2UZ6 A;  3ZDH A;  3RIU A;  2CA5 A;  3SOL A;  4GIW A;  2NR4 A;  5J5F A;  1Y01 A;  3QC9 A;  3DTO A;  4EIW A;  4HQP A;  3EAM A;  4X65 T;  1HX1 B;  3FZK B;  4YXD A;  5KE4 A;  5J5G A;  3AXJ B;  4ZK1 A;  4IE6 A;  2IC6 A;  1AJ3 A;  2E8I A;  2PTF A;  4UY2 A;  4KP3 C;  3B5M A;  2K3W A;  3PU3 A;  1QUU A;  3NWI A;  3UUB A;  2FJD A;  3WTM A;  4KX6 A;  1YQ3 A;  4PK4 A;  1XDP A;  3C4Z A;  1HF8 A;  4QH1 A;  3M65 A;  2W67 A;  3O9X A;  1I94 T;  2L9Q A;  5L3C B;  3LDQ B;  2BKO A;  2WDQ A;  3NRX A;  5EK4 A;  3KV4 A;  2J47 A;  2Q9Q C;  4CI3 B;  4OYK A;  3PV0 F;  3ZYK A;  2W8F A;  2E9X C;  2CWY A;  4A5X A;  4TUY E;  2W2U A;  3K3Q C;  2WU5 A;  4U74 A;  4H9N C;  2XAS B;  3WTK A;  4LMK A;  4BA9 A;  4U33 A;  3ZYM A;  4O4H E;  1LVF A;  4WBN E;  5KMG P;  1XMO T;  2V7I A;  5JDM A;  2BYP A;  4UM3 S;  2J4G A;  3AA0 B;  1XWM A;  4HWI B;  5CB4 E;  5JQG E;  1BR2 A;  4U2Z A;  1YQ4 A;  1FIO A;  3AEB A;  4AFT A;  3NBX X;  4BJM A;  2XJ7 A;  3ZC0 A;  4YT0 A;  2QVA A;  2Y57 A;  2XYS A;  1US7 B;  4Z90 A;  2W61 A;  1LRZ A;  2QGS A;  3PU8 A;  5AFM A;  3VKH A;  1UX2 A;  4UEL A;  1IAP A;  3LJC A;  3F31 A;  2XAJ B;  3WI3 A;  3EDU A;  1UUR A;  4P09 A;  5LJM A;  3AA7 B;  3PUZ F;  3LSV A;  3HKC E;  2XAQ B;  4IIJ E;  1VRB A;  2NWB A;  5L3B B;  4UM1 A;  1HNZ T;  2ODV A;  4YJ2 E;  5L3E B;  3WTI A;  3P4P A;  2NW7 A;  3UU3 A;  4ZXL A;  2VKJ A;  4UF0 A;  4HN9 A;  2WU2 A;  4DUZ T;  5AQN B;  3FB2 A;  4MAL A;  3RRC A;  2FJE A;  2CPT A;  4HFV A;  2XZ5 A;  3Q2M A;  1BR1 A;  3TLS A;  2DLR A;  5JDG A;  5TVC A;  2WP9 A;  4AKI A;  4PNI A;  2Q9Q D;  5CFB A;  2IML A;  2E9X D;  3AVS A;  2WZI A;  4YSY A;  1OXZ A;  2JQK A;  5F5W A;  2DL1 A;  2EHO A;  5FYM A;  3OPC A;  5JDH A;  5HXC A;  4Z8X A;  2MAW A;  4LFA T;  3O4X E;  4O8S A;  5IHY A;  4AQF A;  5AQO B;  5AFJ A;  3IF8 B;  2LKH A;  4QAC A;  2X0L B;  4ZR6 A;  1CHU A;  3RRW A;  1LVK A;  3KFW X;  3AEA A;  4OHF A;  3CWZ B;  2V6X A;  2ACX A;  3ONJ A;  2BDE A;  5JDL A;  1VCS A;  4JUY A;  2UU9 T;  3U8K A;  4EED A;  4LF4 T;  4YTN A;  1JNZ A;  3ZN0 B;  2V5D A;  2VVS A;  2K24 A;  2BBJ A;  5AQI B;  2D0U A;  4DR1 T;  4AIS A;  5LXB A;  4B3T T;  4C91 A;  4HE8 A;  1OWA A;  2BYS A;  3PE0 A;  3I9Y A;  5AIN A;  4DV1 T;  3LK3 B;  3RHW A;  3C4X A;  2FUP A;  1UX5 A;  2WWU A;  2P9B A;  1T98 A;  4EXT A;  4MBQ A;  3RIU C;  4CI2 B;  3UU6 A;  5JR9 B;  2LRK A;  2WMN A;  1O3X A;  1D0Y A;  3B13 A;  5JTG A;  5LYJ E;  3AAA B;  2CWO A;  1J1J A;  4AKH A;  4HWC A;  4CN1 A;  3CQC B;  3SIO A;  3OKQ A;  3ZC1 A;  3SWH A;  3CML A;  4OFZ A;  4DV2 T;  2C5K T;  4H9R C;  3FBL A;  4P1N A;  4DBQ A;  3O1I A;  3PMZ A;  3ZYL A;  2KND A;  3DP7 A;  2ZJU A;  2WDR A;  1HR0 T;  2LE8 A;  4DND A;  4JI7 T;  2W8G A;  4FRR A;  4C90 A;  4D01 A;  4PJJ A;  5L4E A;  5AFH A;  3NKZ A;  4NIQ A;  2VK9 A;  3AE8 A;  4EEB A;  5LMU T;  2CHN A;  3LG7 A;  2UUA T;  1T8B A;  2BYR A;  3ZSS A;  4DMV A;  4AFH A;  1SE7 A;  2V6Y A;  4WBO A;  4DV5 T;  4IHJ E;  4JI1 T;  5L47 A;  4YTM A;  2YK0 A;  4IGU A;  3I0Q A;  2C9T A;  3UQ4 A;  5JME A;  3R6N A;  5FY1 A;  3AE3 A;  4DR3 T;  2JRK A;  2Y58 A;  3DJB A;  2XQ9 A;  2CMR A;  4O4J E;  2XM2 A;  2CLY B;  4COF A;  3GWH A;  2W62 A;  5CJ5 A;  2R6G F;  3C50 A;  2H88 A;  2BS4 A;  2BG9 A;  3N9M A;  3FXE B;  1MIY A;  4MLK A;  4J2C A;  1JNR A;  4I50 E;  4DMW A;  4O2B E;  2UUC T;  4LF8 T;  4BJN A;  3CQX C;  2UXB T;  2Y56 A;  3ZN1 B;  2XZ6 A;  2X67 A;  5C3J A;  3T1Y T;  3F57 A;  3N2K E;  3Q9D A;  4XHE A;  2XQ5 A;  5CGM A;  2F4V T;  3KVA A;  4CQI A;  3Q5W A;  5HXE A;  3FZL B;  2KT9 A;  2XTL A;  5AQJ B;  3LK4 2;  4X1Y E;  3SQ9 A;  1FJG T;  1X79 A;  5AQV B;  4EB6 E;  4PIR A;  2W0G A;  3TLW A;  1XNR T;  2LM9 A;  2PG8 A;  2IHR 1;  2QYW A;  3QK6 A;  2DWG A;  1OED E;  3AE9 A;  2PGZ A;  2IW5 B;  1XZY A;  5JDN A;  2A9U A;  5JH7 E;  3RYH E;  2VVN A;  4UR9 A;  2EHO C;  5EK3 A;  1W9R A;  4YFS A;  2CLY C;  3ZMV B;  2B1E A;  4TN7 B;  4AQF C;  4B6X A;  3K3O A;  2G0U A;  4HKA A;  5BMV E;  4TNV A;  1N34 T;  3HKD E;  3FZM B;  2M6B A;  5LG4 A;  3OYX A;  4AFG A;  2CE7 A;  3CQG B;  4DVD A;  2KWH A;  4Z91 A;  4ZJS A;  2KLQ A;  2E9X B;  2BKP A;  2VKO A;  1D0X A;  3NZP A;  2LHR A;  4U31 A;  3ZLI A;  2V6Y B;  3RYF E;  4IL9 A;  4TWF A;  2Y48 B;  2D0T A;  2YEV C;  3C64 A;  2W4X A;  2E2A A;  2CBI A;  4MHC A;  5L2L A;  3VRA A;  4DUY T;  1MND A;  5BW2 A;  4E7Z A;  2YDS A;  2Y54 A;  1UGO A;  1MIV A;  2PBI A;  2YDQ A;  4G2A A;  4FI5 A;  2XQ6 A;  2LHN A;  4UIG A;  2D2S A;  4AIU A;  1IJ6 A;  4KBM B;  5HXS A;  2WS3 A;  5AQT B;  5HEU A;  3UUM A;  5LGN B;  1MMA A;  4EYU A;  2DWK A;  2WMO A;  2KWI B;  4ADZ A;  1BR0 A;  1E1H B;  2QC1 B;  2Y8D A;  3CIR A;  2Z6E A;  4EGW A;  3ZST A;  2K5B B;  2CXD A;  2NOX A;  2X0H A;  5LA6 E;  4GK5 E;  3AEG A;  4L0R A;  4X1I E;  1OED A;  3GN5 A;  3RH3 A;  4EZ1 A;  5BRX A;  1SHZ C;  2CEA A;  2BR7 A;  3ABV A;  3L8R A;  3IBP A;  1FMW A;  2LM2 A;  2VKH A;  5F8P A;  5FVK A;  1W0A A;  3W15 B;  2X9Y A;  4QAA A;  2OLT A;  4Q25 A;  3RIA A;  4IE5 A;  2X51 A;  3I9W A;  2ZM0 A;  1UUS A;  4HFI A;  4X64 T;  2IAK A;  5LGT B;  5LJN A;  2UXC T;  5LG3 A;  1T72 A;  1MIW A;  4JI5 T;  1NWM X;  5FJV A;  2ZM6 T;  2C5I T;  1N33 T;  2FBW A;  2HN2 A;  2KSR A;  3ZT6 A;  2WNJ A;  4ZRU A;  5ABE A;  3KBU A;  1FMV A;  2V7J A;  3OBV E;  2V26 A;  4UXN B;  2XZE A;  3AE2 A;  4F8H A;  2W63 A;  3UU5 A;  2BG9 C;  3U78 A;  2MTQ A;  4AXP A;  3ONL C;  1H7C A;  4ZI7 E;  4AKG A;  2XQ4 A;  5J0Z A;  4HFB A;  4TNW A;  3EUH A;  4ZS3 A;  2RP4 A;  4IRE A;  1EZ3 A;  2LJL A;  4QKN A;  4TWD A;  2JPF A;  4U7I A;  4ZI2 C;  2RA1 A;  3R84 B;  3WTJ A;  3RC8 A;  2ACZ A;  2AXD S;  4V1A v;  5LMN T;  3SQ6 A;  3Q5X A;  2CM0 A;  4DR6 T;  2LKG A;  1KNZ A;  3WAJ A;  3ZCI A;  4ILA A;  4PJN A;  2XAF B;  2CHO A;  3F2E A;  5LBM A;  2YME A;  3RIF A;  3EDV A;  1ZHC A;  2FJB A;  5LB7 B;  3PJA A;  2L8K A;  2HH7 A;  2WBL A;  3N9P A;  3SS1 A;  4YHH T;  5AQF B;  4GYR A;  4YY3 T;  3PUW F;  1IBK T;  3U3I A;  2ZLY A;  3K1S A;  3JC6 C;  4TZ4 C;  5L3G B;  2MPK A;  2XQ3 A;  3JAD A;  4NZB A;  3JCF A;  3AA1 B;  2W00 A;  4JV5 T;  3FZH B;  5M4Y A;  5J2T E;  3E0Z A;  2LSG A;  4IDN A;  4JLE A;  4H9S E;  3VR8 A;  4NXM T;  2JQ9 A;  5HEJ A;  2W66 A;  2VAS A;  3N2G E;  3ZJ2 A;  4X66 T;  3N2O A;  3QB5 K;  4LF6 T;  4CZZ B;  3PUR A;  2BYN A;  3T4M A;  1SUM B;  3JAF A;  2ZJV A;  1OED B;  3GN5 B;  1KNR A;  4UVC B;  1G8X A;  2WNL A;  5FKY A;  2WZH A;  4IDP A;  2YMD A;  2NTX A;  4LFC T;  4WW0 A;  2CXL A;  3HKB E;  4XAX B;  1UV6 A;  4AI6 A;  4WV9 A;  4H63 H;  4P0A A;  3RPU A;  2XPK A;  4HFE A;  1WFD A;  2XSB A;  4ZS2 A;  2YIN A;  4O2A E;  3IEE A;  1ZKE A;  1S94 A;  4KI0 F;  3ETU A;  2BG9 E;  4PFP A;  4DBR A;  5KXJ A;  3VKG A;  4IE4 A;  4X5T A;  3KDS E;  3LBX A;  2PJQ A;  4B3M T;  4QX8 B;  5DQV A;  3N5L A;  4ZI2 D;  4KUM B;  4A97 A;  1WLX A;  4EV6 A;  3NRY A;  2NTY A;  5AFK A;  2CBJ A;  4PAG A;  4IDZ A;  3KBT A;  5FXX A;  2MYS A;  4HWF A;  5H6R B;  3TKL B;  5DQW A;  3U8J A;  3T1H T;  1M7K A;  2XQY A;  4HFD A;  4I55 E;  2DNX A;  4TV8 E;  2JQQ A;  1Y64 B;  5LHI B;  3K8P C;  2K48 A;  1HNX T;  4OK0 A;  3RKG A;  4ZK4 A;  4ASK A;  2ES0 A;  5DJQ C;  4DR4 T;  3V5S A;  5HWY A;  3JC6 D;  4U3C A;  3OVU A;  4FJO A;  3ZDG A;  4U7Y A;  2WSS V;  3HA4 A;  3ZT5 A;  3QOF A;  5AFM B;  2PFV A;  1FEW A;  4K0U A;  4KMC A;  4CXW A;  4IE0 A;  2BJ0 A;  5J5I A;  1WYB A;  1OED C;  2XYT A;  4QHO A;  5J1G A;  3GMI A;  3RLF F;  3UUL A;  2XM1 A;  5FXZ A;  3N9O A;  4JI6 T;  2JJ9 A;  3MK7 C;  4ILU A;  4UF0 B;  3IGQ A;  4E7S A;  3ZMS B;  5E0O A;  2D9D A;  3T8O A;  4ZI3 C;  1W0B A;  3ZKR A;  4IDQ A;  4GKJ T;  1KK7 A;  3OJA A;  2ZMA A;  2BZB A;  1WCR A;  3J9X 1;  1KEY A;  2EHO B;  3P4W A;  4UVB B;  2WCA A;  4ZEY A;  3AEE A;  2WAU A;  1LKX A;  4LMJ A;  5LHH B;  3AE4 A;  3VR9 A;  4I43 B;  2D5U A;  5GON E;  4X1K E;  4PJL A;  2CXF A;  4JI2 T;  1KF6 A;  2M6I A;  2X68 A;  4ERR A;  2X9H A;  3AEF A;  3SFE A;  3TLU A;  3I1A A;  4B5D A;  3HKE E;  5LNK A;  4XK9 A;  1IZN B;  4IE7 A;  4DR2 T;  5HEO A;  3P4R A;  3N9N A;  3AXJ A;  5IYZ E;  4ALX A;  3KV6 A;  2N9D A;  3SFD A;  1DU2 A;  3AE6 A;  3NVO A;  4CN4 A;  5EZY E;  3LBX B;  2DI4 A;  3AB3 B;  5HWX A;  4I0U A;  5LOV E;  5JVD E;  4TX5 A;  2LEH A;  4K0K T;  2BYQ A;  5JRC A;  2HPL A;  3FBZ A;  4HEA A;  2DCF A;  3A7M A;  1B7T A;  2HPJ A;  4JI4 T;  3Q5E A;  1UCU A;  2A3D A;  3AEC A;  3P7I A;  1QSD A;  5AFU L;  3RX6 A;  4DV4 T;  4ZI3 D;  2A72 A;  3CVR A;  1KFY A;  4TV9 E;  4ZZC A;  5J5H A;  3L3P A;  3M3Z B;  4X20 E;  4OX9 T;  3AAI A;  3CKD A;  2XNV A;  2XY8 B;  4O4I E;  5DAB A;  1HCI A;  1U4Q A;  4JI0 T;  2NW8 A;  4YLH A;  2J1D G;  3EHZ A;  2X00 A;  3EAB A;  2XNT A;  5CA0 E;  2UXD T;  2GK9 A;  1ZV4 X;  3VRB A;  1V9D A;  3UUN A;  5AQM B;  1YKH B;  3QUJ A;  4A56 A;  4UEM A;  1D1A A;  4JI3 T;  1J5W A;  3X1D A;  1R8I A;  3S4U A;  4MFR A;  4EAH A;  4EZH A;  4YTP A;  2FJA A;  1X9B A;  3RYC E;  2XAG B;  1HG5 A;  4PK5 A;  3B57 A;  4LF5 T;  2E5L T;  3WTH A;  2LT3 A;  5FMN A;  3VU7 H;  4HFH A;  5AQQ B;  2I59 A;  2WN9 A;  2H7O A;  5HAX A;  4LML A;  5AQS B;  5A1L A;  2BG9 B;  3PUX F;  3UFE A;  2V7M A;  2CCQ A;  3LK2 B; 
#chains in the Genus database with same CATH homology
 5CFB A;  2BR7 A;  2PH9 A;  3U8N A;  3PEO A;  2M6B A;  3WTK A;  4LMK A;  4QH4 A;  4AFG A;  2LM2 A;  4TWH A;  4ILA A;  3TLV A;  3SIO A;  4A97 A;  4ZZC A;  3P4W A;  3JAE A;  2VL0 A;  5J5H A;  2YME A;  3RIF A;  5AFK A;  4Z91 A;  4ZJS A;  4QAA A;  4BQT A;  2MAW A;  3RIA A;  4LMJ A;  2XNV A;  2UZ6 A;  2X00 D;  2Y56 A;  3ZDH A;  2XZ6 A;  3PMZ A;  3RQU A;  3U8J A;  2ZJU A;  3GUA A;  4HFI A;  2WZY A;  4HFD A;  2BYP A;  4XHE A;  4UM3 S;  4NPP A;  4IL9 A;  2XQ5 A;  2XQA A;  2LLY A;  5J5F A;  5AFJ A;  2W8G A;  2M6I A;  4TWF A;  4FRR A;  3WTN A;  3UU4 A;  3EHZ A;  4HQP A;  3WTO A;  5L4E A;  2LKH A;  2XQ3 A;  3JAD A;  4QAC A;  3EAM A;  4D01 A;  4NZB A;  5AFH A;  2XNU A;  4ZR6 A;  5LG3 A;  2X00 A;  2WNC A;  4ZK4 A;  4BFQ A;  4QH5 A;  2XQ7 A;  4ZJT A;  3WIP A;  5AFL A;  3SQ9 A;  3TLU A;  5IUX A;  4HFC A;  2XNT A;  4B5D A;  5L4H A;  5FJV A;  3SH1 A;  5BW2 A;  4UXU A;  4PIR A;  4XK9 A;  5KE4 A;  4AFT A;  3TLW A;  5J5G A;  2Y54 A;  5HEO A;  3U8K A;  3ZDG A;  4ZK1 A;  5HEJ A;  2BYR A;  2XQ6 A;  2XYS A;  2Y57 A;  4Z90 A;  5AFM B;  3TLT A;  2KSR A;  5HCJ A;  3U8L A;  4ALX A;  2WNJ A;  4ZRU A;  4AFH A;  4A98 A;  4UY2 A;  5AFM A;  1UX2 A;  2BYN A;  1OED E;  2BJ0 A;  5KZU A;  5L47 A;  3T4M A;  3JAF A;  2ZJV A;  5J5I A;  3UU8 A;  1OED C;  2PGZ A;  1OED B;  3C79 A;  2XYT A;  5HEU A;  4F8H A;  5LXB A;  2C9T A;  4ZZB A;  3UQ4 A;  1UW6 A;  5SYO A;  5JME A;  3UUB A;  2WNL A;  5HCM A;  3UU5 A;  3UQ7 A;  3WTM A;  2BG9 C;  3P50 A;  3U8M A;  3LSV A;  2YMD A;  4QAB A;  2Y58 A;  2YN6 A;  2BR8 A;  4QH1 A;  2BYS A;  2XQ9 A;  5AIN A;  1UV6 A;  3WTH A;  2QC1 B;  4UM1 A;  4ILB A;  4WV9 A;  2XQ4 A;  4HFB A;  4IL4 A;  3RI5 A;  4TNW A;  3RHW A;  5J0Z A;  2BYQ A;  4DBM A;  3WTL A;  3WTI A;  3IGQ A;  5HEH A;  3UU3 A;  2LKG A;  4HFH A;  4HFE A;  3EI0 A;  2YKS A;  4COF A;  4IRE A;  3RQW A;  2WN9 A;  2W8F A;  5BP0 A;  4UM3 P;  4TWD A;  2BG9 E;  4LML A;  2XZ5 A;  2YOE A;  3ZKR A;  2Y7Y A;  5AFN A;  2XQ8 A;  5CO5 A;  1OED A;  3UU6 A;  3WTJ A;  2BG9 B;  5HEG A;  3TLS A;  3C84 A;  3SQ6 A;  4EZ1 A;  4TNV A;  4X5T A;  4UM3 A;  5BRX A;  5TVC A;  1I9B A;  2BG9 A;  4ILC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...