5HCJA

Cationic ligand-gated ion channel
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
molecule tags Transport protein
source organism Gloeobacter violaceus
publication title Sites of Anesthetic Inhibitory Action on a Cationic Ligand-Gated Ion Channel.
pubmed doi rcsb
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hcjA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hcjA01
5FJVA 2Y58A 4NZBA 4HFBA 2XNUA 2VL0A 2BG9A 5HCJA 2X00A 2YKSA 2XQ5A 4F8HA 4ZK4A 1I9BA 4IL4A 3U8KA 5BP0A 1UW6A 2WNCA 3SIOA 2X00D 2Y56A 2BG9B 3TLTA 2YMEA 4A98A 2W8GA 4ZZBA 3EAMA 3IGQA 5SYOA 3EI0A 2WNJA 3UQ4A 4ALXA 3TLWA 5J5HA 4HFIA 5HEGA 4ILBA 2YOEA 5HEUA 5IUXA 4QAAA 5CO5A 3ZDHA 4HFHA 5KE4A 4B5DA 3U8NA 3UU3A 2UZ6A 2PGZA 3WTOA 3TLSA 5BW2A 3UUBA 4COFA 3RQUA 3U8MA 4IREA 4TWDA 5AFMB 2BYSA 4QACA 2WZYA 5AINA 1UV6A 5J5IA 4BQTA 4TWFA 3JADA 3JAFA 4D01A 2BYQA 4LMKA 3C84A 4BFQA 3RIFA 5JMEA 4AFHA 3UU6A 2XNVA 2WNLA 2BJ0A 4LMJA 3TLUA 4ZZCA 5TVCA 2XQ4A 4HFDA 1OEDE 4TWHA 4LMLA 4HQPA 5AFJA 4XK9A 2M6BA 3P50A 2M6IA 2LM2A 3EHZA 3RQWA 2XNTA 3LSVA 3RI5A 2LLYA 4IL9A 3TLVA 3C79A 3UQ7A 4Z91A 4HFEA 2KSRA 2W8FA 4UY2A 2BG9C 3P4WA 4UM3P 4TNWA 3UU5A 4X5TA 2Y54A 4PIRA 5L4HA 2YMDA 5CFBA 2XQ6A 2Y7YA 2C9TA 5AFKA 4XHEA 5AFMA 3WTHA 2BG9E 5LG3A 3UU4A 4Z90A 4A97A 2QC1B 2BR7A 4ZJSA 2ZJVA 3WTIA 3PMZA 4ILCA 3U8LA 3RIAA 2ZJUA 5J0ZA 4UM1A 1UX2A 2BYNA 2XQ7A 5L47A 2XQ8A 3WTJA 4ZRUA 2XZ6A 2Y57A 4QH5A 5L4EA 5AFLA 2PH9A 3ZDGA 3WTLA 4QH4A 3RHWA 5LXBA 1OEDC 2XYTA 3U8JA 3GUAA 5HEHA 2LKGA 3WTKA 5J5FA 4EZ1A 4AFTA 5BRXA 3SQ9A 4TNVA 4AFGA 5AFHA 2XZ5A 5J5GA 2BYPA 4NPPA 2WN9A 3PEOA 4QABA 5AFNA 4UXUA 2BYRA 4WV9A 4ZR6A 2YN6A 3SH1A 3T4MA 2BR8A 3ZKRA 3JAEA 4ZK1A 5HCMA 3WTNA 2XYSA 2XQ3A 5KZUA 5HEOA 1OEDB 4QH1A 3UU8A 3SQ6A 4ZJTA 3WIPA 4HFCA 2XQ9A 4UM3S 4FRRA 4ILAA 4DBMA 4UM3A 2LKHA 2MAWA 2XQAA 3WTMA 1OEDA 5HEJA
chains in the Genus database with same CATH superfamily
4YT0A 4PFOA 2C0SA 4DBQA 3ETVA 3AA0B 2UXDT 1MMAA 1D1BA 5C8YE 2KWIB 4LF7T 4F8HA 4CQIA 2CWYA 5SYOA 4ALXA 4LF9T 1XMOT 3LDQB 3ETUA 2LRLA 3UU3A 4X64T 4U31A 2B76A 2VB6A 3K1SA 4QACA 4G2AA 2WY2A 3P4QA 1N36T 2LM9A 3AXJB 2CBJA 4DR4T 1HNXT 3AECA 4KHZF 3L09A 4TWHA 4XK9A 1FEWA 5CA0E 3PUZF 3AA1B 3VR8A 5AQUB 2ZM8A 4X5TA 3Q5WA 3FZFB 2YMDA 4JYAT 2V7KA 3RH3A 3S4UA 2I0MA 1UX4A 5AQJB 5J2UE 2LE8A 1MMDA 2M67A 5L47A 2RPAA 5JDNA 5FYMA 1YXRA 3RHWA 4YTPA 5JREA 5LA6E 4IE0A 4UV9B 1M7KA 1XDOA 2IUBA 2WMNA 5LMNT 4HGAA 3CPZA 4UXUA 2WMOA 2XM2A 3ZKRA 3SS1A 1OEDB 2E8IA 4ZJTA 2CXLA 4O4IE 3CQXC 4OYKA 4ILAA 2LKHA 5JQGE 4DV1T 3ZYKA 4DR1T 5ABFB 2WNCA 3LK2B 1UURA 1UUSA 2YMEA 3FBLA 2KMFA 1XNQT 4ILUA 5JR9C 5IUXA 2XQYA 4DMVA 2QGSA 4DUZT 4B3TT 4YFSA 3U8MA 4X65T 3KVAA 2WZYA 3ZEFB 4FJOA 4X66T 2LT3A 3C84A 5JR9A 2W4XA 4DV3T 4IHJE 4AIUA 5TVCA 1OEDE 2M6BA 5FMNA 4HE8A 4UR9A 3UT5E 2LLYA 2BKPA 3OYXA 1XWMA 4G63A 2E5LT 3C79A 2BG9C 3OJAA 4UV8B 5IWAT 3N2OA 1UCUA 2XQ6A 4XHEA 3VRBA 3I9WA 3NBXX 2I59A 5AQMB 3ZPOA 4ZRUA 4K0UA 2QRXA 4UELA 5ABHA 5HEHA 4YY3T 2DWGA 2V6XA 4DBRA 5CB4E 3IHRA 2EHOA 2XTLA 4WV9A 3CQCB 4H9PC 3FXEB 1LRZA 4YSZA 5A1LA 3WAJA 4ZXLA 2XAJB 3CIRA 1I94T 4YLHA 3KV4A 1ZKEA 5AQPB 4EZ4A 4C91A 1X9BA 1B7TA 5F3JA 2CHOA 5H6RB 2W8GA 2PG8A 4AKRB 5L3GB 3ZDHA 4EB6E 2H89A 5LHHB 2W00A 4O2BE 1J1JA 3C4ZA 2MOZA 5AQKB 4ZEYA 4HN9A 3LBXB 5JMEA 1HG5A 2YINA 2WNLA 3LK42 5JRCB 5FXXA 4HFDA 2IW5B 3HR0A 2ACXA 1HTJF 2M6IA 5BR8T 4GYSA 4CXXA 3RQWA 2KNDA 2DCFA 2X0HA 4IL9A 3ZSTA 3PUQA 2CXFA 2C9TA 5AFKA 2BS2A 5AFMA 4ZJSA 2XJ7A 2DWKA 1KF6A 4PFPA 2DL1A 3A8YC 3U8JA 4U72A 2J4GA 4AFGA 5J5GA 4DV0T 1NENA 4MHCA 3MKDA 3FHNA 2A3DA 2W2UA 4ERRA 4Q25A 2W61A 2VQFT 4UIGA 4A56A 1OXZA 3GN5B 4LFBT 4AQGA 2E5VA 2X00A 4YHHT 4E7ZA 4EXTA 3Q9DA 2BBJA 4A98A 2UXCT 3O1IA 2WNJA 2LOSA 5J5HA 3I1AA 5HEGA 4HEAA 3PURA 5HXEA 3ZN1B 2QYWA 4MBQA 4HWCA 2X0YA 5DJQC 4HTEA 2CPTA 5LB7B 1J5ET 2Z6EA 3VR9A 4LMKA 3I0QA 2LSYA 3UU6A 3KBUA 4LMJA 5LXTE 2XAGB 3NVOA 3EHZA 2NW7A 4K0KT 4EOZB 3RI5A 4Z8XA 5AQNB 3P4WA 1U5PA 4BJNA 2EHOB 5FY1A 1LKXA 3RIUA 2JIWA 1IJ6A 5EK2A 3FZKB 3W15B 4DV4T 3N9MA 3QNUA 2E2AA 2HPLA 2X9HA 3OVUA 1HS7A 4EZ1A 2NW9A 2LRKA 3P8CD 4QWNB 4TNVA 5AFNA 3O1JA 2XAFB 1L0VA 4DBMA 2WP9A 3RRCA 2Y7YA 4GK5E 2HN2A 3N2GE 3E22E 1ZEEA 5FJVA 3VU7H 4EEBA 4ZK4A 5JRCA 2K5BB 5BP0A 5LGNB 3N5LA 4AXPA 3AE8A 5ABFA 1R8IA 4QAAA 3P4PA 4HWDA 5J1GA 3EUHA 2JQQA 3UUMA 3N9OA 4COFA 3RQUA 3RYIE 3QB5K 2HHHT 2JMKA 1IZNB 2XNVA 5AQTB 3AAIA 4GK0E 1HF8A 2XQ4A 1FMWA 3PJAJ 5AQFB 3A7MA 5JR9B 1AJ3A 3AE6A 3PE0A 3BQLA 4BJMA 4HFEA 2JQHA 5L4HA 2G0UA 3QC9A 2LSJA 3HI2A 2QVAA 5HXRA 2NWBA 3ANWB 2MYSA 4JI1T 4ILCA 2J62A 4PW8A 5L3EB 3R84B 3ZDGA 1UK5A 4P09A 2W67A 4NUVA 3RC8A 4UVBB 2ACZA 5IYZE 3EDVA 2WQYA 1BR2A 3TKLB 3AAAB 3V5UA 2LSGA 5KMGP 5L3FB 4HFCA 1S35A 2D2SA 3MA9A 3ZLIA 2BS3A 4TZ4C 2D9DA 5LG4A 3PV0F 5HCJA 3OBVE 3ZC0A 4QXCB 1FIOA 4KUMB 2V7IA 2HN1A 4DO0A 3ZMVB 4HKAA 2DHRA 5BMVE 3NRXA 5TAOA 3RYHE 4HFHA 5FKYA 4GKKT 5J2TE 2IC6A 1T72A 4IDPA 2E9XD 4JI2T 1N32T 2Q9QA 3FZMB 4IDZA 3SFEA 3OKQA 4BFQA 2A9UA 2DNXA 1W0AA 4AQYT 3BK9A 4DUYT 2MPKA 2ZM0A 1H7CA 2UXNB 1N34T 2XNTA 2NTXA 2VVSA 5LJNA 3RKOA 4JV5T 4FI5A 4WYVA 4P0AA 4U74A 4WNKA 5FXZA 3RLFF 2BR7A 1MNDA 3HA4A 2ZJUA 1UX2A 3L8RA 4UVAB 1D0XA 4QH5A 4H9OC 2X51A 4QH4A 2XYTA 1D1CA 3HKBE 1WFDA 5AFUL 3SQ9A 3F2EA 2XZ5A 2CHNA 2BYPA 4NPPA 3CMLA 4TV8E 5DQVA 1UX5A 4YTNA 3SH1A 3AVSA 1Y01A 2V8SV 3SQ6A 3WIPA 4ZI3C 2BBHA 4LF5T 3T8OA 2MAWA 2XQAA 2VKOA 4CN4A 2IIUA 2WAUA 4NZBA 4JI5T 4NXNT 3U78A 3UFEA 4ZHQE 1KFYA 3SIOA 5AQGB 2Y56A 3RYCE 4I4TE 4X1KE 5AQQB 1O3XA 3ONJA 5L3DB 3V5SA 5LP6E 3IBPA 1YQ3A 5BW2A 4DR6T 4ZI2D 1MMGA 4TWDA 4DV6T 1WYBA 5L3BB 3AA7B 4BQTA 3ONLC 3DJBA 5F8PA 1WR0A 2BYQA 5LHIB 2DLRA 3IEEA 2UXBT 1Z8UA 2ZLYA 4H63H 3RKGA 3P50A 1M62A 2XAQB 3KV9A 5FVKA 2N1GA 2CE7A 3HKEE 4Z91A 4TNWA 4PIRA 4X20E 2L8KA 4EAHA 4KP3C 4DIDB 1NWMX 2X66A 1QUUA 2BG9E 3B57A 4YSYA 2K48A 3LK3B 3O9XA 2V7LA 5J0ZA 2X68A 3WTJA 4YSXA 3K3NA 3T1HT 4OK0A 3ZYMA 2X9WA 5JDLA 1E1HB 3P4SA 5JDFA 4NXMT 2D5UA 2WM9A 4GKJT 3F31A 2JRKA 2BR8A 4XZCA 3EVYA 3K3OA 4ZK1A 4ZOLE 3AA6B 3B5MA 3H3MA 5HEJA 3CQGB 3RX6A 2YDRA 2LSKA 4UF0B 5AQOB 1UW6A 2WZIA 3JC6C 3Q2MA 3EI0A 4O2AE 3UULA 4PK5A 4OYJA 1VRBA 3TLWA 3PU8A 2IAKA 5F5WA 2K24A 2L3LA 3OPCA 4OX9T 4O8SA 1HNWT 3FZLB 4GIWA 5ETWA 4HFVA 2OV9A 2R6GF 3K8PC 1MMNA 5LYJE 2NR4A 2V7JA 4PAGA 2NTYA 2CXDA 2WDRA 4EEDA 1MIYA 3CX8B 3P7IA 2BVLA 2MBGA 1QLBA 5FNVE 2IHR1 2YDQA 3UQ7A 3HL6A 4DR3T 3UU5A 2H88A 4YTMA 3H37A 1JNRA 4MALA 4U2ZA 4YJ2E 2B1EA 5LBQB 4JEUB 3AE9A 5FY7A 2E9XB 2WBLA 3C51A 3SFDA 4A97A 3FZHB 3PUVF 3RIAA 2YK0A 3AVRA 5CA1E 2JQ9A 2IC9A 3O1HA 1XDPA 3N2KE 3PUWF 3RGLA 2YDSA 2BKNA 2CBIA 5JVDE 3B13A 2YEVC 4QH1A 3NKZA 5C2TA 2I6HA 3ZC1A 1D1AA 3AB3B 2AE9A 2CEAA 3AEBA 3Q5XA 3N9PA 4WW0A 5KX5E 4IL4A 3ABVA 1KK7A 2NP9A 1SE7A 1G73A 2FJAA 2ZMAA 5AQHB 4ISSA 3JCFA 3T1YT 4ZS3A 2FJDA 3J7Yq 4O4HE 2QA7A 2UZ6A 3WTOA 4M1PA 5AFMB 3C4XA 2MTQA 3E08A 2UUCT 4UXNB 4P0BA 2BJ0A 3AEDA 2JMHA 5JDQA 2LHRA 4DMWA 1N33T 1ZOYA 2PTFA 2J47A 4PJMA 4I50E 3KVBA 5IHYA 1V9DA 1W09A 5H6QB 4ZI3D 3RC3A 2ODUA 4PNIA 2VASA 2ZJVA 3AXJA 4DR7T 2XQ7A 2XQ8A 4ASKA 2XZ6A 4CI2B 4B3RT 3GUAA 1T7SA 4LF6T 2KWHA 5AFHA 2BDEA 4AKHA 4QABA 2V6YA 2XYSA 4ISTA 3UU8A 2WSSV 1DU2A 4EZHA 1E7PA 1T8BA 4YHJA 4LFCT 3AE1A 5FL1A 3CWZB 3MK7C 4P1NA 2X0LB 2XASB 2CMRA 2Y8DA 1HNZT 4TN7B 5EK3A 2OA5A 4V1Av 5AQIB 4U33A 2PGZA 3D0TA 4TV9E 4WBNE 4U7IA 1IJ5A 4X62T 3LFMA 2RP4A 2W66A 3RIFA 3PUGA 5AFJA 4MLKA 2Q9QC 3LSVA 3E0ZA 4HWFA 4J2CA 4IE4A 4CI1B 3KV6A 3AEGA 2JJ9A 3ZMUB 2CRBA 4IGUA 3PDYA 3IA3A 3WTHA 4CN1A 4DV5T 1NEKA 3CK6A 3AEEA 3WTIA 1KEYA 3PMZA 3CVRA 3U3IA 4IE7A 4PJLA 3KV5A 3AE2A 2PH9A 4IIJE 4UVCB 3O4XE 1EZ3A 1FJGT 3Q5EA 4DVDA 1CUNA 2LKGA 1G8XA 2WCAA 3M65A 2WN9A 3QK6A 3H3AA 1UGOA 5HCMA 4PJNA 3ZMTB 4EYYR 4I55E 3VRAA 5LBMA 2VQET 3NRYA 4AKLA 2UUBT 3WTMA 4O4JE 2F4VT 2CA5A 3AEAA 5FY0A 3C64A 1YW0A 4ZZBA 2X67A 2BS4A 1HFAA 5HEUA 4DNDA 1KNRA 1X79A 3PU3A 1IBKT 4B5DA 3J9X1 3HKCE 3RPUA 2VL8A 1VCTA 4AFHA 2BVMA 5LMUT 2H7VC 5E0OA 2WZHA 3GA8A 1ZP0A 2UU9T 4UY2A 4H63V 1US7B 2V6YB 3L3PA 3KINB 2BKOA 2LHNA 4QX7B 1S94A 4O4LE 4PK4A 3I9YA 2KZ7B 3UFGA 5L2LA 2A72A 4EIWA 5LJMA 3WTLA 5LXBA 3OYZA 5AQSB 2WWUA 5JTGA 2W62A 3ZT5A 3C98B 5HAXA 2YN6A 4E7SA 3FXDB 2KLQA 2SPCA 3PUYF 2C5KT 4DV7T 2KT9A 3ONXA 4AKIA 2X9YA 4DR5T 4JI3T 2LJLA 3NWIA 1XMQT 2VK9A 4JLEA 2XQ5A 2NOXA 3MACA 2X00D 4JI7T 5DQWA 3U8NA 5HXCA 4LFAT 4U7YA 2WS3A 5AINA 1Y64B 3MJXA 3LJCA 2JQKA 4AQFA 3RRWA 4UF0A 1OWAA 1XNRT 4AQFC 3L39A 1IBMT 5ADXL 2C5IT 2W0GA 2W63A 3NZPA 3ZMSB 3PUSA 5LGUB 3R6NA 2W8FA 3KDSE 1MNEA 4UM3P 4JUYA 2Y54A 1W9RA 3ZT6A 4ADZA 3RF1A 1MIWA 4KBMB 3OTOT 2AXDS 1CHUA 5LHGB 1XZYA 4DV2T 3JC6D 2H3RA 4WBOA 3LG7A 2FJEA 3MXZA 2UUAT 2H7OA 4JI0T 4CXYA 4B3ST 4KI0F 2YU2A 4AFTA 3DP7A 5ABGA 4B3MT 3JAEA 5FP3A 5EZYE 4QXHB 4KX6A 4H9QC 2JPFA 1NAFA 1VCSA 5GONE 3UUNA 5HYAA 4PJJA 2Y58A 3FBZA 2PJQA 4YXDA 4PK6A 3U8KA 2CCQA 2BG9B 1SA0E 5L3CB 5AQLB 3EABA 1U4QA 2V26A 3CX6B 2D0TA 3Q5DA 4JI6T 2YOEA 1JNZA 3AEFA 2N2NA 2C5JA 2BYSA 4EV6A 5J5IA 2CM0A 3UTKA 1QSDA 3JAFA 3GMIA 4H9RC 1WYCA 2DI4A 2XM1A 3PUAA 4ZZCA 3PJAA 2HPJA 4CZZB 1BR4A 5JDGA 2XUEA 1WCRA 5LOVE 4QX8B 3BQKA 2KXPB 5HWXA 2WWVA 5HWYA 5KDMC 4C90A 1D0ZA 5AQVB 2BYNA 2WDVA 3C4WA 3P4RA 4N78D 5L4EA 5LCYA 5ABEA 2IMLA 2WU5A 4KMCA 1WRDA 4CXWA 2WU2A 2LEHA 3AE7A 1IBLT 5HXHA 3WTKA 1ZV4X 2Y6XA 3SOLA 4TX5A 2PFVA 1WLXA 5JDMA 4H9NC 2BYRA 3T4MA 3BQIA 1FMVA 4OHFA 2EHOC 2CLYB 5HEOA 1I6ZA 2XQ9A 4U3CA 5FXWA 1W0BA 2VKHA 3VKHA 4HFBA 2XNUA 3ZJ2A 3WI3A 5FL0A 4QKNA 1HR0T 3TLTA 5JH7E 3RIUC 3I0OA 4AKGA 1J5WA 4IDNA 5LGTB 2Y48B 3ZSSA 2E9XC 3TLSA 4AISA 2ZM6T 4B6XA 3AAEB 2XSBA 3GN5A 2VKJA 3EDUA 2E9XA 3PUXF 4L5GA 1UV6A 2K3WA 3JADA 4QHOA 2Q9QD 2XAHB 4ZI7E 1HCIA 2XHEB 3N9QA 4LMLA 1GQEA 4IT4A 3ZT7A 3ZCIA 1YD8G 3KFWX 4ZI2C 3QB5A 3ANWA 3ZYLA 2L9QA 3CX7B 5CFBA 3HKDE 2XY8B 2FBWA 5LG3A 2XPKA 4JI4T 1LVFA 3ZN0B 2ODVA 4UM1A 3KBTA 4BA9A 2Y57A 3CKDA 4QXBB 1MIVA 2XZEA 4OFZA 3M3ZB 3N9LA 1IAPA 5FVLA 4X1IE 4A5XA 3VKGA 4LF4T 4FRRA 2WDQA 1OEDA 4XAXB 1T98A 3AE3A 3LBXA 4JBWF 2D0UA 2YKSA 1HG2A 1I9BA 2A2FX 4AI6A 2K9AA 2LSIA 3QUJA 4KHPT 3EAMA 3IGQA 2V5DA 5CJ5A 3UQ4A 4HFIA 4ILBA 5CO5A 3AE4A 4L9IA 3ZJ1A 3MZKB 2Q9QB 4NUUA 3AE5A 3QOFA 4IDOA 3RYFE 4EYUA 4IDQA 4HWHA 2XSAA 3PTRB 4NIQA 3UUXB 4ANJA 4UEMA 3TLVA 3SWHA 3NZQA 3FB2A 5C3JA 2GK9A 3WAKA 3C50A 4X1YE 3IF8B 3DTOA 1SHZC 4Z90A 5AQRB 1SUMB 4U2YA 1YKEB 4XBFB 2NW8A 2V5CA 4GYRA 1OEDC 4EGWA 1VOMA 5J5FA 2P9BA 5BRXA 2EHOD 5HXSA 3PEOA 5FXVA 4ZR6A 4WZXA 4JI8T 2LOPA 2XQ3A 2CLYC 1WR6A 2OLTA 2IDOB 4UM3S 1E2AA 5KXJA 2PBIA 2FUPA 2RA1A 2BG9A 2VL0A 5M4YA 1KNPA 4IE5A 5LNKA 4GOUA 1KNZA 4CI3B 3ZMZB 2VWAA 2VKDA 4I43B 5KE4A 2HH7A 1YQ4A 4MFRA 3UUBA 4IREA 2CWOA 2KINB 2V7MA 2WB5A 4TWFA 4D01A 1Z0PA 3X1DA 2VURA 3ZCJA 3TLUA 1BR1A 5DABA 4HQPA 4JEHB 1HX1B 1ZHCA 2LM2A 2ES0A 1HX8A 3F57A 4I0UA 2KSRA 4BAYB 2BZBA 3K3QC 4ZS2A 5EK4A 1YKHB 2J1DG 4YJ3E 4LF8T 1LVKA 3VHLA 3UU4A 4H9SE 2QC1B 5JDHA 2N9DA 3U8LA 2VVNA 4F6RC 2YU1A 4HWIB 5AFLA 3SRZA 3G06A 4IE6A 3GWHA 2FJBA 4TUYE 4DR2T 2UXXB 3N9NA 1D0YA 3A5XA 1BR0A 4CN6A 3ESLA 3WTNA 5CGMA 5KZUA 2ZM2A 2V1DB 4L0RA 4UM3A 2X9XA
chains in the Genus database with same CATH topology
5FJVA 2Y58A 4NZBA 4HFBA 2XNUA 2VL0A 2BG9A 5HCJA 2X00A 2YKSA 2XQ5A 4F8HA 4ZK4A 1I9BA 4IL4A 3U8KA 5BP0A 1UW6A 2WNCA 3SIOA 2X00D 2Y56A 2BG9B 3TLTA 2YMEA 4A98A 2W8GA 4ZZBA 3EAMA 3IGQA 5SYOA 3EI0A 2WNJA 3UQ4A 4ALXA 3TLWA 5J5HA 4HFIA 5HEGA 4ILBA 2YOEA 5HEUA 5IUXA 4QAAA 5CO5A 3ZDHA 4HFHA 5KE4A 4B5DA 3U8NA 3UU3A 2UZ6A 2PGZA 3WTOA 3TLSA 5BW2A 3UUBA 4COFA 3RQUA 3U8MA 4IREA 4TWDA 5AFMB 2BYSA 4QACA 2WZYA 5AINA 1UV6A 5J5IA 4BQTA 4TWFA 3JADA 3JAFA 4D01A 2BYQA 4LMKA 3C84A 4BFQA 3RIFA 5JMEA 4AFHA 3UU6A 2XNVA 2WNLA 2BJ0A 4LMJA 3TLUA 4ZZCA 5TVCA 2XQ4A 4HFDA 1OEDE 4TWHA 4LMLA 4HQPA 5AFJA 4XK9A 2M6BA 3P50A 2M6IA 2LM2A 3EHZA 3RQWA 2XNTA 3LSVA 3RI5A 2LLYA 4IL9A 3TLVA 3C79A 3UQ7A 4Z91A 4HFEA 2KSRA 2W8FA 4UY2A 2BG9C 3P4WA 4UM3P 4TNWA 3UU5A 4X5TA 2Y54A 4PIRA 5L4HA 2YMDA 5CFBA 2XQ6A 2Y7YA 2C9TA 5AFKA 4XHEA 5AFMA 3WTHA 2BG9E 5LG3A 3UU4A 4Z90A 4A97A 2QC1B 2BR7A 4ZJSA 2ZJVA 3WTIA 3PMZA 4ILCA 3U8LA 3RIAA 2ZJUA 5J0ZA 4UM1A 1UX2A 2BYNA 2XQ7A 5L47A 2XQ8A 3WTJA 4ZRUA 2XZ6A 2Y57A 4QH5A 5L4EA 5AFLA 2PH9A 3ZDGA 3WTLA 4QH4A 3RHWA 5LXBA 1OEDC 2XYTA 3U8JA 3GUAA 5HEHA 2LKGA 3WTKA 5J5FA 4EZ1A 4AFTA 5BRXA 3SQ9A 4TNVA 4AFGA 5AFHA 2XZ5A 5J5GA 2BYPA 4NPPA 2WN9A 3PEOA 4QABA 5AFNA 4UXUA 2BYRA 4WV9A 4ZR6A 2YN6A 3SH1A 3T4MA 2BR8A 3ZKRA 3JAEA 4ZK1A 5HCMA 3WTNA 2XYSA 2XQ3A 5KZUA 5HEOA 1OEDB 4QH1A 3UU8A 3SQ6A 4ZJTA 3WIPA 4HFCA 2XQ9A 4UM3S 4FRRA 4ILAA 4DBMA 4UM3A 2LKHA 2MAWA 2XQAA 3WTMA 1OEDA 5HEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJV A;  2Y58 A;  4NZB A;  4HFB A;  2XNU A;  2VL0 A;  2BG9 A;  5HCJ A;  2X00 A;  2YKS A;  2XQ5 A;  4F8H A;  4ZK4 A;  1I9B A;  4IL4 A;  3U8K A;  5BP0 A;  1UW6 A;  2WNC A;  3SIO A;  2X00 D;  2Y56 A;  2BG9 B;  3TLT A;  2YME A;  4A98 A;  2W8G A;  4ZZB A;  3EAM A;  3IGQ A;  5SYO A;  3EI0 A;  2WNJ A;  3UQ4 A;  4ALX A;  3TLW A;  5J5H A;  4HFI A;  5HEG A;  4ILB A;  2YOE A;  5HEU A;  5IUX A;  4QAA A;  5CO5 A;  3ZDH A;  4HFH A;  5KE4 A;  4B5D A;  3U8N A;  3UU3 A;  2UZ6 A;  2PGZ A;  3WTO A;  3TLS A;  5BW2 A;  3UUB A;  4COF A;  3RQU A;  3U8M A;  4IRE A;  4TWD A;  5AFM B;  2BYS A;  4QAC A;  2WZY A;  5AIN A;  1UV6 A;  5J5I A;  4BQT A;  4TWF A;  3JAD A;  3JAF A;  4D01 A;  2BYQ A;  4LMK A;  3C84 A;  4BFQ A;  3RIF A;  5JME A;  4AFH A;  3UU6 A;  2XNV A;  2WNL A;  2BJ0 A;  4LMJ A;  3TLU A;  4ZZC A;  5TVC A;  2XQ4 A;  4HFD A;  1OED E;  4TWH A;  4LML A;  4HQP A;  5AFJ A;  4XK9 A;  2M6B A;  3P50 A;  2M6I A;  2LM2 A;  3EHZ A;  3RQW A;  2XNT A;  3LSV A;  3RI5 A;  2LLY A;  4IL9 A;  3TLV A;  3C79 A;  3UQ7 A;  4Z91 A;  4HFE A;  2KSR A;  2W8F A;  4UY2 A;  2BG9 C;  3P4W A;  4UM3 P;  4TNW A;  3UU5 A;  4X5T A;  2Y54 A;  4PIR A;  5L4H A;  2YMD A;  5CFB A;  2XQ6 A;  2Y7Y A;  2C9T A;  5AFK A;  4XHE A;  5AFM A;  3WTH A;  2BG9 E;  5LG3 A;  3UU4 A;  4Z90 A;  4A97 A;  2QC1 B;  2BR7 A;  4ZJS A;  2ZJV A;  3WTI A;  3PMZ A;  4ILC A;  3U8L A;  3RIA A;  2ZJU A;  5J0Z A;  4UM1 A;  1UX2 A;  2BYN A;  2XQ7 A;  5L47 A;  2XQ8 A;  3WTJ A;  4ZRU A;  2XZ6 A;  2Y57 A;  4QH5 A;  5L4E A;  5AFL A;  2PH9 A;  3ZDG A;  3WTL A;  4QH4 A;  3RHW A;  5LXB A;  1OED C;  2XYT A;  3U8J A;  3GUA A;  5HEH A;  2LKG A;  3WTK A;  5J5F A;  4EZ1 A;  4AFT A;  5BRX A;  3SQ9 A;  4TNV A;  4AFG A;  5AFH A;  2XZ5 A;  5J5G A;  2BYP A;  4NPP A;  2WN9 A;  3PEO A;  4QAB A;  5AFN A;  4UXU A;  2BYR A;  4WV9 A;  4ZR6 A;  2YN6 A;  3SH1 A;  3T4M A;  2BR8 A;  3ZKR A;  3JAE A;  4ZK1 A;  5HCM A;  3WTN A;  2XYS A;  2XQ3 A;  5KZU A;  5HEO A;  1OED B;  4QH1 A;  3UU8 A;  3SQ6 A;  4ZJT A;  3WIP A;  4HFC A;  2XQ9 A;  4UM3 S;  4FRR A;  4ILA A;  4DBM A;  4UM3 A;  2LKH A;  2MAW A;  2XQA A;  3WTM A;  1OED A;  5HEJ A; 
#chains in the Genus database with same CATH topology
 4YT0 A;  4PFO A;  2C0S A;  4DBQ A;  3ETV A;  3AA0 B;  2UXD T;  1MMA A;  1D1B A;  5C8Y E;  2KWI B;  4LF7 T;  4F8H A;  4CQI A;  2CWY A;  5SYO A;  4ALX A;  4LF9 T;  1XMO T;  3LDQ B;  3ETU A;  2LRL A;  3UU3 A;  4X64 T;  4U31 A;  2B76 A;  2VB6 A;  3K1S A;  4QAC A;  4G2A A;  2WY2 A;  3P4Q A;  1N36 T;  2LM9 A;  3AXJ B;  2CBJ A;  4DR4 T;  1HNX T;  3AEC A;  4KHZ F;  3L09 A;  4TWH A;  4XK9 A;  1FEW A;  5CA0 E;  3PUZ F;  3AA1 B;  3VR8 A;  5AQU B;  2ZM8 A;  4X5T A;  3Q5W A;  3FZF B;  2YMD A;  4JYA T;  2V7K A;  3RH3 A;  3S4U A;  2I0M A;  1UX4 A;  5AQJ B;  5J2U E;  2LE8 A;  1MMD A;  2M67 A;  5L47 A;  2RPA A;  5JDN A;  5FYM A;  1YXR A;  3RHW A;  4YTP A;  5JRE A;  5LA6 E;  4IE0 A;  4UV9 B;  1M7K A;  1XDO A;  2IUB A;  2WMN A;  5LMN T;  4HGA A;  3CPZ A;  4UXU A;  2WMO A;  2XM2 A;  3ZKR A;  3SS1 A;  1OED B;  2E8I A;  4ZJT A;  2CXL A;  4O4I E;  3CQX C;  4OYK A;  4ILA A;  2LKH A;  5JQG E;  4DV1 T;  3ZYK A;  4DR1 T;  5ABF B;  2WNC A;  3LK2 B;  1UUR A;  1UUS A;  2YME A;  3FBL A;  2KMF A;  1XNQ T;  4ILU A;  5JR9 C;  5IUX A;  2XQY A;  4DMV A;  2QGS A;  4DUZ T;  4B3T T;  4YFS A;  3U8M A;  4X65 T;  3KVA A;  2WZY A;  3ZEF B;  4FJO A;  4X66 T;  2LT3 A;  3C84 A;  5JR9 A;  2W4X A;  4DV3 T;  4IHJ E;  4AIU A;  5TVC A;  1OED E;  2M6B A;  5FMN A;  4HE8 A;  4UR9 A;  3UT5 E;  2LLY A;  2BKP A;  3OYX A;  1XWM A;  4G63 A;  2E5L T;  3C79 A;  2BG9 C;  3OJA A;  4UV8 B;  5IWA T;  3N2O A;  1UCU A;  2XQ6 A;  4XHE A;  3VRB A;  3I9W A;  3NBX X;  2I59 A;  5AQM B;  3ZPO A;  4ZRU A;  4K0U A;  2QRX A;  4UEL A;  5ABH A;  5HEH A;  4YY3 T;  2DWG A;  2V6X A;  4DBR A;  5CB4 E;  3IHR A;  2EHO A;  2XTL A;  4WV9 A;  3CQC B;  4H9P C;  3FXE B;  1LRZ A;  4YSZ A;  5A1L A;  3WAJ A;  4ZXL A;  2XAJ B;  3CIR A;  1I94 T;  4YLH A;  3KV4 A;  1ZKE A;  5AQP B;  4EZ4 A;  4C91 A;  1X9B A;  1B7T A;  5F3J A;  2CHO A;  5H6R B;  2W8G A;  2PG8 A;  4AKR B;  5L3G B;  3ZDH A;  4EB6 E;  2H89 A;  5LHH B;  2W00 A;  4O2B E;  1J1J A;  3C4Z A;  2MOZ A;  5AQK B;  4ZEY A;  4HN9 A;  3LBX B;  5JME A;  1HG5 A;  2YIN A;  2WNL A;  3LK4 2;  5JRC B;  5FXX A;  4HFD A;  2IW5 B;  3HR0 A;  2ACX A;  1HTJ F;  2M6I A;  5BR8 T;  4GYS A;  4CXX A;  3RQW A;  2KND A;  2DCF A;  2X0H A;  4IL9 A;  3ZST A;  3PUQ A;  2CXF A;  2C9T A;  5AFK A;  2BS2 A;  5AFM A;  4ZJS A;  2XJ7 A;  2DWK A;  1KF6 A;  4PFP A;  2DL1 A;  3A8Y C;  3U8J A;  4U72 A;  2J4G A;  4AFG A;  5J5G A;  4DV0 T;  1NEN A;  4MHC A;  3MKD A;  3FHN A;  2A3D A;  2W2U A;  4ERR A;  4Q25 A;  2W61 A;  2VQF T;  4UIG A;  4A56 A;  1OXZ A;  3GN5 B;  4LFB T;  4AQG A;  2E5V A;  2X00 A;  4YHH T;  4E7Z A;  4EXT A;  3Q9D A;  2BBJ A;  4A98 A;  2UXC T;  3O1I A;  2WNJ A;  2LOS A;  5J5H A;  3I1A A;  5HEG A;  4HEA A;  3PUR A;  5HXE A;  3ZN1 B;  2QYW A;  4MBQ A;  4HWC A;  2X0Y A;  5DJQ C;  4HTE A;  2CPT A;  5LB7 B;  1J5E T;  2Z6E A;  3VR9 A;  4LMK A;  3I0Q A;  2LSY A;  3UU6 A;  3KBU A;  4LMJ A;  5LXT E;  2XAG B;  3NVO A;  3EHZ A;  2NW7 A;  4K0K T;  4EOZ B;  3RI5 A;  4Z8X A;  5AQN B;  3P4W A;  1U5P A;  4BJN A;  2EHO B;  5FY1 A;  1LKX A;  3RIU A;  2JIW A;  1IJ6 A;  5EK2 A;  3FZK B;  3W15 B;  4DV4 T;  3N9M A;  3QNU A;  2E2A A;  2HPL A;  2X9H A;  3OVU A;  1HS7 A;  4EZ1 A;  2NW9 A;  2LRK A;  3P8C D;  4QWN B;  4TNV A;  5AFN A;  3O1J A;  2XAF B;  1L0V A;  4DBM A;  2WP9 A;  3RRC A;  2Y7Y A;  4GK5 E;  2HN2 A;  3N2G E;  3E22 E;  1ZEE A;  5FJV A;  3VU7 H;  4EEB A;  4ZK4 A;  5JRC A;  2K5B B;  5BP0 A;  5LGN B;  3N5L A;  4AXP A;  3AE8 A;  5ABF A;  1R8I A;  4QAA A;  3P4P A;  4HWD A;  5J1G A;  3EUH A;  2JQQ A;  3UUM A;  3N9O A;  4COF A;  3RQU A;  3RYI E;  3QB5 K;  2HHH T;  2JMK A;  1IZN B;  2XNV A;  5AQT B;  3AAI A;  4GK0 E;  1HF8 A;  2XQ4 A;  1FMW A;  3PJA J;  5AQF B;  3A7M A;  5JR9 B;  1AJ3 A;  3AE6 A;  3PE0 A;  3BQL A;  4BJM A;  4HFE A;  2JQH A;  5L4H A;  2G0U A;  3QC9 A;  2LSJ A;  3HI2 A;  2QVA A;  5HXR A;  2NWB A;  3ANW B;  2MYS A;  4JI1 T;  4ILC A;  2J62 A;  4PW8 A;  5L3E B;  3R84 B;  3ZDG A;  1UK5 A;  4P09 A;  2W67 A;  4NUV A;  3RC8 A;  4UVB B;  2ACZ A;  5IYZ E;  3EDV A;  2WQY A;  1BR2 A;  3TKL B;  3AAA B;  3V5U A;  2LSG A;  5KMG P;  5L3F B;  4HFC A;  1S35 A;  2D2S A;  3MA9 A;  3ZLI A;  2BS3 A;  4TZ4 C;  2D9D A;  5LG4 A;  3PV0 F;  5HCJ A;  3OBV E;  3ZC0 A;  4QXC B;  1FIO A;  4KUM B;  2V7I A;  2HN1 A;  4DO0 A;  3ZMV B;  4HKA A;  2DHR A;  5BMV E;  3NRX A;  5TAO A;  3RYH E;  4HFH A;  5FKY A;  4GKK T;  5J2T E;  2IC6 A;  1T72 A;  4IDP A;  2E9X D;  4JI2 T;  1N32 T;  2Q9Q A;  3FZM B;  4IDZ A;  3SFE A;  3OKQ A;  4BFQ A;  2A9U A;  2DNX A;  1W0A A;  4AQY T;  3BK9 A;  4DUY T;  2MPK A;  2ZM0 A;  1H7C A;  2UXN B;  1N34 T;  2XNT A;  2NTX A;  2VVS A;  5LJN A;  3RKO A;  4JV5 T;  4FI5 A;  4WYV A;  4P0A A;  4U74 A;  4WNK A;  5FXZ A;  3RLF F;  2BR7 A;  1MND A;  3HA4 A;  2ZJU A;  1UX2 A;  3L8R A;  4UVA B;  1D0X A;  4QH5 A;  4H9O C;  2X51 A;  4QH4 A;  2XYT A;  1D1C A;  3HKB E;  1WFD A;  5AFU L;  3SQ9 A;  3F2E A;  2XZ5 A;  2CHN A;  2BYP A;  4NPP A;  3CML A;  4TV8 E;  5DQV A;  1UX5 A;  4YTN A;  3SH1 A;  3AVS A;  1Y01 A;  2V8S V;  3SQ6 A;  3WIP A;  4ZI3 C;  2BBH A;  4LF5 T;  3T8O A;  2MAW A;  2XQA A;  2VKO A;  4CN4 A;  2IIU A;  2WAU A;  4NZB A;  4JI5 T;  4NXN T;  3U78 A;  3UFE A;  4ZHQ E;  1KFY A;  3SIO A;  5AQG B;  2Y56 A;  3RYC E;  4I4T E;  4X1K E;  5AQQ B;  1O3X A;  3ONJ A;  5L3D B;  3V5S A;  5LP6 E;  3IBP A;  1YQ3 A;  5BW2 A;  4DR6 T;  4ZI2 D;  1MMG A;  4TWD A;  4DV6 T;  1WYB A;  5L3B B;  3AA7 B;  4BQT A;  3ONL C;  3DJB A;  5F8P A;  1WR0 A;  2BYQ A;  5LHI B;  2DLR A;  3IEE A;  2UXB T;  1Z8U A;  2ZLY A;  4H63 H;  3RKG A;  3P50 A;  1M62 A;  2XAQ B;  3KV9 A;  5FVK A;  2N1G A;  2CE7 A;  3HKE E;  4Z91 A;  4TNW A;  4PIR A;  4X20 E;  2L8K A;  4EAH A;  4KP3 C;  4DID B;  1NWM X;  2X66 A;  1QUU A;  2BG9 E;  3B57 A;  4YSY A;  2K48 A;  3LK3 B;  3O9X A;  2V7L A;  5J0Z A;  2X68 A;  3WTJ A;  4YSX A;  3K3N A;  3T1H T;  4OK0 A;  3ZYM A;  2X9W A;  5JDL A;  1E1H B;  3P4S A;  5JDF A;  4NXM T;  2D5U A;  2WM9 A;  4GKJ T;  3F31 A;  2JRK A;  2BR8 A;  4XZC A;  3EVY A;  3K3O A;  4ZK1 A;  4ZOL E;  3AA6 B;  3B5M A;  3H3M A;  5HEJ A;  3CQG B;  3RX6 A;  2YDR A;  2LSK A;  4UF0 B;  5AQO B;  1UW6 A;  2WZI A;  3JC6 C;  3Q2M A;  3EI0 A;  4O2A E;  3UUL A;  4PK5 A;  4OYJ A;  1VRB A;  3TLW A;  3PU8 A;  2IAK A;  5F5W A;  2K24 A;  2L3L A;  3OPC A;  4OX9 T;  4O8S A;  1HNW T;  3FZL B;  4GIW A;  5ETW A;  4HFV A;  2OV9 A;  2R6G F;  3K8P C;  1MMN A;  5LYJ E;  2NR4 A;  2V7J A;  4PAG A;  2NTY A;  2CXD A;  2WDR A;  4EED A;  1MIY A;  3CX8 B;  3P7I A;  2BVL A;  2MBG A;  1QLB A;  5FNV E;  2IHR 1;  2YDQ A;  3UQ7 A;  3HL6 A;  4DR3 T;  3UU5 A;  2H88 A;  4YTM A;  3H37 A;  1JNR A;  4MAL A;  4U2Z A;  4YJ2 E;  2B1E A;  5LBQ B;  4JEU B;  3AE9 A;  5FY7 A;  2E9X B;  2WBL A;  3C51 A;  3SFD A;  4A97 A;  3FZH B;  3PUV F;  3RIA A;  2YK0 A;  3AVR A;  5CA1 E;  2JQ9 A;  2IC9 A;  3O1H A;  1XDP A;  3N2K E;  3PUW F;  3RGL A;  2YDS A;  2BKN A;  2CBI A;  5JVD E;  3B13 A;  2YEV C;  4QH1 A;  3NKZ A;  5C2T A;  2I6H A;  3ZC1 A;  1D1A A;  3AB3 B;  2AE9 A;  2CEA A;  3AEB A;  3Q5X A;  3N9P A;  4WW0 A;  5KX5 E;  4IL4 A;  3ABV A;  1KK7 A;  2NP9 A;  1SE7 A;  1G73 A;  2FJA A;  2ZMA A;  5AQH B;  4ISS A;  3JCF A;  3T1Y T;  4ZS3 A;  2FJD A;  3J7Y q;  4O4H E;  2QA7 A;  2UZ6 A;  3WTO A;  4M1P A;  5AFM B;  3C4X A;  2MTQ A;  3E08 A;  2UUC T;  4UXN B;  4P0B A;  2BJ0 A;  3AED A;  2JMH A;  5JDQ A;  2LHR A;  4DMW A;  1N33 T;  1ZOY A;  2PTF A;  2J47 A;  4PJM A;  4I50 E;  3KVB A;  5IHY A;  1V9D A;  1W09 A;  5H6Q B;  4ZI3 D;  3RC3 A;  2ODU A;  4PNI A;  2VAS A;  2ZJV A;  3AXJ A;  4DR7 T;  2XQ7 A;  2XQ8 A;  4ASK A;  2XZ6 A;  4CI2 B;  4B3R T;  3GUA A;  1T7S A;  4LF6 T;  2KWH A;  5AFH A;  2BDE A;  4AKH A;  4QAB A;  2V6Y A;  2XYS A;  4IST A;  3UU8 A;  2WSS V;  1DU2 A;  4EZH A;  1E7P A;  1T8B A;  4YHJ A;  4LFC T;  3AE1 A;  5FL1 A;  3CWZ B;  3MK7 C;  4P1N A;  2X0L B;  2XAS B;  2CMR A;  2Y8D A;  1HNZ T;  4TN7 B;  5EK3 A;  2OA5 A;  4V1A v;  5AQI B;  4U33 A;  2PGZ A;  3D0T A;  4TV9 E;  4WBN E;  4U7I A;  1IJ5 A;  4X62 T;  3LFM A;  2RP4 A;  2W66 A;  3RIF A;  3PUG A;  5AFJ A;  4MLK A;  2Q9Q C;  3LSV A;  3E0Z A;  4HWF A;  4J2C A;  4IE4 A;  4CI1 B;  3KV6 A;  3AEG A;  2JJ9 A;  3ZMU B;  2CRB A;  4IGU A;  3PDY A;  3IA3 A;  3WTH A;  4CN1 A;  4DV5 T;  1NEK A;  3CK6 A;  3AEE A;  3WTI A;  1KEY A;  3PMZ A;  3CVR A;  3U3I A;  4IE7 A;  4PJL A;  3KV5 A;  3AE2 A;  2PH9 A;  4IIJ E;  4UVC B;  3O4X E;  1EZ3 A;  1FJG T;  3Q5E A;  4DVD A;  1CUN A;  2LKG A;  1G8X A;  2WCA A;  3M65 A;  2WN9 A;  3QK6 A;  3H3A A;  1UGO A;  5HCM A;  4PJN A;  3ZMT B;  4EYY R;  4I55 E;  3VRA A;  5LBM A;  2VQE T;  3NRY A;  4AKL A;  2UUB T;  3WTM A;  4O4J E;  2F4V T;  2CA5 A;  3AEA A;  5FY0 A;  3C64 A;  1YW0 A;  4ZZB A;  2X67 A;  2BS4 A;  1HFA A;  5HEU A;  4DND A;  1KNR A;  1X79 A;  3PU3 A;  1IBK T;  4B5D A;  3J9X 1;  3HKC E;  3RPU A;  2VL8 A;  1VCT A;  4AFH A;  2BVM A;  5LMU T;  2H7V C;  5E0O A;  2WZH A;  3GA8 A;  1ZP0 A;  2UU9 T;  4UY2 A;  4H63 V;  1US7 B;  2V6Y B;  3L3P A;  3KIN B;  2BKO A;  2LHN A;  4QX7 B;  1S94 A;  4O4L E;  4PK4 A;  3I9Y A;  2KZ7 B;  3UFG A;  5L2L A;  2A72 A;  4EIW A;  5LJM A;  3WTL A;  5LXB A;  3OYZ A;  5AQS B;  2WWU A;  5JTG A;  2W62 A;  3ZT5 A;  3C98 B;  5HAX A;  2YN6 A;  4E7S A;  3FXD B;  2KLQ A;  2SPC A;  3PUY F;  2C5K T;  4DV7 T;  2KT9 A;  3ONX A;  4AKI A;  2X9Y A;  4DR5 T;  4JI3 T;  2LJL A;  3NWI A;  1XMQ T;  2VK9 A;  4JLE A;  2XQ5 A;  2NOX A;  3MAC A;  2X00 D;  4JI7 T;  5DQW A;  3U8N A;  5HXC A;  4LFA T;  4U7Y A;  2WS3 A;  5AIN A;  1Y64 B;  3MJX A;  3LJC A;  2JQK A;  4AQF A;  3RRW A;  4UF0 A;  1OWA A;  1XNR T;  4AQF C;  3L39 A;  1IBM T;  5ADX L;  2C5I T;  2W0G A;  2W63 A;  3NZP A;  3ZMS B;  3PUS A;  5LGU B;  3R6N A;  2W8F A;  3KDS E;  1MNE A;  4UM3 P;  4JUY A;  2Y54 A;  1W9R A;  3ZT6 A;  4ADZ A;  3RF1 A;  1MIW A;  4KBM B;  3OTO T;  2AXD S;  1CHU A;  5LHG B;  1XZY A;  4DV2 T;  3JC6 D;  2H3R A;  4WBO A;  3LG7 A;  2FJE A;  3MXZ A;  2UUA T;  2H7O A;  4JI0 T;  4CXY A;  4B3S T;  4KI0 F;  2YU2 A;  4AFT A;  3DP7 A;  5ABG A;  4B3M T;  3JAE A;  5FP3 A;  5EZY E;  4QXH B;  4KX6 A;  4H9Q C;  2JPF A;  1NAF A;  1VCS A;  5GON E;  3UUN A;  5HYA A;  4PJJ A;  2Y58 A;  3FBZ A;  2PJQ A;  4YXD A;  4PK6 A;  3U8K A;  2CCQ A;  2BG9 B;  1SA0 E;  5L3C B;  5AQL B;  3EAB A;  1U4Q A;  2V26 A;  3CX6 B;  2D0T A;  3Q5D A;  4JI6 T;  2YOE A;  1JNZ A;  3AEF A;  2N2N A;  2C5J A;  2BYS A;  4EV6 A;  5J5I A;  2CM0 A;  3UTK A;  1QSD A;  3JAF A;  3GMI A;  4H9R C;  1WYC A;  2DI4 A;  2XM1 A;  3PUA A;  4ZZC A;  3PJA A;  2HPJ A;  4CZZ B;  1BR4 A;  5JDG A;  2XUE A;  1WCR A;  5LOV E;  4QX8 B;  3BQK A;  2KXP B;  5HWX A;  2WWV A;  5HWY A;  5KDM C;  4C90 A;  1D0Z A;  5AQV B;  2BYN A;  2WDV A;  3C4W A;  3P4R A;  4N78 D;  5L4E A;  5LCY A;  5ABE A;  2IML A;  2WU5 A;  4KMC A;  1WRD A;  4CXW A;  2WU2 A;  2LEH A;  3AE7 A;  1IBL T;  5HXH A;  3WTK A;  1ZV4 X;  2Y6X A;  3SOL A;  4TX5 A;  2PFV A;  1WLX A;  5JDM A;  4H9N C;  2BYR A;  3T4M A;  3BQI A;  1FMV A;  4OHF A;  2EHO C;  2CLY B;  5HEO A;  1I6Z A;  2XQ9 A;  4U3C A;  5FXW A;  1W0B A;  2VKH A;  3VKH A;  4HFB A;  2XNU A;  3ZJ2 A;  3WI3 A;  5FL0 A;  4QKN A;  1HR0 T;  3TLT A;  5JH7 E;  3RIU C;  3I0O A;  4AKG A;  1J5W A;  4IDN A;  5LGT B;  2Y48 B;  3ZSS A;  2E9X C;  3TLS A;  4AIS A;  2ZM6 T;  4B6X A;  3AAE B;  2XSB A;  3GN5 A;  2VKJ A;  3EDU A;  2E9X A;  3PUX F;  4L5G A;  1UV6 A;  2K3W A;  3JAD A;  4QHO A;  2Q9Q D;  2XAH B;  4ZI7 E;  1HCI A;  2XHE B;  3N9Q A;  4LML A;  1GQE A;  4IT4 A;  3ZT7 A;  3ZCI A;  1YD8 G;  3KFW X;  4ZI2 C;  3QB5 A;  3ANW A;  3ZYL A;  2L9Q A;  3CX7 B;  5CFB A;  3HKD E;  2XY8 B;  2FBW A;  5LG3 A;  2XPK A;  4JI4 T;  1LVF A;  3ZN0 B;  2ODV A;  4UM1 A;  3KBT A;  4BA9 A;  2Y57 A;  3CKD A;  4QXB B;  1MIV A;  2XZE A;  4OFZ A;  3M3Z B;  3N9L A;  1IAP A;  5FVL A;  4X1I E;  4A5X A;  3VKG A;  4LF4 T;  4FRR A;  2WDQ A;  1OED A;  4XAX B;  1T98 A;  3AE3 A;  3LBX A;  4JBW F;  2D0U A;  2YKS A;  1HG2 A;  1I9B A;  2A2F X;  4AI6 A;  2K9A A;  2LSI A;  3QUJ A;  4KHP T;  3EAM A;  3IGQ A;  2V5D A;  5CJ5 A;  3UQ4 A;  4HFI A;  4ILB A;  5CO5 A;  3AE4 A;  4L9I A;  3ZJ1 A;  3MZK B;  2Q9Q B;  4NUU A;  3AE5 A;  3QOF A;  4IDO A;  3RYF E;  4EYU A;  4IDQ A;  4HWH A;  2XSA A;  3PTR B;  4NIQ A;  3UUX B;  4ANJ A;  4UEM A;  3TLV A;  3SWH A;  3NZQ A;  3FB2 A;  5C3J A;  2GK9 A;  3WAK A;  3C50 A;  4X1Y E;  3IF8 B;  3DTO A;  1SHZ C;  4Z90 A;  5AQR B;  1SUM B;  4U2Y A;  1YKE B;  4XBF B;  2NW8 A;  2V5C A;  4GYR A;  1OED C;  4EGW A;  1VOM A;  5J5F A;  2P9B A;  5BRX A;  2EHO D;  5HXS A;  3PEO A;  5FXV A;  4ZR6 A;  4WZX A;  4JI8 T;  2LOP A;  2XQ3 A;  2CLY C;  1WR6 A;  2OLT A;  2IDO B;  4UM3 S;  1E2A A;  5KXJ A;  2PBI A;  2FUP A;  2RA1 A;  2BG9 A;  2VL0 A;  5M4Y A;  1KNP A;  4IE5 A;  5LNK A;  4GOU A;  1KNZ A;  4CI3 B;  3ZMZ B;  2VWA A;  2VKD A;  4I43 B;  5KE4 A;  2HH7 A;  1YQ4 A;  4MFR A;  3UUB A;  4IRE A;  2CWO A;  2KIN B;  2V7M A;  2WB5 A;  4TWF A;  4D01 A;  1Z0P A;  3X1D A;  2VUR A;  3ZCJ A;  3TLU A;  1BR1 A;  5DAB A;  4HQP A;  4JEH B;  1HX1 B;  1ZHC A;  2LM2 A;  2ES0 A;  1HX8 A;  3F57 A;  4I0U A;  2KSR A;  4BAY B;  2BZB A;  3K3Q C;  4ZS2 A;  5EK4 A;  1YKH B;  2J1D G;  4YJ3 E;  4LF8 T;  1LVK A;  3VHL A;  3UU4 A;  4H9S E;  2QC1 B;  5JDH A;  2N9D A;  3U8L A;  2VVN A;  4F6R C;  2YU1 A;  4HWI B;  5AFL A;  3SRZ A;  3G06 A;  4IE6 A;  3GWH A;  2FJB A;  4TUY E;  4DR2 T;  2UXX B;  3N9N A;  1D0Y A;  3A5X A;  1BR0 A;  4CN6 A;  3ESL A;  3WTN A;  5CGM A;  5KZU A;  2ZM2 A;  2V1D B;  4L0R A;  4UM3 A;  2X9X A; 
#chains in the Genus database with same CATH homology
 5FJV A;  2Y58 A;  4NZB A;  4HFB A;  2XNU A;  2VL0 A;  2BG9 A;  5HCJ A;  2X00 A;  2YKS A;  2XQ5 A;  4F8H A;  4ZK4 A;  1I9B A;  4IL4 A;  3U8K A;  5BP0 A;  1UW6 A;  2WNC A;  3SIO A;  2X00 D;  2Y56 A;  2BG9 B;  3TLT A;  2YME A;  4A98 A;  2W8G A;  4ZZB A;  3EAM A;  3IGQ A;  5SYO A;  3EI0 A;  2WNJ A;  3UQ4 A;  4ALX A;  3TLW A;  5J5H A;  4HFI A;  5HEG A;  4ILB A;  2YOE A;  5HEU A;  5IUX A;  4QAA A;  5CO5 A;  3ZDH A;  4HFH A;  5KE4 A;  4B5D A;  3U8N A;  3UU3 A;  2UZ6 A;  2PGZ A;  3WTO A;  3TLS A;  5BW2 A;  3UUB A;  4COF A;  3RQU A;  3U8M A;  4IRE A;  4TWD A;  5AFM B;  2BYS A;  4QAC A;  2WZY A;  5AIN A;  1UV6 A;  5J5I A;  4BQT A;  4TWF A;  3JAD A;  3JAF A;  4D01 A;  2BYQ A;  4LMK A;  3C84 A;  4BFQ A;  3RIF A;  5JME A;  4AFH A;  3UU6 A;  2XNV A;  2WNL A;  2BJ0 A;  4LMJ A;  3TLU A;  4ZZC A;  5TVC A;  2XQ4 A;  4HFD A;  1OED E;  4TWH A;  4LML A;  4HQP A;  5AFJ A;  4XK9 A;  2M6B A;  3P50 A;  2M6I A;  2LM2 A;  3EHZ A;  3RQW A;  2XNT A;  3LSV A;  3RI5 A;  2LLY A;  4IL9 A;  3TLV A;  3C79 A;  3UQ7 A;  4Z91 A;  4HFE A;  2KSR A;  2W8F A;  4UY2 A;  2BG9 C;  3P4W A;  4UM3 P;  4TNW A;  3UU5 A;  4X5T A;  2Y54 A;  4PIR A;  5L4H A;  2YMD A;  5CFB A;  2XQ6 A;  2Y7Y A;  2C9T A;  5AFK A;  4XHE A;  5AFM A;  3WTH A;  2BG9 E;  5LG3 A;  3UU4 A;  4Z90 A;  4A97 A;  2QC1 B;  2BR7 A;  4ZJS A;  2ZJV A;  3WTI A;  3PMZ A;  4ILC A;  3U8L A;  3RIA A;  2ZJU A;  5J0Z A;  4UM1 A;  1UX2 A;  2BYN A;  2XQ7 A;  5L47 A;  2XQ8 A;  3WTJ A;  4ZRU A;  2XZ6 A;  2Y57 A;  4QH5 A;  5L4E A;  5AFL A;  2PH9 A;  3ZDG A;  3WTL A;  4QH4 A;  3RHW A;  5LXB A;  1OED C;  2XYT A;  3U8J A;  3GUA A;  5HEH A;  2LKG A;  3WTK A;  5J5F A;  4EZ1 A;  4AFT A;  5BRX A;  3SQ9 A;  4TNV A;  4AFG A;  5AFH A;  2XZ5 A;  5J5G A;  2BYP A;  4NPP A;  2WN9 A;  3PEO A;  4QAB A;  5AFN A;  4UXU A;  2BYR A;  4WV9 A;  4ZR6 A;  2YN6 A;  3SH1 A;  3T4M A;  2BR8 A;  3ZKR A;  3JAE A;  4ZK1 A;  5HCM A;  3WTN A;  2XYS A;  2XQ3 A;  5KZU A;  5HEO A;  1OED B;  4QH1 A;  3UU8 A;  3SQ6 A;  4ZJT A;  3WIP A;  4HFC A;  2XQ9 A;  4UM3 S;  4FRR A;  4ILA A;  4DBM A;  4UM3 A;  2LKH A;  2MAW A;  2XQA A;  3WTM A;  1OED A;  5HEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...