5HCJA

Cationic ligand-gated ion channel
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Proton-gated ion channel
publication title Sites of Anesthetic Inhibitory Action on a Cationic Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hcjA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hcjA01
1OEDE 3P50A 5JMEA 2XYSA 4QH1A 2M6IA 2XZ6A 4QACA 5BP0A 2X00D 2WZYA 3IGQA 2KSRA 3EAMA 5AINA 2YKSA 5J5HA 3RI5A 5AFMB 4Z90A 5KZUA 4QH4A 4AFTA 5AFJA 3WTJA 2XQ5A 3SIOA 5SYOA 3U8LA 2XQ6A 3LSVA 3WIPA 5AFHA 4UM3S 2XNVA 4BQTA 2BYSA 2Y56A 3U8MA 5BRXA 2BJ0A 4B5DA 1UW6A 5IUXA 2BR8A 3ZDGA 2XQ4A 3TLSA 4AFGA 2QC1B 5L47A 4TWHA 3UU3A 4QABA 4ILBA 3WTNA 2ZJVA 4ZRUA 2YMEA 3PMZA 2LKHA 2BG9C 4HFHA 5J0ZA 3TLUA 3TLWA 1OEDA 3T4MA 4XK9A 4D01A 2XNUA 4IL4A 2LKGA 3RQUA 3PEOA 4ALXA 4F8HA 3WTHA 4ZR6A 5CO5A 3WTKA 2PH9A 4ZK1A 2YMDA 3SQ9A 2Y54A 1UX2A 1OEDB 4PIRA 3C79A 2LLYA 2WNJA 3WTIA 3UU6A 4NPPA 4QH5A 1UV6A 3GUAA 3UU4A 2BR7A 3RQWA 4UM3P 4QAAA 4ZK4A 4TNVA 4IREA 2ZJUA 4FRRA 2Y58A 2VL0A 5LG3A 5HCJA 4HFCA 5HCMA 3JAEA 3RIFA 3RHWA 3UU8A 2BYPA 4IL9A 5LXBA 2YOEA 4COFA 2BYQA 2WNCA 5AFNA 4HFDA 3SQ6A 5HEGA 4WV9A 3EHZA 5HEUA 5HEJA 4ILCA 5CFBA 2WN9A 3ZDHA 2MAWA 2Y7YA 4HFIA 2W8GA 2BYRA 2XZ5A 4ZJSA 4BFQA 3UQ4A 5KE4A 2PGZA 4A97A 4TWDA 1I9BA 3SH1A 4UY2A 4HFEA 4LMJA 2LM2A 3P4WA 4HFBA 4LMLA 2C9TA 2BYNA 5J5FA 4UM3A 3WTOA 2M6BA 4NZBA 4TNWA 5AFKA 3WTMA 2XNTA 4HQPA 2X00A 4ZZCA 2XYTA 3UU5A 3U8NA 3TLVA 4A98A 5L4EA 5TVCA 3RIAA 3WTLA 2XQ3A 5FJVA 2BG9E 2XQ8A 3JAFA 2XQ9A 3TLTA 2BG9A 1OEDC 2Y57A 4AFHA 4UM1A 5HEHA 3C84A 4X5TA 2W8FA 3JADA 3UQ7A 5AFLA 2WNLA 3EI0A 2XQAA 4ZZBA 4EZ1A 4ZJTA 4LMKA 2BG9B 4Z91A 5HEOA 2UZ6A 5L4HA 4ILAA 4XHEA 3U8JA 3U8KA 5J5IA 5J5GA 4DBMA 2YN6A 4UXUA 5BW2A 3ZKRA 5AFMA 4TWFA 3UUBA 2XQ7A
chains in the Genus database with same CATH superfamily
2OLTA 4XBFB 5LMUT 1V9DA 1KNZA 3IHRA 4ISTA 5HXCA 3EAMA 2MBGA 5AFMB 1HX8A 2VKHA 2PG8A 1US7B 3ZMTB 3N2OA 3G06A 2QVAA 4UM3S 3DJBA 5F3JA 2HH7A 4AISA 4PK4A 2BDEA 4AFGA 1HNXT 1D0YA 5AQKB 1D1CA 2XAFB 3PMZA 5J0ZA 4GKKT 1VOMA 2HPJA 3H3AA 3MZKB 4ALXA 3OBVE 1SA0E 2XAHB 4U31A 5FNVE 3VRAA 4ZI2D 3UFEA 5AQPB 1XMQT 3PUQA 3K1SA 3RRCA 3P7IA 2B1EA 3ZC1A 5LMNT 4EZHA 4YTNA 4H9PC 3MKDA 3LK42 3O1JA 5HEJA 2WN9A 4WZXA 3FZLB 4DR4T 3ANWB 1UX5A 2D5UA 3WAJA 1IZNB 4NZBA 1FMVA 5DQVA 1MIVA 2VASA 5LXTE 3VKGA 3JAFA 3OKQA 3AEGA 2R6GF 2YU2A 4UV8B 3ZT5A 5L3EB 1Y01A 4CXYA 1T98A 3EABA 3EI0A 1UURA 2Q9QC 2UU9T 3AEAA 3IA3A 2PFVA 2XJ7A 4UF0B 4TWFA 3P50A 2LSKA 4YJ3E 3LK2B 3MJXA 3BQKA 2MYSA 4H9QC 4ERRA 3WTJA 2XQ5A 3SIOA 3AXJA 4O4LE 4BQTA 3AE4A 1UW6A 2HPLA 5FP3A 2WDRA 4LF7T 3TLWA 3UUNA 3P4SA 3NRYA 1IJ6A 4XZCA 3UT5E 3F57A 3K3NA 2XZEA 2E9XC 3VR8A 2VKDA 3L39A 2ZJUA 5FVKA 5AQHB 5JVDE 5LBMA 3UU8A 2QA7A 1I94T 2YOEA 4J2CA 4WV9A 4EYUA 4UY2A 1H7CA 4G2AA 2M6BA 3PUGA 3UUXB 2XNTA 1YXRA 2E5VA 4I4TE 4A98A 4E7ZA 3C50A 2XQ3A 2BG9E 3OJAA 3LJCA 4JI3T 3D0TA 2W8FA 2WNLA 2A2FX 4I43B 1M62A 3ZPOA 1UGOA 1HTJF 3UUBA 1N33T 4CN1A 2WU2A 2W61A 2K48A 4DV1T 4EEDA 3ZCJA 5SYOA 2NOXA 2EHOD 3LSVA 2WBLA 3O9XA 2ZM0A 2MTQA 1IBKT 4B5DA 4JEUB 2YEVC 3AAEB 5EK3A 4B3ST 4NUUA 2X9HA 3RGLA 4AKHA 1W9RA 2D0UA 3PEOA 4F8HA 1XDPA 2YDQA 4U3CA 4PNIA 3BQLA 3Q9DA 3MXZA 4KHPT 2V7KA 3FXEB 2CWYA 3PUWF 3E22E 3GUAA 3UU4A 1LVKA 1VCTA 3I9WA 4DBRA 5AQTB 5HCMA 3KINB 2C5KT 1GQEA 4O4IE 3AVSA 3JCFA 4CQIA 2FJEA 2ZLYA 2BYRA 3IEEA 3K8PC 2PGZA 3OPCA 2WQYA 4HFBA 2N2NA 2KLQA 4IE4A 4MLKA 4U2ZA 3FBZA 3SFEA 1WYCA 1LRZA 2G0UA 5F5WA 3WAKA 2IDOB 4ZI3D 4GYRA 5A1LA 5HEOA 3U8KA 3BK9A 2IIUA 1MMAA 5HXSA 3J7Yq 5HWXA 2IC9A 3T1HT 5AFMA 4QKNA 4AKIA 4LFAT 3Q2MA 4HE8A 4DR2T 4WBNE 4TX5A 4KMCA 4EIWA 3RPUA 3LK3B 3ONXA 5CB4E 3B57A 2Y56A 3ZYMA 4EAHA 5IUXA 3ZCIA 3ZDGA 2FUPA 4ZI2C 2E5LT 1MIWA 4IL4A 3SWHA 2VB6A 2Y54A 4JYAT 4PJNA 4FRRA 5JDMA 3KV4A 2JQQA 3ANWA 2VQFT 2CCQA 2X0HA 3MK7C 4WYVA 2W8GA 4WNKA 1E7PA 5FL0A 4OHFA 4B3MT 2XSAA 3P4WA 4LMLA 4U7IA 4X62T 3WTOA 3CK6A 1T8BA 1IJ5A 1WR0A 3N9QA 2W00A 2CXDA 3PUZF 2CBJA 3F31A 3LFMA 4AQFC 3HKBE 5HEHA 4PK5A 3L8RA 4Z91A 3L3PA 2V1DB 2V7IA 2BKPA 2Y7YA 4ZXLA 4DV4T 2IC6A 4X64T 2FJDA 3M65A 4EOZB 2X00D 3AECA 5J5HA 2OV9A 3QB5K 3ZJ1A 1KEYA 2BVLA 3GWHA 4YHJA 4BAYB 2XQ4A 4ZS2A 3CVRA 4UXNB 3AE6A 4ZS3A 5AFUL 4QABA 2WDQA 3WTNA 3LG7A 2MPKA 4DR7T 1WYBA 3AEEA 3N9LA 3PUSA 3ETUA 4G63A 3UTKA 3CQXC 1OEDB 4KX6A 3O1HA 4LFCT 4EZ4A 1N34T 4X1IE 2BS4A 4YSXA 2WB5A 5JDLA 4COFA 1MMNA 4DR6T 3BQIA 5CFBA 2BZBA 4QWNB 3DP7A 3TKLB 1WFDA 2KNDA 5L3CB 4H9RC 4UM3A 3NZQA 2NW9A 2CHOA 4CN4A 4P0BA 1L0VA 5LBQB 2E8IA 4X66T 4OYJA 2Q9QB 5LNKA 2A3DA 3U3IA 4DV2T 4O8SA 4DBMA 5BW2A 2AXDS 2LM2A 3LBXB 5IYZE 2DNXA 4UV9B 2EHOC 1W09A 4YFSA 2XASB 1EZ3A 5JR9C 3FZHB 1YKEB 2CMRA 2NW8A 3U8LA 1JNRA 4DR3T 2BS2A 2DWKA 1HCIA 5L47A 5C2TA 2CXLA 3QC9A 4HGAA 2Y48B 2E9XB 1J5ET 5ABFB 1SUMB 4JLEA 5L3BB 3I1AA 2BS3A 3WTHA 4U74A 3CQGB 4HWFA 3AAAB 4DV5T 2YK0A 2KINB 4KUMB 2WNJA 3PDYA 3WTIA 3JC6D 4QAAA 3ZMVB 5LA6E 2NR4A 4H9OC 1YQ4A 3CX7B 4MFRA 2WS3A 3RIUC 3ZYKA 4UVBB 2WWUA 3N9NA 4TNWA 3ZEFB 4ZEYA 4JEHB 2LJLA 4CI2B 5JDQA 3EDVA 3AEDA 1OEDC 2X68A 5M4YA 4GYSA 2XPKA 2XUEA 3IF8B 3NWIA 4PJMA 5J5IA 3N9OA 5CGMA 3PU8A 1T7SA 2XQ7A 1CUNA 3VKHA 3HKEE 5JMEA 3FB2A 2UXBT 5AQVB 4QACA 3ZMUB 1XDOA 4GOUA 5AQRB 2N1GA 2JQKA 5AFJA 2C0SA 4HEAA 2BYSA 3O4XE 3NBXX 5LJMA 5BRXA 5DQWA 2BR8A 3UU3A 3AE1A 4X1KE 4YT0A 2WM9A 1YKHB 4HKAA 1ZP0A 2RA1A 1FEWA 2QGSA 3WTKA 5FYMA 3KV9A 2XHEB 1N36T 1UV6A 4UM3P 1NAFA 3OVUA 4LF6T 1UX4A 4QXBB 1U5PA 3SQ6A 2XAGB 5HEUA 5LCYA 2V6YB 3UQ4A 1IBMT 4TWDA 3SH1A 4HTEA 3ABVA 1MMGA 3ZSSA 5GONE 4FI5A 3U8NA 1Z0PA 1XMOT 3W15B 5TVCA 3HKDE 4MBQA 3N5LA 2WP9A 4TZ4C 4IIJE 1D1AA 2VKJA 2W62A 3PU3A 1QLBA 3QK6A 5FY0A 3CQCB 1NEKA 2RP4A 4DNDA 4YHHT 1BR4A 4ILAA 3U8JA 4Q25A 2D0TA 1E2AA 2K5BB 1W0AA 3ZKRA 3K3QC 4IDOA 2M6IA 1FMWA 4PJLA 4DVDA 4DR1T 1XNQT 3KBUA 1QSDA 4EEBA 5ETWA 4IDPA 3RYFE 3A8YC 2VK9A 2BJ0A 4DBQA 4YSZA 1BR0A 3ZC0A 4ZHQE 2IMLA 3TLUA 1OEDA 1YD8G 4AXPA 4QXCB 3J9X1 2WSSV 4EB6E 3X1DA 3F2EA 4ASKA 5JREA 2H88A 2CRBA 3AEFA 2ACZA 2RPAA 3GN5B 3JAEA 4UELA 4DV3T 2AE9A 1FJGT 3EHZA 3ZDHA 5KMGP 3FBLA 4HFIA 4BFQA 5J2TE 5L2LA 2VL8A 2CHNA 1KFYA 2Q9QA 2UXDT 1T72A 5AFKA 3E08A 4ADZA 2A9UA 2BKOA 4DUYT 5AQOB 4I50E 4X65T 1ZEEA 3Q5EA 4BJMA 3U78A 1W0BA 5AFLA 3JADA 3R6NA 1UK5A 4GK0E 5FKYA 3LBXA 3CX8B 5EZYE 4KBMB 4JI6T 2I59A 1DU2A 5AQQB 5CA0E 2LT3A 2HN1A 1OEDE 3RYIE 4I55E 2XYSA 3R84B 2X0YA 2KSRA 4YSYA 5HXRA 5KZUA 3AEBA 5ABGA 3A7MA 3SRZA 5AQUB 4L9IA 2E9XA 4JV5T 2V5DA 5ABFA 2B76A 2W4XA 2LHNA 4DO0A 4TWHA 4WW0A 3H3MA 2CE7A 3KDSE 4H63V 2DCFA 1FIOA 1WR6A 3JC6C 2Y6XA 4QX8B 4ZOLE 4GIWA 2WDVA 1G8XA 2SPCA 1D0ZA 2UUAT 1HG5A 1UCUA 3UU6A 4JI1T 4AI6A 5E0OA 2K24A 3RIFA 2JJ9A 4IE7A 4ILCA 2LSYA 3PUAA 4B3TT 4H9SE 5FMNA 1I9BA 1XNRT 1MNDA 3P4PA 5FY1A 2N9DA 4Z8XA 3VU7H 4EGWA 5LGNB 2W0GA 3ZLIA 1KNPA 4CXXA 3MA9A 2Y8DA 4N78D 2FJBA 2OA5A 5JRCB 2QYWA 4XAXB 2XQ8A 2NP9A 4JI2T 3KBTA 4ZZBA 1OWAA 2C5JA 3AA0B 2BG9B 4TV9E 2EHOB 5JR9B 2ACXA 4AKRB 5JH7E 2J4GA 2BKNA 3PUXF 4L0RA 3HR0A 3EVYA 3NRXA 5BP0A 3RLFF 5AINA 3C4ZA 5LYJE 4KI0F 3PE0A 3ZT7A 4UF0A 1HF8A 2P9BA 3WIPA 2XNVA 2CWOA 4NXMT 2LM9A 4P1NA 2QC1B 4JI5T 2YDRA 1HS7A 3QB5A 2K3WA 2XY8B 2YU1A 2Z6EA 3RQUA 5LHIB 2J47A 3N9MA 4ZR6A 3WI3A 5CO5A 3ZT6A 2H7OA 1JNZA 1QUUA 3VRBA 3HKCE 3AE2A 4HWCA 5LP6E 3C98B 2DHRA 2X9WA 4ZK4A 3NVOA 2V6YA 4MHCA 3KFWX 2Y58A 4CN6A 4C90A 4EXTA 1G73A 1ZOYA 2V7LA 5LXBA 2JPFA 2ODVA 5HEGA 4ZJSA 4YTPA 4TN7B 2UUBT 4LF8T 4OX9T 3PJAA 5L4EA 4CZZB 2XQ9A 4O2AE 5JTGA 3C84A 5ADXL 4P0AA 2JRKA 3N2GE 3CX6B 5LJNA 2WU5A 2WZHA 5L4HA 3AE3A 4AKGA 4PAGA 5KDMC 3GMIA 2BBHA 3ZN0B 3RRWA 5JDGA 5HWYA 3AE7A 4QH1A 2WZYA 5L3DB 2CA5A 2YKSA 1LKXA 3RI5A 3ZMZB 5L3GB 4QH4A 3RKOA 5BR8T 3ONJA 3CMLA 4B3RT 1XZYA 1R8IA 3FHNA 4PFPA 5AQSB 3M3ZB 2X51A 2E2AA 2LRKA 5FXZA 1HX1B 4ZRUA 4CI3B 2BG9C 3L09A 3CWZB 5LG4A 4DV7T 4B6XA 3AE9A 4PW8A 3QOFA 4FJOA 3C4XA 3GA8A 2XQYA 2H7VC 2YMDA 4TUYE 3GN5A 3Q5DA 3FZFB 4UVCB 3ZSTA 5LG3A 2X9YA 3C51A 5HCJA 1SE7A 4QHOA 3RHWA 2CLYC 2WNCA 4HFDA 2FBWA 4AQFA 3N9PA 2MAWA 2X0LB 4A97A 5AQGB 1J5WA 2BYNA 3ZMSB 5AQLB 1MIYA 4ZZCA 3ONLC 3SFDA 3V5SA 4YJ2E 3Q5XA 4UIGA 1AJ3A 3RX6A 3RC8A 4CXWA 3UQ7A 5LHGB 2LSIA 2XQAA 4EZ1A 2BVMA 1MMDA 5JDNA 3RF1A 2NTXA 3ESLA 4O4JE 3FXDB 4ZI3C 1KNRA 5FL1A 5EK4A 4CI1B 4A56A 3U8MA 2IUBA 4BJNA 4F6RC 3UULA 2XAQB 2VVNA 3PJAJ 3AA7B 3HI2A 2LEHA 2ZM6T 1VRBA 4EV6A 2PTFA 1SHZC 3SS1A 5AQMB 2XNUA 2LKGA 5LGTB 3OTOT 4AQYT 2L8KA 2PH9A 2DLRA 1UX2A 2VQET 4A5XA 3C79A 3AE8A 4NPPA 4QH5A 2BR7A 3RQWA 4LFBT 1D0XA 1WCRA 4U72A 2XM2A 3K3OA 3N2KE 5LHHB 4UEMA 5KE4A 4HFEA 5JRCA 2CBIA 3QUJA 1N32T 1E1HB 2GK9A 3WTMA 3P8CD 1X79A 3KVBA 3TLVA 3VHLA 1KK7A 4JBWF 3RYCE 4YTMA 2ZM2A 1X9BA 2BG9A 4IT4A 2IHR1 3KVAA 4DV6T 4O2BE 2F4VT 2EHOA 2Y57A 1WRDA 4UM1A 5JR9A 4EYYR 3ZYLA 4PJJA 4XHEA 4HWHA 1B7TA 5J5GA 1Z8UA 4ISSA 4QXHB 1S94A 3FZKB 3B5MA 2WZIA 1M7KA 3H37A 3IGQA 2WMOA 2WY2A 2UUCT 2PJQA 4KP3C 2LSGA 4DMVA 4JI0T 1NWMX 4AIUA 3AA1B 4NUVA 4H63H 3Q5WA 2ES0A 3AAIA 3RC3A 1O3XA 4M1PA 2YMEA 3DTOA 4X1YE 3B13A 3KV5A 3RIUA 1XWMA 4ZK1A 1IAPA 2LLYA 4JUYA 2H3RA 2LE8A 5FVLA 4TNVA 2WAUA 2KT9A 1U4QA 4IL9A 2JIWA 4E7SA 2K9AA 1IBLT 2ZMAA 5J5FA 3HL6A 4DIDB 5AQNB 2XYTA 4LF4T 2HHHT 3RIAA 5FY7A 5FJVA 1YQ3A 5EK2A 5L3FB 2V7MA 3V5UA 3KV6A 1HNZT 4IE5A 3CIRA 5FXXA 5AQIB 4UXUA 1LVFA 5DABA 4L5GA 4UR9A 2UXNB 4U7YA 2UXXB 2PBIA 4Z90A 5ABHA 5HAXA 2L3LA 2W67A 2XQ6A 1WLXA 2V5CA 5DJQC 3ETVA 5IHYA 2KXPB 2LKHA 1J1JA 2KZ7B 4D01A 2X66A 2I6HA 4JI4T 4HN9A 2XSBA 2D9DA 2KWIB 4IE6A 2D2SA 4PIRA 2JQ9A 4HFVA 1HNWT 4HFCA 4OYKA 4ZI7E 1HG2A 5LGUB 2MOZA 4IDQA 2LRLA 2FJAA 1UUSA 4DR5T 2CEAA 2X9XA 1ZKEA 3T8OA 2A72A 2J1DG 2X00A 4HQPA 3PV0F 3WTLA 3C4WA 5IWAT 5FXWA 5HYAA 4LF9T 2XTLA 3TLTA 2NTYA 1HFAA 4X5TA 4UVAB 5LOVE 4OFZA 2YDSA 2UZ6A 2YN6A 3QNUA 2LHRA 2X67A 2W63A 3PURA 2IW5B 4IHJE 4NXNT 4O4HE 3RH3A 3VR9A 2WWVA 2Q9QD 2J62A 2XZ6A 5FXVA 2W66A 2ZM8A 1YW0A 3OYXA 2BBJA 3SOLA 4PFOA 4AFTA 2QRXA 2DL1A 3T1YT 1CHUA 4NIQA 2LSJA 4DV0T 5KX5E 2IAKA 4ILBA 3AXJB 4U2YA 2ZJVA 2W2UA 2JMHA 4XK9A 3FZMB 4OK0A 1BR2A 4P09A 2V26A 2CXFA 2VURA 5JDHA 3SQ9A 2CLYB 3PTRB 5C8YE 2M67A 5HXHA 3AA6B 2LOSA 3C64A 2V6XA 3AVRA 4IREA 2XM1A 2NWBA 4IDZA 2E9XD 2CPTA 1KF6A 4MALA 5BMVE 2BYQA 5AFNA 4IDNA 3UFGA 5AQFB 1S35A 2XZ5A 4HWIB 3E0ZA 2I0MA 2DWGA 3S4UA 3UUMA 2C9TA 2NW7A 4YLHA 2VWAA 5JQGE 4JI8T 5TAOA 3UU5A 5J2UE 2KWHA 2UXCT 2JQHA 4IE0A 4X20E 4AQGA 4V1Av 5H6RB 3A5XA 3O1IA 4LMKA 3IBPA 1NENA 2XAJB 3I9YA 4YXDA 3ZN1B 3NKZA 4IGUA 4PK6A 2WMNA 2HN2A 2C5IT 3MACA 3RYHE 4I0UA 3P4QA 1Y64B 4H9NC 5AQJB 2KMFA 5HXEA 3EDUA 5AFHA 5CA1E 1OXZA 3TLSA 4GKJT 2L9QA 3AE5A 4LF5T 4GK5E 4HFHA 4U33A 1MNEA 3T4MA 2V8SV 5J1GA 5F8PA 4C91A 4K0UA 1ZV4X 2H89A 2YINA 3HA4A 4DUZT 4QX7B 5CJ5A 3EUHA 3AB3B 2VL0A 3PUYF 3I0OA 5JDFA 4ANJA 1VCSA 4YY3T 2BYPA 2V7JA 4ILUA 4AKLA 3I0QA 4TV8E 3RKGA 4K0KT 4HWDA 4LMJA 4WBOA 3OYZA 4JI7T 3LDQB 2VKOA 4DMWA 2CM0A 1BR1A 2ODUA 5KXJA 3CKDA 5C3JA 5LB7B 2LOPA 3P4RA 1HR0T 2VVSA 3CPZA 4AFHA 3PUVF 3ZJ2A 1D1BA 1ZHCA 2JMKA 4KHZF 5ABEA 4ZJTA 3NZPA 1I6ZA 2DI4A 2WCAA 5H6QB 4BA9A
chains in the Genus database with same CATH topology
1OEDE 3P50A 5JMEA 2XYSA 4QH1A 2M6IA 2XZ6A 4QACA 5BP0A 2X00D 2WZYA 3IGQA 2KSRA 3EAMA 5AINA 2YKSA 5J5HA 3RI5A 5AFMB 4Z90A 5KZUA 4QH4A 4AFTA 5AFJA 3WTJA 2XQ5A 3SIOA 5SYOA 3U8LA 2XQ6A 3LSVA 3WIPA 5AFHA 4UM3S 2XNVA 4BQTA 2BYSA 2Y56A 3U8MA 5BRXA 2BJ0A 4B5DA 1UW6A 5IUXA 2BR8A 3ZDGA 2XQ4A 3TLSA 4AFGA 2QC1B 5L47A 4TWHA 3UU3A 4QABA 4ILBA 3WTNA 2ZJVA 4ZRUA 2YMEA 3PMZA 2LKHA 2BG9C 4HFHA 5J0ZA 3TLUA 3TLWA 1OEDA 3T4MA 4XK9A 4D01A 2XNUA 4IL4A 2LKGA 3RQUA 3PEOA 4ALXA 4F8HA 3WTHA 4ZR6A 5CO5A 3WTKA 2PH9A 4ZK1A 2YMDA 3SQ9A 2Y54A 1UX2A 1OEDB 4PIRA 3C79A 2LLYA 2WNJA 3WTIA 3UU6A 4NPPA 4QH5A 1UV6A 3GUAA 3UU4A 2BR7A 3RQWA 4UM3P 4QAAA 4ZK4A 4TNVA 4IREA 2ZJUA 4FRRA 2Y58A 2VL0A 5LG3A 5HCJA 4HFCA 5HCMA 3JAEA 3RIFA 3RHWA 3UU8A 2BYPA 4IL9A 5LXBA 2YOEA 4COFA 2BYQA 2WNCA 5AFNA 4HFDA 3SQ6A 5HEGA 4WV9A 3EHZA 5HEUA 5HEJA 4ILCA 5CFBA 2WN9A 3ZDHA 2MAWA 2Y7YA 4HFIA 2W8GA 2BYRA 2XZ5A 4ZJSA 4BFQA 3UQ4A 5KE4A 2PGZA 4A97A 4TWDA 1I9BA 3SH1A 4UY2A 4HFEA 4LMJA 2LM2A 3P4WA 4HFBA 4LMLA 2C9TA 2BYNA 5J5FA 4UM3A 3WTOA 2M6BA 4NZBA 4TNWA 5AFKA 3WTMA 2XNTA 4HQPA 2X00A 4ZZCA 2XYTA 3UU5A 3U8NA 3TLVA 4A98A 5L4EA 5TVCA 3RIAA 3WTLA 2XQ3A 5FJVA 2BG9E 2XQ8A 3JAFA 2XQ9A 3TLTA 2BG9A 1OEDC 2Y57A 4AFHA 4UM1A 5HEHA 3C84A 4X5TA 2W8FA 3JADA 3UQ7A 5AFLA 2WNLA 3EI0A 2XQAA 4ZZBA 4EZ1A 4ZJTA 4LMKA 2BG9B 4Z91A 5HEOA 2UZ6A 5L4HA 4ILAA 4XHEA 3U8JA 3U8KA 5J5IA 5J5GA 4DBMA 2YN6A 4UXUA 5BW2A 3ZKRA 5AFMA 4TWFA 3UUBA 2XQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OED E;  3P50 A;  5JME A;  2XYS A;  4QH1 A;  2M6I A;  2XZ6 A;  4QAC A;  5BP0 A;  2X00 D;  2WZY A;  3IGQ A;  2KSR A;  3EAM A;  5AIN A;  2YKS A;  5J5H A;  3RI5 A;  5AFM B;  4Z90 A;  5KZU A;  4QH4 A;  4AFT A;  5AFJ A;  3WTJ A;  2XQ5 A;  3SIO A;  5SYO A;  3U8L A;  2XQ6 A;  3LSV A;  3WIP A;  5AFH A;  4UM3 S;  2XNV A;  4BQT A;  2BYS A;  2Y56 A;  3U8M A;  5BRX A;  2BJ0 A;  4B5D A;  1UW6 A;  5IUX A;  2BR8 A;  3ZDG A;  2XQ4 A;  3TLS A;  4AFG A;  2QC1 B;  5L47 A;  4TWH A;  3UU3 A;  4QAB A;  4ILB A;  3WTN A;  2ZJV A;  4ZRU A;  2YME A;  3PMZ A;  2LKH A;  2BG9 C;  4HFH A;  5J0Z A;  3TLU A;  3TLW A;  1OED A;  3T4M A;  4XK9 A;  4D01 A;  2XNU A;  4IL4 A;  2LKG A;  3RQU A;  3PEO A;  4ALX A;  4F8H A;  3WTH A;  4ZR6 A;  5CO5 A;  3WTK A;  2PH9 A;  4ZK1 A;  2YMD A;  3SQ9 A;  2Y54 A;  1UX2 A;  1OED B;  4PIR A;  3C79 A;  2LLY A;  2WNJ A;  3WTI A;  3UU6 A;  4NPP A;  4QH5 A;  1UV6 A;  3GUA A;  3UU4 A;  2BR7 A;  3RQW A;  4UM3 P;  4QAA A;  4ZK4 A;  4TNV A;  4IRE A;  2ZJU A;  4FRR A;  2Y58 A;  2VL0 A;  5LG3 A;  5HCJ A;  4HFC A;  5HCM A;  3JAE A;  3RIF A;  3RHW A;  3UU8 A;  2BYP A;  4IL9 A;  5LXB A;  2YOE A;  4COF A;  2BYQ A;  2WNC A;  5AFN A;  4HFD A;  3SQ6 A;  5HEG A;  4WV9 A;  3EHZ A;  5HEU A;  5HEJ A;  4ILC A;  5CFB A;  2WN9 A;  3ZDH A;  2MAW A;  2Y7Y A;  4HFI A;  2W8G A;  2BYR A;  2XZ5 A;  4ZJS A;  4BFQ A;  3UQ4 A;  5KE4 A;  2PGZ A;  4A97 A;  4TWD A;  1I9B A;  3SH1 A;  4UY2 A;  4HFE A;  4LMJ A;  2LM2 A;  3P4W A;  4HFB A;  4LML A;  2C9T A;  2BYN A;  5J5F A;  4UM3 A;  3WTO A;  2M6B A;  4NZB A;  4TNW A;  5AFK A;  3WTM A;  2XNT A;  4HQP A;  2X00 A;  4ZZC A;  2XYT A;  3UU5 A;  3U8N A;  3TLV A;  4A98 A;  5L4E A;  5TVC A;  3RIA A;  3WTL A;  2XQ3 A;  5FJV A;  2BG9 E;  2XQ8 A;  3JAF A;  2XQ9 A;  3TLT A;  2BG9 A;  1OED C;  2Y57 A;  4AFH A;  4UM1 A;  5HEH A;  3C84 A;  4X5T A;  2W8F A;  3JAD A;  3UQ7 A;  5AFL A;  2WNL A;  3EI0 A;  2XQA A;  4ZZB A;  4EZ1 A;  4ZJT A;  4LMK A;  2BG9 B;  4Z91 A;  5HEO A;  2UZ6 A;  5L4H A;  4ILA A;  4XHE A;  3U8J A;  3U8K A;  5J5I A;  5J5G A;  4DBM A;  2YN6 A;  4UXU A;  5BW2 A;  3ZKR A;  5AFM A;  4TWF A;  3UUB A;  2XQ7 A; 
#chains in the Genus database with same CATH topology
 2OLT A;  4XBF B;  5LMU T;  1V9D A;  1KNZ A;  3IHR A;  4IST A;  5HXC A;  3EAM A;  2MBG A;  5AFM B;  1HX8 A;  2VKH A;  2PG8 A;  1US7 B;  3ZMT B;  3N2O A;  3G06 A;  2QVA A;  4UM3 S;  3DJB A;  5F3J A;  2HH7 A;  4AIS A;  4PK4 A;  2BDE A;  4AFG A;  1HNX T;  1D0Y A;  5AQK B;  1D1C A;  2XAF B;  3PMZ A;  5J0Z A;  4GKK T;  1VOM A;  2HPJ A;  3H3A A;  3MZK B;  4ALX A;  3OBV E;  1SA0 E;  2XAH B;  4U31 A;  5FNV E;  3VRA A;  4ZI2 D;  3UFE A;  5AQP B;  1XMQ T;  3PUQ A;  3K1S A;  3RRC A;  3P7I A;  2B1E A;  3ZC1 A;  5LMN T;  4EZH A;  4YTN A;  4H9P C;  3MKD A;  3LK4 2;  3O1J A;  5HEJ A;  2WN9 A;  4WZX A;  3FZL B;  4DR4 T;  3ANW B;  1UX5 A;  2D5U A;  3WAJ A;  1IZN B;  4NZB A;  1FMV A;  5DQV A;  1MIV A;  2VAS A;  5LXT E;  3VKG A;  3JAF A;  3OKQ A;  3AEG A;  2R6G F;  2YU2 A;  4UV8 B;  3ZT5 A;  5L3E B;  1Y01 A;  4CXY A;  1T98 A;  3EAB A;  3EI0 A;  1UUR A;  2Q9Q C;  2UU9 T;  3AEA A;  3IA3 A;  2PFV A;  2XJ7 A;  4UF0 B;  4TWF A;  3P50 A;  2LSK A;  4YJ3 E;  3LK2 B;  3MJX A;  3BQK A;  2MYS A;  4H9Q C;  4ERR A;  3WTJ A;  2XQ5 A;  3SIO A;  3AXJ A;  4O4L E;  4BQT A;  3AE4 A;  1UW6 A;  2HPL A;  5FP3 A;  2WDR A;  4LF7 T;  3TLW A;  3UUN A;  3P4S A;  3NRY A;  1IJ6 A;  4XZC A;  3UT5 E;  3F57 A;  3K3N A;  2XZE A;  2E9X C;  3VR8 A;  2VKD A;  3L39 A;  2ZJU A;  5FVK A;  5AQH B;  5JVD E;  5LBM A;  3UU8 A;  2QA7 A;  1I94 T;  2YOE A;  4J2C A;  4WV9 A;  4EYU A;  4UY2 A;  1H7C A;  4G2A A;  2M6B A;  3PUG A;  3UUX B;  2XNT A;  1YXR A;  2E5V A;  4I4T E;  4A98 A;  4E7Z A;  3C50 A;  2XQ3 A;  2BG9 E;  3OJA A;  3LJC A;  4JI3 T;  3D0T A;  2W8F A;  2WNL A;  2A2F X;  4I43 B;  1M62 A;  3ZPO A;  1UGO A;  1HTJ F;  3UUB A;  1N33 T;  4CN1 A;  2WU2 A;  2W61 A;  2K48 A;  4DV1 T;  4EED A;  3ZCJ A;  5SYO A;  2NOX A;  2EHO D;  3LSV A;  2WBL A;  3O9X A;  2ZM0 A;  2MTQ A;  1IBK T;  4B5D A;  4JEU B;  2YEV C;  3AAE B;  5EK3 A;  4B3S T;  4NUU A;  2X9H A;  3RGL A;  4AKH A;  1W9R A;  2D0U A;  3PEO A;  4F8H A;  1XDP A;  2YDQ A;  4U3C A;  4PNI A;  3BQL A;  3Q9D A;  3MXZ A;  4KHP T;  2V7K A;  3FXE B;  2CWY A;  3PUW F;  3E22 E;  3GUA A;  3UU4 A;  1LVK A;  1VCT A;  3I9W A;  4DBR A;  5AQT B;  5HCM A;  3KIN B;  2C5K T;  1GQE A;  4O4I E;  3AVS A;  3JCF A;  4CQI A;  2FJE A;  2ZLY A;  2BYR A;  3IEE A;  3K8P C;  2PGZ A;  3OPC A;  2WQY A;  4HFB A;  2N2N A;  2KLQ A;  4IE4 A;  4MLK A;  4U2Z A;  3FBZ A;  3SFE A;  1WYC A;  1LRZ A;  2G0U A;  5F5W A;  3WAK A;  2IDO B;  4ZI3 D;  4GYR A;  5A1L A;  5HEO A;  3U8K A;  3BK9 A;  2IIU A;  1MMA A;  5HXS A;  3J7Y q;  5HWX A;  2IC9 A;  3T1H T;  5AFM A;  4QKN A;  4AKI A;  4LFA T;  3Q2M A;  4HE8 A;  4DR2 T;  4WBN E;  4TX5 A;  4KMC A;  4EIW A;  3RPU A;  3LK3 B;  3ONX A;  5CB4 E;  3B57 A;  2Y56 A;  3ZYM A;  4EAH A;  5IUX A;  3ZCI A;  3ZDG A;  2FUP A;  4ZI2 C;  2E5L T;  1MIW A;  4IL4 A;  3SWH A;  2VB6 A;  2Y54 A;  4JYA T;  4PJN A;  4FRR A;  5JDM A;  3KV4 A;  2JQQ A;  3ANW A;  2VQF T;  2CCQ A;  2X0H A;  3MK7 C;  4WYV A;  2W8G A;  4WNK A;  1E7P A;  5FL0 A;  4OHF A;  4B3M T;  2XSA A;  3P4W A;  4LML A;  4U7I A;  4X62 T;  3WTO A;  3CK6 A;  1T8B A;  1IJ5 A;  1WR0 A;  3N9Q A;  2W00 A;  2CXD A;  3PUZ F;  2CBJ A;  3F31 A;  3LFM A;  4AQF C;  3HKB E;  5HEH A;  4PK5 A;  3L8R A;  4Z91 A;  3L3P A;  2V1D B;  2V7I A;  2BKP A;  2Y7Y A;  4ZXL A;  4DV4 T;  2IC6 A;  4X64 T;  2FJD A;  3M65 A;  4EOZ B;  2X00 D;  3AEC A;  5J5H A;  2OV9 A;  3QB5 K;  3ZJ1 A;  1KEY A;  2BVL A;  3GWH A;  4YHJ A;  4BAY B;  2XQ4 A;  4ZS2 A;  3CVR A;  4UXN B;  3AE6 A;  4ZS3 A;  5AFU L;  4QAB A;  2WDQ A;  3WTN A;  3LG7 A;  2MPK A;  4DR7 T;  1WYB A;  3AEE A;  3N9L A;  3PUS A;  3ETU A;  4G63 A;  3UTK A;  3CQX C;  1OED B;  4KX6 A;  3O1H A;  4LFC T;  4EZ4 A;  1N34 T;  4X1I E;  2BS4 A;  4YSX A;  2WB5 A;  5JDL A;  4COF A;  1MMN A;  4DR6 T;  3BQI A;  5CFB A;  2BZB A;  4QWN B;  3DP7 A;  3TKL B;  1WFD A;  2KND A;  5L3C B;  4H9R C;  4UM3 A;  3NZQ A;  2NW9 A;  2CHO A;  4CN4 A;  4P0B A;  1L0V A;  5LBQ B;  2E8I A;  4X66 T;  4OYJ A;  2Q9Q B;  5LNK A;  2A3D A;  3U3I A;  4DV2 T;  4O8S A;  4DBM A;  5BW2 A;  2AXD S;  2LM2 A;  3LBX B;  5IYZ E;  2DNX A;  4UV9 B;  2EHO C;  1W09 A;  4YFS A;  2XAS B;  1EZ3 A;  5JR9 C;  3FZH B;  1YKE B;  2CMR A;  2NW8 A;  3U8L A;  1JNR A;  4DR3 T;  2BS2 A;  2DWK A;  1HCI A;  5L47 A;  5C2T A;  2CXL A;  3QC9 A;  4HGA A;  2Y48 B;  2E9X B;  1J5E T;  5ABF B;  1SUM B;  4JLE A;  5L3B B;  3I1A A;  2BS3 A;  3WTH A;  4U74 A;  3CQG B;  4HWF A;  3AAA B;  4DV5 T;  2YK0 A;  2KIN B;  4KUM B;  2WNJ A;  3PDY A;  3WTI A;  3JC6 D;  4QAA A;  3ZMV B;  5LA6 E;  2NR4 A;  4H9O C;  1YQ4 A;  3CX7 B;  4MFR A;  2WS3 A;  3RIU C;  3ZYK A;  4UVB B;  2WWU A;  3N9N A;  4TNW A;  3ZEF B;  4ZEY A;  4JEH B;  2LJL A;  4CI2 B;  5JDQ A;  3EDV A;  3AED A;  1OED C;  2X68 A;  5M4Y A;  4GYS A;  2XPK A;  2XUE A;  3IF8 B;  3NWI A;  4PJM A;  5J5I A;  3N9O A;  5CGM A;  3PU8 A;  1T7S A;  2XQ7 A;  1CUN A;  3VKH A;  3HKE E;  5JME A;  3FB2 A;  2UXB T;  5AQV B;  4QAC A;  3ZMU B;  1XDO A;  4GOU A;  5AQR B;  2N1G A;  2JQK A;  5AFJ A;  2C0S A;  4HEA A;  2BYS A;  3O4X E;  3NBX X;  5LJM A;  5BRX A;  5DQW A;  2BR8 A;  3UU3 A;  3AE1 A;  4X1K E;  4YT0 A;  2WM9 A;  1YKH B;  4HKA A;  1ZP0 A;  2RA1 A;  1FEW A;  2QGS A;  3WTK A;  5FYM A;  3KV9 A;  2XHE B;  1N36 T;  1UV6 A;  4UM3 P;  1NAF A;  3OVU A;  4LF6 T;  1UX4 A;  4QXB B;  1U5P A;  3SQ6 A;  2XAG B;  5HEU A;  5LCY A;  2V6Y B;  3UQ4 A;  1IBM T;  4TWD A;  3SH1 A;  4HTE A;  3ABV A;  1MMG A;  3ZSS A;  5GON E;  4FI5 A;  3U8N A;  1Z0P A;  1XMO T;  3W15 B;  5TVC A;  3HKD E;  4MBQ A;  3N5L A;  2WP9 A;  4TZ4 C;  4IIJ E;  1D1A A;  2VKJ A;  2W62 A;  3PU3 A;  1QLB A;  3QK6 A;  5FY0 A;  3CQC B;  1NEK A;  2RP4 A;  4DND A;  4YHH T;  1BR4 A;  4ILA A;  3U8J A;  4Q25 A;  2D0T A;  1E2A A;  2K5B B;  1W0A A;  3ZKR A;  3K3Q C;  4IDO A;  2M6I A;  1FMW A;  4PJL A;  4DVD A;  4DR1 T;  1XNQ T;  3KBU A;  1QSD A;  4EEB A;  5ETW A;  4IDP A;  3RYF E;  3A8Y C;  2VK9 A;  2BJ0 A;  4DBQ A;  4YSZ A;  1BR0 A;  3ZC0 A;  4ZHQ E;  2IML A;  3TLU A;  1OED A;  1YD8 G;  4AXP A;  4QXC B;  3J9X 1;  2WSS V;  4EB6 E;  3X1D A;  3F2E A;  4ASK A;  5JRE A;  2H88 A;  2CRB A;  3AEF A;  2ACZ A;  2RPA A;  3GN5 B;  3JAE A;  4UEL A;  4DV3 T;  2AE9 A;  1FJG T;  3EHZ A;  3ZDH A;  5KMG P;  3FBL A;  4HFI A;  4BFQ A;  5J2T E;  5L2L A;  2VL8 A;  2CHN A;  1KFY A;  2Q9Q A;  2UXD T;  1T72 A;  5AFK A;  3E08 A;  4ADZ A;  2A9U A;  2BKO A;  4DUY T;  5AQO B;  4I50 E;  4X65 T;  1ZEE A;  3Q5E A;  4BJM A;  3U78 A;  1W0B A;  5AFL A;  3JAD A;  3R6N A;  1UK5 A;  4GK0 E;  5FKY A;  3LBX A;  3CX8 B;  5EZY E;  4KBM B;  4JI6 T;  2I59 A;  1DU2 A;  5AQQ B;  5CA0 E;  2LT3 A;  2HN1 A;  1OED E;  3RYI E;  4I55 E;  2XYS A;  3R84 B;  2X0Y A;  2KSR A;  4YSY A;  5HXR A;  5KZU A;  3AEB A;  5ABG A;  3A7M A;  3SRZ A;  5AQU B;  4L9I A;  2E9X A;  4JV5 T;  2V5D A;  5ABF A;  2B76 A;  2W4X A;  2LHN A;  4DO0 A;  4TWH A;  4WW0 A;  3H3M A;  2CE7 A;  3KDS E;  4H63 V;  2DCF A;  1FIO A;  1WR6 A;  3JC6 C;  2Y6X A;  4QX8 B;  4ZOL E;  4GIW A;  2WDV A;  1G8X A;  2SPC A;  1D0Z A;  2UUA T;  1HG5 A;  1UCU A;  3UU6 A;  4JI1 T;  4AI6 A;  5E0O A;  2K24 A;  3RIF A;  2JJ9 A;  4IE7 A;  4ILC A;  2LSY A;  3PUA A;  4B3T T;  4H9S E;  5FMN A;  1I9B A;  1XNR T;  1MND A;  3P4P A;  5FY1 A;  2N9D A;  4Z8X A;  3VU7 H;  4EGW A;  5LGN B;  2W0G A;  3ZLI A;  1KNP A;  4CXX A;  3MA9 A;  2Y8D A;  4N78 D;  2FJB A;  2OA5 A;  5JRC B;  2QYW A;  4XAX B;  2XQ8 A;  2NP9 A;  4JI2 T;  3KBT A;  4ZZB A;  1OWA A;  2C5J A;  3AA0 B;  2BG9 B;  4TV9 E;  2EHO B;  5JR9 B;  2ACX A;  4AKR B;  5JH7 E;  2J4G A;  2BKN A;  3PUX F;  4L0R A;  3HR0 A;  3EVY A;  3NRX A;  5BP0 A;  3RLF F;  5AIN A;  3C4Z A;  5LYJ E;  4KI0 F;  3PE0 A;  3ZT7 A;  4UF0 A;  1HF8 A;  2P9B A;  3WIP A;  2XNV A;  2CWO A;  4NXM T;  2LM9 A;  4P1N A;  2QC1 B;  4JI5 T;  2YDR A;  1HS7 A;  3QB5 A;  2K3W A;  2XY8 B;  2YU1 A;  2Z6E A;  3RQU A;  5LHI B;  2J47 A;  3N9M A;  4ZR6 A;  3WI3 A;  5CO5 A;  3ZT6 A;  2H7O A;  1JNZ A;  1QUU A;  3VRB A;  3HKC E;  3AE2 A;  4HWC A;  5LP6 E;  3C98 B;  2DHR A;  2X9W A;  4ZK4 A;  3NVO A;  2V6Y A;  4MHC A;  3KFW X;  2Y58 A;  4CN6 A;  4C90 A;  4EXT A;  1G73 A;  1ZOY A;  2V7L A;  5LXB A;  2JPF A;  2ODV A;  5HEG A;  4ZJS A;  4YTP A;  4TN7 B;  2UUB T;  4LF8 T;  4OX9 T;  3PJA A;  5L4E A;  4CZZ B;  2XQ9 A;  4O2A E;  5JTG A;  3C84 A;  5ADX L;  4P0A A;  2JRK A;  3N2G E;  3CX6 B;  5LJN A;  2WU5 A;  2WZH A;  5L4H A;  3AE3 A;  4AKG A;  4PAG A;  5KDM C;  3GMI A;  2BBH A;  3ZN0 B;  3RRW A;  5JDG A;  5HWY A;  3AE7 A;  4QH1 A;  2WZY A;  5L3D B;  2CA5 A;  2YKS A;  1LKX A;  3RI5 A;  3ZMZ B;  5L3G B;  4QH4 A;  3RKO A;  5BR8 T;  3ONJ A;  3CML A;  4B3R T;  1XZY A;  1R8I A;  3FHN A;  4PFP A;  5AQS B;  3M3Z B;  2X51 A;  2E2A A;  2LRK A;  5FXZ A;  1HX1 B;  4ZRU A;  4CI3 B;  2BG9 C;  3L09 A;  3CWZ B;  5LG4 A;  4DV7 T;  4B6X A;  3AE9 A;  4PW8 A;  3QOF A;  4FJO A;  3C4X A;  3GA8 A;  2XQY A;  2H7V C;  2YMD A;  4TUY E;  3GN5 A;  3Q5D A;  3FZF B;  4UVC B;  3ZST A;  5LG3 A;  2X9Y A;  3C51 A;  5HCJ A;  1SE7 A;  4QHO A;  3RHW A;  2CLY C;  2WNC A;  4HFD A;  2FBW A;  4AQF A;  3N9P A;  2MAW A;  2X0L B;  4A97 A;  5AQG B;  1J5W A;  2BYN A;  3ZMS B;  5AQL B;  1MIY A;  4ZZC A;  3ONL C;  3SFD A;  3V5S A;  4YJ2 E;  3Q5X A;  4UIG A;  1AJ3 A;  3RX6 A;  3RC8 A;  4CXW A;  3UQ7 A;  5LHG B;  2LSI A;  2XQA A;  4EZ1 A;  2BVM A;  1MMD A;  5JDN A;  3RF1 A;  2NTX A;  3ESL A;  4O4J E;  3FXD B;  4ZI3 C;  1KNR A;  5FL1 A;  5EK4 A;  4CI1 B;  4A56 A;  3U8M A;  2IUB A;  4BJN A;  4F6R C;  3UUL A;  2XAQ B;  2VVN A;  3PJA J;  3AA7 B;  3HI2 A;  2LEH A;  2ZM6 T;  1VRB A;  4EV6 A;  2PTF A;  1SHZ C;  3SS1 A;  5AQM B;  2XNU A;  2LKG A;  5LGT B;  3OTO T;  4AQY T;  2L8K A;  2PH9 A;  2DLR A;  1UX2 A;  2VQE T;  4A5X A;  3C79 A;  3AE8 A;  4NPP A;  4QH5 A;  2BR7 A;  3RQW A;  4LFB T;  1D0X A;  1WCR A;  4U72 A;  2XM2 A;  3K3O A;  3N2K E;  5LHH B;  4UEM A;  5KE4 A;  4HFE A;  5JRC A;  2CBI A;  3QUJ A;  1N32 T;  1E1H B;  2GK9 A;  3WTM A;  3P8C D;  1X79 A;  3KVB A;  3TLV A;  3VHL A;  1KK7 A;  4JBW F;  3RYC E;  4YTM A;  2ZM2 A;  1X9B A;  2BG9 A;  4IT4 A;  2IHR 1;  3KVA A;  4DV6 T;  4O2B E;  2F4V T;  2EHO A;  2Y57 A;  1WRD A;  4UM1 A;  5JR9 A;  4EYY R;  3ZYL A;  4PJJ A;  4XHE A;  4HWH A;  1B7T A;  5J5G A;  1Z8U A;  4ISS A;  4QXH B;  1S94 A;  3FZK B;  3B5M A;  2WZI A;  1M7K A;  3H37 A;  3IGQ A;  2WMO A;  2WY2 A;  2UUC T;  2PJQ A;  4KP3 C;  2LSG A;  4DMV A;  4JI0 T;  1NWM X;  4AIU A;  3AA1 B;  4NUV A;  4H63 H;  3Q5W A;  2ES0 A;  3AAI A;  3RC3 A;  1O3X A;  4M1P A;  2YME A;  3DTO A;  4X1Y E;  3B13 A;  3KV5 A;  3RIU A;  1XWM A;  4ZK1 A;  1IAP A;  2LLY A;  4JUY A;  2H3R A;  2LE8 A;  5FVL A;  4TNV A;  2WAU A;  2KT9 A;  1U4Q A;  4IL9 A;  2JIW A;  4E7S A;  2K9A A;  1IBL T;  2ZMA A;  5J5F A;  3HL6 A;  4DID B;  5AQN B;  2XYT A;  4LF4 T;  2HHH T;  3RIA A;  5FY7 A;  5FJV A;  1YQ3 A;  5EK2 A;  5L3F B;  2V7M A;  3V5U A;  3KV6 A;  1HNZ T;  4IE5 A;  3CIR A;  5FXX A;  5AQI B;  4UXU A;  1LVF A;  5DAB A;  4L5G A;  4UR9 A;  2UXN B;  4U7Y A;  2UXX B;  2PBI A;  4Z90 A;  5ABH A;  5HAX A;  2L3L A;  2W67 A;  2XQ6 A;  1WLX A;  2V5C A;  5DJQ C;  3ETV A;  5IHY A;  2KXP B;  2LKH A;  1J1J A;  2KZ7 B;  4D01 A;  2X66 A;  2I6H A;  4JI4 T;  4HN9 A;  2XSB A;  2D9D A;  2KWI B;  4IE6 A;  2D2S A;  4PIR A;  2JQ9 A;  4HFV A;  1HNW T;  4HFC A;  4OYK A;  4ZI7 E;  1HG2 A;  5LGU B;  2MOZ A;  4IDQ A;  2LRL A;  2FJA A;  1UUS A;  4DR5 T;  2CEA A;  2X9X A;  1ZKE A;  3T8O A;  2A72 A;  2J1D G;  2X00 A;  4HQP A;  3PV0 F;  3WTL A;  3C4W A;  5IWA T;  5FXW A;  5HYA A;  4LF9 T;  2XTL A;  3TLT A;  2NTY A;  1HFA A;  4X5T A;  4UVA B;  5LOV E;  4OFZ A;  2YDS A;  2UZ6 A;  2YN6 A;  3QNU A;  2LHR A;  2X67 A;  2W63 A;  3PUR A;  2IW5 B;  4IHJ E;  4NXN T;  4O4H E;  3RH3 A;  3VR9 A;  2WWV A;  2Q9Q D;  2J62 A;  2XZ6 A;  5FXV A;  2W66 A;  2ZM8 A;  1YW0 A;  3OYX A;  2BBJ A;  3SOL A;  4PFO A;  4AFT A;  2QRX A;  2DL1 A;  3T1Y T;  1CHU A;  4NIQ A;  2LSJ A;  4DV0 T;  5KX5 E;  2IAK A;  4ILB A;  3AXJ B;  4U2Y A;  2ZJV A;  2W2U A;  2JMH A;  4XK9 A;  3FZM B;  4OK0 A;  1BR2 A;  4P09 A;  2V26 A;  2CXF A;  2VUR A;  5JDH A;  3SQ9 A;  2CLY B;  3PTR B;  5C8Y E;  2M67 A;  5HXH A;  3AA6 B;  2LOS A;  3C64 A;  2V6X A;  3AVR A;  4IRE A;  2XM1 A;  2NWB A;  4IDZ A;  2E9X D;  2CPT A;  1KF6 A;  4MAL A;  5BMV E;  2BYQ A;  5AFN A;  4IDN A;  3UFG A;  5AQF B;  1S35 A;  2XZ5 A;  4HWI B;  3E0Z A;  2I0M A;  2DWG A;  3S4U A;  3UUM A;  2C9T A;  2NW7 A;  4YLH A;  2VWA A;  5JQG E;  4JI8 T;  5TAO A;  3UU5 A;  5J2U E;  2KWH A;  2UXC T;  2JQH A;  4IE0 A;  4X20 E;  4AQG A;  4V1A v;  5H6R B;  3A5X A;  3O1I A;  4LMK A;  3IBP A;  1NEN A;  2XAJ B;  3I9Y A;  4YXD A;  3ZN1 B;  3NKZ A;  4IGU A;  4PK6 A;  2WMN A;  2HN2 A;  2C5I T;  3MAC A;  3RYH E;  4I0U A;  3P4Q A;  1Y64 B;  4H9N C;  5AQJ B;  2KMF A;  5HXE A;  3EDU A;  5AFH A;  5CA1 E;  1OXZ A;  3TLS A;  4GKJ T;  2L9Q A;  3AE5 A;  4LF5 T;  4GK5 E;  4HFH A;  4U33 A;  1MNE A;  3T4M A;  2V8S V;  5J1G A;  5F8P A;  4C91 A;  4K0U A;  1ZV4 X;  2H89 A;  2YIN A;  3HA4 A;  4DUZ T;  4QX7 B;  5CJ5 A;  3EUH A;  3AB3 B;  2VL0 A;  3PUY F;  3I0O A;  5JDF A;  4ANJ A;  1VCS A;  4YY3 T;  2BYP A;  2V7J A;  4ILU A;  4AKL A;  3I0Q A;  4TV8 E;  3RKG A;  4K0K T;  4HWD A;  4LMJ A;  4WBO A;  3OYZ A;  4JI7 T;  3LDQ B;  2VKO A;  4DMW A;  2CM0 A;  1BR1 A;  2ODU A;  5KXJ A;  3CKD A;  5C3J A;  5LB7 B;  2LOP A;  3P4R A;  1HR0 T;  2VVS A;  3CPZ A;  4AFH A;  3PUV F;  3ZJ2 A;  1D1B A;  1ZHC A;  2JMK A;  4KHZ F;  5ABE A;  4ZJT A;  3NZP A;  1I6Z A;  2DI4 A;  2WCA A;  5H6Q B;  4BA9 A; 
#chains in the Genus database with same CATH homology
 1OED E;  3P50 A;  5JME A;  2XYS A;  4QH1 A;  2M6I A;  2XZ6 A;  4QAC A;  5BP0 A;  2X00 D;  2WZY A;  3IGQ A;  2KSR A;  3EAM A;  5AIN A;  2YKS A;  5J5H A;  3RI5 A;  5AFM B;  4Z90 A;  5KZU A;  4QH4 A;  4AFT A;  5AFJ A;  3WTJ A;  2XQ5 A;  3SIO A;  5SYO A;  3U8L A;  2XQ6 A;  3LSV A;  3WIP A;  5AFH A;  4UM3 S;  2XNV A;  4BQT A;  2BYS A;  2Y56 A;  3U8M A;  5BRX A;  2BJ0 A;  4B5D A;  1UW6 A;  5IUX A;  2BR8 A;  3ZDG A;  2XQ4 A;  3TLS A;  4AFG A;  2QC1 B;  5L47 A;  4TWH A;  3UU3 A;  4QAB A;  4ILB A;  3WTN A;  2ZJV A;  4ZRU A;  2YME A;  3PMZ A;  2LKH A;  2BG9 C;  4HFH A;  5J0Z A;  3TLU A;  3TLW A;  1OED A;  3T4M A;  4XK9 A;  4D01 A;  2XNU A;  4IL4 A;  2LKG A;  3RQU A;  3PEO A;  4ALX A;  4F8H A;  3WTH A;  4ZR6 A;  5CO5 A;  3WTK A;  2PH9 A;  4ZK1 A;  2YMD A;  3SQ9 A;  2Y54 A;  1UX2 A;  1OED B;  4PIR A;  3C79 A;  2LLY A;  2WNJ A;  3WTI A;  3UU6 A;  4NPP A;  4QH5 A;  1UV6 A;  3GUA A;  3UU4 A;  2BR7 A;  3RQW A;  4UM3 P;  4QAA A;  4ZK4 A;  4TNV A;  4IRE A;  2ZJU A;  4FRR A;  2Y58 A;  2VL0 A;  5LG3 A;  5HCJ A;  4HFC A;  5HCM A;  3JAE A;  3RIF A;  3RHW A;  3UU8 A;  2BYP A;  4IL9 A;  5LXB A;  2YOE A;  4COF A;  2BYQ A;  2WNC A;  5AFN A;  4HFD A;  3SQ6 A;  5HEG A;  4WV9 A;  3EHZ A;  5HEU A;  5HEJ A;  4ILC A;  5CFB A;  2WN9 A;  3ZDH A;  2MAW A;  2Y7Y A;  4HFI A;  2W8G A;  2BYR A;  2XZ5 A;  4ZJS A;  4BFQ A;  3UQ4 A;  5KE4 A;  2PGZ A;  4A97 A;  4TWD A;  1I9B A;  3SH1 A;  4UY2 A;  4HFE A;  4LMJ A;  2LM2 A;  3P4W A;  4HFB A;  4LML A;  2C9T A;  2BYN A;  5J5F A;  4UM3 A;  3WTO A;  2M6B A;  4NZB A;  4TNW A;  5AFK A;  3WTM A;  2XNT A;  4HQP A;  2X00 A;  4ZZC A;  2XYT A;  3UU5 A;  3U8N A;  3TLV A;  4A98 A;  5L4E A;  5TVC A;  3RIA A;  3WTL A;  2XQ3 A;  5FJV A;  2BG9 E;  2XQ8 A;  3JAF A;  2XQ9 A;  3TLT A;  2BG9 A;  1OED C;  2Y57 A;  4AFH A;  4UM1 A;  5HEH A;  3C84 A;  4X5T A;  2W8F A;  3JAD A;  3UQ7 A;  5AFL A;  2WNL A;  3EI0 A;  2XQA A;  4ZZB A;  4EZ1 A;  4ZJT A;  4LMK A;  2BG9 B;  4Z91 A;  5HEO A;  2UZ6 A;  5L4H A;  4ILA A;  4XHE A;  3U8J A;  3U8K A;  5J5I A;  5J5G A;  4DBM A;  2YN6 A;  4UXU A;  5BW2 A;  3ZKR A;  5AFM A;  4TWF A;  3UUB A;  2XQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...