5HCJA

Cationic ligand-gated ion channel
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sites of Anesthetic Inhibitory Action on a Cationic Ligand-Gated Ion Channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 94
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hcjA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hcjA01
2KSRA 4UXUA 4Z90A 3EI0A 3RQUA 2BJ0A 2UZ6A 4UM3A 5AFJA 3SQ9A 4AFTA 2YN6A 2YKSA 3UU5A 3T4MA 5J5GA 2MAWA 4HFCA 5LG3A 2WNJA 3JAEA 3RQWA 3RHWA 3P4WA 4Z91A 4TNWA 4QH4A 2LKHA 3WTHA 2Y56A 4AFHA 4WV9A 3UU3A 3EAMA 2XYTA 4NZBA 2LM2A 5SYOA 4AFGA 4HFHA 5L47A 3UU4A 3TLWA 4LMLA 4TNVA 2PGZA 5BRXA 4QH1A 1I9BA 5CO5A 3U8KA 3TLTA 3UU8A 2Y58A 3WTKA 4TWFA 5FJVA 4LMJA 3ZDHA 5BW2A 3WTMA 4QABA 4X5TA 2M6IA 3P50A 4ZRUA 5AFLA 2QC1B 5AINA 4ZR6A 2WNCA 3RI5A 2VL0A 4UY2A 1OEDB 2X00A 2WZYA 3UQ4A 3WTLA 2W8FA 4DBMA 4XHEA 2X00D 2BG9A 2XQ6A 3WTNA 5BP0A 2YMEA 4HFIA 5HCMA 5AFHA 2XQ8A 4QH5A 2ZJUA 2M6BA 4ALXA 4ZZCA 3C79A 4ILBA 2C9TA 3UU6A 4B5DA 2XNVA 4PIRA 4ZJTA 2XQ4A 5J5IA 3SIOA 2BYSA 3SQ6A 3TLUA 3GUAA 4UM3P 3U8LA 4IL9A 4ZZBA 2XQ9A 3U8JA 2W8GA 3WTOA 2BG9B 5JMEA 5HEGA 3LSVA 4QACA 1OEDA 2WN9A 3UUBA 3RIAA 2BYQA 5L4EA 1OEDC 3U8MA 3ZKRA 5AFMA 4BQTA 4IL4A 5HEOA 4A97A 4F8HA 1UW6A 2YMDA 3SH1A 2XQ5A 5AFKA 2LKGA 4HFBA 4ILCA 5HCJA 2Y54A 2Y57A 3UQ7A 4FRRA 5L4HA 4XK9A 1OEDE 5LXBA 3WIPA 5AFNA 4ZK4A 2Y7YA 5J5HA 2BG9E 2WNLA 4ZJSA 3EHZA 4ZK1A 5HEUA 4ILAA 2XNTA 3C84A 5CFBA 4D01A 5HEHA 2PH9A 2XQ7A 2XQ3A 1UV6A 4QAAA 3JAFA 4NPPA 2BYRA 2XYSA 2XZ6A 2XQAA 3TLVA 3RIFA 4BFQA 2BG9C 5KE4A 3ZDGA 4TWHA 5HEJA 3U8NA 5J0ZA 2XZ5A 4IREA 2XNUA 4HFEA 5J5FA 4EZ1A 2LLYA 3WTJA 3PMZA 4HQPA 2ZJVA 2BR7A 3WTIA 1UX2A 5IUXA 2BR8A 3JADA 4TWDA 5TVCA 4HFDA 4A98A 4COFA 2YOEA 4UM1A 4UM3S 5AFMB 3TLSA 3IGQA 2BYNA 2BYPA 4LMKA 3PEOA 5KZUA
chains in the Genus database with same CATH superfamily
1UCUA 2EHOD 2BVMA 5J5GA 2BS2A 2E9XB 3JAEA 3NRYA 2CWYA 2W66A 2LM2A 4AFGA 3TLWA 4GIWA 3I0OA 1B7TA 4KMCA 3LFMA 4TV9E 4J2CA 4JI8T 3UFGA 3RRWA 1MMDA 3ZMTB 2L8KA 2D0UA 2MOZA 4PK6A 4QXCB 1OWAA 1SE7A 3O1JA 3HKBE 4X66T 3TLUA 1G73A 1GQEA 2N1GA 5IYZE 2V8SV 3D0TA 2KNDA 3VKHA 2DLRA 2DWKA 4YTPA 5AFKA 4FRRA 2Y54A 3QOFA 4Q25A 4YHHT 2CM0A 4DR4T 1WYBA 4U3CA 4EB6E 1E1HB 2XQ3A 3AAEB 4H63H 1IAPA 2CCQA 2BKPA 3QB5K 1XNQT 4B3TT 3KDSE 2B76A 2WMNA 5DABA 4HN9A 4X65T 5HWYA 1WCRA 5LNKA 3ZEFB 4UM3S 5L3BB 4O8SA 1SUMB 2BYPA 4I4TE 2YU1A 2JJ9A 3AAAB 3BK9A 4V1Av 4Z90A 3EI0A 2LSYA 1ZP0A 2KINB 1HNWT 1YKHB 4DVDA 4WV9A 2KXPB 3VR8A 2K3WA 2W0GA 5F3JA 1KK7A 4NUUA 4HWDA 2X9HA 4QABA 3OTOT 2I6HA 3P50A 4ZRUA 3OJAA 3CQCB 4IDPA 3IBPA 2BG9A 2C5IT 4KHZF 4HFIA 3VR9A 4JV5T 3UU6A 3N9OA 4PIRA 3HI2A 3U8LA 3MZKB 3WTOA 2FJBA 5C3JA 1FMWA 1MMGA 2IC6A 5JMEA 1OEDA 3N9NA 2D0TA 4DO0A 3QNUA 4O4JE 2YINA 3T8OA 2W63A 2CLYB 4A97A 3EUHA 1N33T 3Q9DA 2UXXB 3RC3A 4JBWF 3B5MA 4N78D 4X1YE 1KEYA 2HN2A 3JAFA 2BYRA 3SFDA 2NOXA 2YEVC 2XQAA 2XUEA 1YQ4A 3FZMB 3TLVA 4GK5E 3PJAA 4CI3B 5FYMA 3P7IA 2DWGA 5ETWA 3C98B 5JDFA 5CA0E 3ONXA 4UF0B 2WWVA 4EV6A 4UM1A 3CWZB 3ZC1A 1D0ZA 5TAOA 5KZUA 4CXWA 4DV6T 4AKIA 2H88A 2IDOB 3N2OA 2WWUA 1T8BA 2SPCA 4PK4A 4PJMA 2LRLA 4CN4A 2X0LB 3PU3A 2IHR1 3N9PA 4HGAA 5JDQA 4X5TA 3RRCA 5J1GA 4DMWA 2WDVA 1JNZA 4KI0F 2W8FA 1KNRA 4QX7B 5L3DB 4YT0A 2C9TA 3SQ6A 3AXJB 3GUAA 3PUVF 4XBFB 1E2AA 4GYSA 1FMVA 2CXFA 4FJOA 5HEGA 3UUXB 1W0BA 3LBXA 3VKGA 5LCYA 5LXBA 1SHZC 3LK3B 3CX8B 4D01A 2WU5A 4H9RC 5GONE 2R6GF 5HEHA 4ZI3D 3C64A 2QA7A 2PG8A 3U78A 1WYCA 3ZDGA 5HEJA 4GK0E 2LHRA 2N9DA 1D1AA 2RA1A 4QKNA 2XZ5A 3PUXF 3C4XA 4IDQA 2NTYA 2WMOA 3ZT6A 3P4RA 5FP3A 4DV0T 4ZI2C 3ONLC 4DR3T 4OYJA 2Z6EA 3PTRB 4HFCA 2LRKA 3HKEE 3AE2A 4TNWA 4DIDB 2LOSA 4ZEYA 4PNIA 2Q9QB 2FJAA 3ZN0B 4EXTA 3K1SA 3MKDA 4ZI7E 3ZJ1A 2VL0A 4UY2A 1OEDB 3UQ4A 5JDMA 5FMNA 3AEBA 5LB7B 3FZKB 3ZMVB 5HYAA 3K8PC 5M4YA 2ZM8A 5CB4E 4CI1B 3P4QA 1KFYA 2BG9B 2VASA 3PDYA 1YD8G 5EK4A 2VB6A 4B3ST 3CKDA 3CX7B 4ILUA 4U31A 3UQ7A 5JRCB 4AKHA 4ZK4A 3ZCIA 2K9AA 2V5CA 4DV2T 1NWMX 2GK9A 2XNTA 5LP6E 2VQET 3SRZA 2WY2A 2YU2A 4I50E 3MACA 4BA9A 3P8CD 3DP7A 4EZ1A 4DV1T 2CLYC 5CJ5A 3K3OA 3W15B 1I94T 3PE0A 2WAUA 1NAFA 2UXCT 2CXLA 2V7MA 5AQQB 2LSJA 3ZT5A 2V7KA 3I0QA 3P4PA 4DR7T 1U4QA 2WNJA 3IF8B 1VCSA 2VURA 5BRXA 5SYOA 2JQ9A 2V7JA 3UU4A 4ISTA 2HN1A 4DBQA 5FXZA 2CHNA 2J4GA 2AE9A 2W61A 1NENA 3L39A 4IE4A 2CMRA 5AFLA 3E22E 5JREA 4IDZA 2ZMAA 3T1YT 2RP4A 4JI5T 4GOUA 4DV5T 1BR4A 3UULA 4HEAA 5FXXA 3NVOA 5FY7A 2H3RA 1HX8A 4MHCA 1N34T 4H9NC 5LHIB 2EHOC 2E8IA 3CX6B 1J1JA 4LF4T 2YDQA 5DQWA 3HA4A 3AAIA 2LE8A 2W4XA 4ISSA 3SH1A 2C5KT 1OEDE 3KBTA 4AI6A 1HG5A 5C8YE 4OFZA 4UVAB 3QC9A 3NWIA 4CXYA 4KUMB 4X64T 2BG9C 2W67A 4AQGA 4P1NA 3U8NA 4I55E 2JMHA 3ETVA 2FBWA 4TUYE 4HQPA 3MA9A 1UX2A 2V26A 5AQMB 4O4HE 3FZLB 2BYNA 4LMKA 4EEBA 4H9PC 4JI3T 4UM3A 2DHRA 4ASKA 4UXNB 1VRBA 3RQWA 2BBJA 2C0SA 3I9YA 3LJCA 2W00A 1IZNB 2UXDT 3UU3A 4BJMA 1HX1B 3KFWX 3I1AA 4KP3C 3ZDHA 3AA7B 2B1EA 1X79A 2QC1B 3QK6A 5A1LA 4MLKA 2X00A 5L3CB 5E0OA 4IE7A 2LEHA 4CN1A 1QSDA 3C79A 3AA6B 1MMAA 2UUAT 4OYKA 4ZZBA 1V9DA 4ANJA 3LSVA 3G06A 3RIAA 2XY8B 2IAKA 5LMNT 5FL1A 4EEDA 3UUNA 3AE1A 4NXMT 2WU2A 2Y7YA 3C84A 1XMOT 2CRBA 2XQ7A 2XYSA 3RIFA 4YJ2E 2NW7A 1KF6A 4BFQA 1U5PA 2V7LA 3P4SA 5KE4A 1HNZT 2JPFA 5LYJE 3ZSSA 4OK0A 1T7SA 3WTJA 4WNKA 3C4WA 5IUXA 4LFCT 4AFTA 3N9QA 3RC8A 1UUSA 3N9MA 2D9DA 2K5BB 1QLBA 5IWAT 4JI1T 1WRDA 3AEEA 4LFAT 2IIUA 5HXEA 2IC9A 4E7SA 3AVRA 2CPTA 3AE7A 5HAXA 3BQIA 4YTNA 4TWFA 4F6RC 3ZJ2A 5DQVA 4PJLA 2M6IA 2XTLA 4O2AE 5H6RB 5JQGE 3UFEA 4XAXB 5JR9C 2YMEA 4GKJT 4O2BE 3EVYA 5J5IA 4X20E 1UURA 5FVLA 2YDRA 2XAQB 2DI4A 1ZOYA 1D0XA 3PUAA 1ZHCA 4L5GA 3UUBA 3FBLA 3E08A 5DJQC 3PV0F 5FL0A 3HKCE 5AFMA 4BJNA 4C90A 3WI3A 5EK2A 3VHLA 1XMQT 2V1DB 1X9BA 3F57A 4JI6T 3CQXC 4MBQA 4DUYT 4M1PA 2KMFA 3AEFA 5JDHA 3UTKA 2VKHA 4ZXLA 2VK9A 5J0ZA 3UUMA 5AQLB 3PUWF 3Q5DA 2XM1A 4I0UA 1IBMT 1EZ3A 2PTFA 2H89A 4AFHA 5L47A 3RYFE 4TNVA 1BR0A 5CO5A 3TKLB 1YKEB 4HWCA 2WM9A 3LBXB 1LKXA 3M65A 3WTMA 4UV9B 3RLFF 2EHOB 3AE4A 3R84B 3N2GE 3ZMZB 1R8IA 3FBZA 2Q9QD 2XAFB 4ZZCA 3CIRA 3FZHB 2KT9A 2XQ4A 4AISA 4GYRA 5FY1A 3O1IA 1IBKT 2X66A 2XQ9A 2W8GA 4DR6T 4WBNE 5F8PA 1HG2A 4YXDA 3OBVE 3AB3B 1OEDC 2QRXA 2XQYA 1W9RA 4CQIA 2E5VA 3I9WA 3J9X1 5AQTB 3WIPA 3GN5B 4U2YA 2WNLA 4ZJSA 5HEUA 3QB5A 4G2AA 3RGLA 4DR5T 3JC6C 4NPPA 2XZ6A 3EDUA 2LJLA 2WCAA 2FJEA 3JC6D 3AEGA 1ZV4X 1MMNA 2X9XA 3AEAA 4AIUA 2LLYA 4U7IA 3B13A 3EABA 2ZJVA 3WTIA 4X1KE 2CWOA 4TWDA 3ANWA 1O3XA 2L9QA 5J2TE 3TLSA 3IGQA 3AVSA 3PEOA 5AFJA 1NEKA 2UU9T 2Y6XA 5AQNB 1LRZA 1AJ3A 4HWHA 4DV7T 3P4WA 1WLXA 3ZYLA 4HFHA 4Z8XA 4HWFA 4DNDA 3N5LA 4YHJA 3IEEA 2LM9A 4FI5A 2LSKA 1W0AA 5AQIB 3AE6A 4B6XA 5F5WA 4HE8A 2K24A 3ZMSB 4YJ3E 5EZYE 1D1BA 2EHOA 3MJXA 3GA8A 5LBMA 2H7OA 4K0UA 4JLEA 4ZJTA 2I59A 4QWNB 5LG4A 2XASB 3PU8A 2HPJA 1YQ3A 3ZN1B 1MIVA 5FVKA 2X0HA 3PUYF 4ZI3C 5LGTB 3ZKRA 4UV8B 3MK7C 5HXSA 2J1DG 1XDOA 3ONJA 2JMKA 1MIWA 2BG9E 2E5LT 2NWBA 2ODUA 1JNRA 3O4XE 4LF6T 3WAKA 1MIYA 3NRXA 2V6XA 2BKOA 5LGUB 4IREA 4HWIB 5L3GB 3KV5A 2NW8A 1D0YA 3AXJA 3PMZA 4H9QC 1W09A 2Y48B 3OKQA 2UUCT 4IT4A 5BMVE 2ZM6T 4UXUA 2DL1A 3HKDE 2V6YB 3J7Yq 1VOMA 2BDEA 5AQUB 2XSAA 2XYTA 4LMLA 3Q5EA 2PFVA 5EK3A 4TN7B 5LJNA 2WS3A 4JYAT 4PW8A 4UEMA 1UX5A 5AINA 4ZR6A 4AKLA 3WTLA 5AFHA 4TV8E 1ZEEA 3N9LA 2Q9QC 3ZPOA 2NW9A 4KX6A 5AQFB 4P0BA 4CXXA 2KWHA 3K3NA 2MTQA 3KV9A 3RYIE 2WDQA 4IL4A 2Y8DA 2QYWA 2I0MA 3ZYKA 1KNPA 3L3PA 2XAHB 2VKOA 4EOZB 3EHZA 2X67A 5LJMA 1UGOA 4XZCA 5J2UE 2PH9A 5HXRA 3ETUA 4EGWA 3AE5A 4QAAA 4A5XA 2V5DA 3Q2MA 5LOVE 5AQPB 2A9UA 2WB5A 3JCFA 4ZS2A 2F4VT 2BVLA 2XNUA 1YW0A 2VVSA 5FXVA 3O9XA 2K48A 3ABVA 3L09A 3JADA 1XNRT 4HFDA 5AFMB 4EAHA 5AQGB 3RPUA 3IA3A 3DJBA 3QUJA 3MXZA 2CXDA 1XWMA 4PK5A 2UXNB 5L3FB 3CVRA 4Z91A 3FHNA 4QX8B 1M62A 3RIUA 3NKZA 2X68A 2ZLYA 5JR9A 2JIWA 4G63A 2LSGA 4PJNA 4LMJA 1XDPA 1S94A 2DCFA 2P9BA 2WZIA 4EIWA 1H7CA 4DBMA 3SWHA 2E2AA 3HL6A 2XQ6A 4YY3T 4U72A 5AFUL 2X9YA 4ALXA 3CQGB 2HHHT 3ZC0A 4ZHQE 5HXHA 4U33A 3E0ZA 5JDLA 4U7YA 3LG7A 2VKDA 5L3EB 4LF5T 2LT3A 1LVFA 3C50A 2L3LA 5HEOA 2YMDA 4JUYA 2VWAA 2WQYA 2WDRA 2HH7A 3ZYMA 3HR0A 5CFBA 2J47A 4IIJE 2BKNA 2XZEA 4IDNA 5IHYA 1J5WA 3AE8A 5JDNA 2X0YA 4MFRA 4AQFA 5J5FA 2DNXA 4NXNT 3K3QC 4A56A 2J62A 3ZLIA 2BR8A 4UIGA 5TVCA 2KLQA 4WYVA 4A98A 4C91A 3A8YC 3N2KE 2MPKA 4LFBT 2UZ6A 5LXTE 2ES0A 4GKKT 3AECA 3M3ZB 3RHWA 4WBOA 2V7IA 2PGZA 4QH1A 1S35A 3UU8A 2PBIA 1HR0T 3WTKA 4JEUB 4PFPA 2IW5B 2VQFT 1Y64B 2WNCA 2WZYA 3AA1B 2W62A 3AE3A 2NTXA 2YDSA 2VL8A 4TX5A 3ANWB 5C2TA 2XNVA 3RIUC 2ZM2A 2JQHA 1XZYA 2KWIB 5BR8T 4IE5A 3VU7H 4QACA 4LF7T 2LHNA 3PJAJ 4P0AA 3KBUA 5AQVB 5AQKB 5FXWA 5JR9B 1CHUA 4HFBA 5HCJA 4CI2B 3VRAA 2G0UA 4EYUA 3GN5A 5J5HA 3PUGA 4JI4T 1Y01A 5ABGA 5LHHB 1US7B 3PURA 3PUSA 5AQOB 3SS1A 1LVKA 4L0RA 4DUZT 4COFA 2YOEA 4O4IE 3F2EA 3Q5XA 1T98A 2OV9A 3V5SA 2YKSA 3UU5A 2MAWA 5LG3A 5ADXL 2Q9QA 4IE0A 3GWHA 3KVBA 1FIOA 4BAYB 3T1HT 3TLTA 4L9IA 4UF0A 3LK42 5BW2A 5AQJB 3UT5E 4EZHA 5LMUT 4LF8T 2OLTA 1SA0E 2BS3A 5ABFA 5HCMA 1FJGT 2C5JA 4IE6A 1HS7A 4B3RT 2UUBT 2X51A 3SIOA 2A2FX 2YK0A 3WAJA 4WW0A 1HCIA 5ABFB 4OX9T 1WR0A 3A7MA 2XJ7A 3LDQB 4QHOA 1CUNA 5ABHA 4AKRB 4F8HA 2ZM0A 1UW6A 2XQ5A 4ZS3A 3KVAA 2BS4A 3KINB 3ESLA 4PJJA 1T72A 2XAJB 2NR4A 3SOLA 2CE7A 2CEAA 2XPKA 3ZT7A 2BBHA 3LK2B 2E9XC 4HFEA 2H7VC 4YFSA 5AQHB 3F31A 5JH7E 1HNXT 4KHPT 3RQUA 3SQ9A 3BQLA 3X1DA 1KNZA 5HWXA 3ZCJA 2A3DA 2MYSA 1MNEA 2WZHA 3EAMA 4DR1T 3OYXA 5FY0A 4NIQA 1I9BA 4YSZA 4U74A 4DMVA 1L0VA 4IDOA 4EZ4A 2X9WA 4H9SE 4JEHB 4QH5A 2ZJUA 5KXJA 4ILBA 3AA0B 2WSSV 3NZQA 1VCTA 4OHFA 5CA1E 2BYSA 2PJQA 4ADZA 4IGUA 4IL9A 2FJDA 4I43B 1N32T 3C4ZA 4QXBB 4UVBB 4DV4T 3OYZA 2D5UA 4B3MT 4JI2T 2WP9A 2NP9A 2CBJA 4XK9A 5AFNA 2CA5A 3GMIA 4PFOA 3IHRA 5JVDE 1HFAA 3L8RA 2LOPA 2UXBT 2KZ7B 2WBLA 4WZXA 5KMGP 1OXZA 1MNDA 2BZBA 5CGMA 1DU2A 4TZ4C 1WFDA 4JI7T 4AXPA 3VRBA 2FUPA 4UR9A 3RKGA 3DTOA 2QVAA 3CK6A 2ACXA 4CZZB 2XAGB 3H3MA 3R6NA 4QH4A 1N36T 1YXRA 3WTHA 4HTEA 4NZBA 3RF1A 4YLHA 4UELA 2Y58A 2JRKA 4NUVA 5KDMC 5FJVA 3NBXX 1UX4A 4AQFC 1E7PA 3RI5A 1BR2A 3OPCA 1FEWA 1IJ6A 3BQKA 4XHEA 2AXDS 1Z0PA 2M6BA 4B5DA 4HFVA 4EYYR 1HF8A 4AKGA 2CBIA 2ACZA 5LBQB 1IBLT 2JQQA 3Q5WA 4H63V 4H9OC 3RYHE 3S4UA 3RX6A 5JTGA 2VVNA 2WN9A 4ZI2D 4DR2T 4BQTA 1J5ET 1HTJF 4ILCA 2XHEB 2Y57A 2QGSA 5AQRB 4QXHB 1QUUA 4O4LE 3A5XA 4ZK1A 4ILAA 3O1HA 5ABEA 4KBMB 5FNVE 2D2SA 4X62T 3FB2A 2M67A 3FXEB 3CMLA 4IHJE 5H6QB 3PUQA 4CN6A 5JDGA 2E9XD 3AEDA 3OVUA 1D1CA 3FXDB 5LA6E 1M7KA 4E7ZA 4HKAA 2KSRA 2BJ0A 4MALA 4LF9T 3NZPA 4PAGA 2YN6A 3T4MA 4P09A 2VKJA 3KV4A 2IUBA 2LKHA 2Y56A 5FKYA 4K0KT 1Z8UA 3RH3A 1WR6A 3U8KA 1I6ZA 1G8XA 4ZOLE 4U2ZA 2MBGA 4YSYA 3CPZA 2RPAA 2E9XA 2W2UA 3H37A 4DBRA 2X00D 3WTNA 5BP0A 5L2LA 3U3IA 2XQ8A 3RYCE 3RKOA 2A72A 2JQKA 5KX5E 4UVCB 4AQYT 5LHGB 4UM3P 4YTMA 1IJ5A 3U8JA 4YSXA 2CHOA 2V6YA 4ERRA 2N2NA 3EDVA 2BYQA 5L4EA 4DV3T 2IMLA 2OA5A 3H3AA 3U8MA 5AQSB 2LKGA 5JRCA 5L4HA 3PUZF 2LSIA 1BR1A 1ZKEA 3SFEA 2XSBA 5LGNB 2XM2A 1UV6A 5HXCA 3C51A 3FZFB 2HPLA 3B57A 3V5UA 3ZSTA 1UK5A 4TWHA 2ODVA 2BR7A 4JI0T 3ZMUB 3AE9A 3KV6A 4X1IE
chains in the Genus database with same CATH topology
2KSRA 4UXUA 4Z90A 3EI0A 3RQUA 2BJ0A 2UZ6A 4UM3A 5AFJA 3SQ9A 4AFTA 2YN6A 2YKSA 3UU5A 3T4MA 5J5GA 2MAWA 4HFCA 5LG3A 2WNJA 3JAEA 3RQWA 3RHWA 3P4WA 4Z91A 4TNWA 4QH4A 2LKHA 3WTHA 2Y56A 4AFHA 4WV9A 3UU3A 3EAMA 2XYTA 4NZBA 2LM2A 5SYOA 4AFGA 4HFHA 5L47A 3UU4A 3TLWA 4LMLA 4TNVA 2PGZA 5BRXA 4QH1A 1I9BA 5CO5A 3U8KA 3TLTA 3UU8A 2Y58A 3WTKA 4TWFA 5FJVA 4LMJA 3ZDHA 5BW2A 3WTMA 4QABA 4X5TA 2M6IA 3P50A 4ZRUA 5AFLA 2QC1B 5AINA 4ZR6A 2WNCA 3RI5A 2VL0A 4UY2A 1OEDB 2X00A 2WZYA 3UQ4A 3WTLA 2W8FA 4DBMA 4XHEA 2X00D 2BG9A 2XQ6A 3WTNA 5BP0A 2YMEA 4HFIA 5HCMA 5AFHA 2XQ8A 4QH5A 2ZJUA 2M6BA 4ALXA 4ZZCA 3C79A 4ILBA 2C9TA 3UU6A 4B5DA 2XNVA 4PIRA 4ZJTA 2XQ4A 5J5IA 3SIOA 2BYSA 3SQ6A 3TLUA 3GUAA 4UM3P 3U8LA 4IL9A 4ZZBA 2XQ9A 3U8JA 2W8GA 3WTOA 2BG9B 5JMEA 5HEGA 3LSVA 4QACA 1OEDA 2WN9A 3UUBA 3RIAA 2BYQA 5L4EA 1OEDC 3U8MA 3ZKRA 5AFMA 4BQTA 4IL4A 5HEOA 4A97A 4F8HA 1UW6A 2YMDA 3SH1A 2XQ5A 5AFKA 2LKGA 4HFBA 4ILCA 5HCJA 2Y54A 2Y57A 3UQ7A 4FRRA 5L4HA 4XK9A 1OEDE 5LXBA 3WIPA 5AFNA 4ZK4A 2Y7YA 5J5HA 2BG9E 2WNLA 4ZJSA 3EHZA 4ZK1A 5HEUA 4ILAA 2XNTA 3C84A 5CFBA 4D01A 5HEHA 2PH9A 2XQ7A 2XQ3A 1UV6A 4QAAA 3JAFA 4NPPA 2BYRA 2XYSA 2XZ6A 2XQAA 3TLVA 3RIFA 4BFQA 2BG9C 5KE4A 3ZDGA 4TWHA 5HEJA 3U8NA 5J0ZA 2XZ5A 4IREA 2XNUA 4HFEA 5J5FA 4EZ1A 2LLYA 3WTJA 3PMZA 4HQPA 2ZJVA 2BR7A 3WTIA 1UX2A 5IUXA 2BR8A 3JADA 4TWDA 5TVCA 4HFDA 4A98A 4COFA 2YOEA 4UM1A 4UM3S 5AFMB 3TLSA 3IGQA 2BYNA 2BYPA 4LMKA 3PEOA 5KZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSR A;  4UXU A;  4Z90 A;  3EI0 A;  3RQU A;  2BJ0 A;  2UZ6 A;  4UM3 A;  5AFJ A;  3SQ9 A;  4AFT A;  2YN6 A;  2YKS A;  3UU5 A;  3T4M A;  5J5G A;  2MAW A;  4HFC A;  5LG3 A;  2WNJ A;  3JAE A;  3RQW A;  3RHW A;  3P4W A;  4Z91 A;  4TNW A;  4QH4 A;  2LKH A;  3WTH A;  2Y56 A;  4AFH A;  4WV9 A;  3UU3 A;  3EAM A;  2XYT A;  4NZB A;  2LM2 A;  5SYO A;  4AFG A;  4HFH A;  5L47 A;  3UU4 A;  3TLW A;  4LML A;  4TNV A;  2PGZ A;  5BRX A;  4QH1 A;  1I9B A;  5CO5 A;  3U8K A;  3TLT A;  3UU8 A;  2Y58 A;  3WTK A;  4TWF A;  5FJV A;  4LMJ A;  3ZDH A;  5BW2 A;  3WTM A;  4QAB A;  4X5T A;  2M6I A;  3P50 A;  4ZRU A;  5AFL A;  2QC1 B;  5AIN A;  4ZR6 A;  2WNC A;  3RI5 A;  2VL0 A;  4UY2 A;  1OED B;  2X00 A;  2WZY A;  3UQ4 A;  3WTL A;  2W8F A;  4DBM A;  4XHE A;  2X00 D;  2BG9 A;  2XQ6 A;  3WTN A;  5BP0 A;  2YME A;  4HFI A;  5HCM A;  5AFH A;  2XQ8 A;  4QH5 A;  2ZJU A;  2M6B A;  4ALX A;  4ZZC A;  3C79 A;  4ILB A;  2C9T A;  3UU6 A;  4B5D A;  2XNV A;  4PIR A;  4ZJT A;  2XQ4 A;  5J5I A;  3SIO A;  2BYS A;  3SQ6 A;  3TLU A;  3GUA A;  4UM3 P;  3U8L A;  4IL9 A;  4ZZB A;  2XQ9 A;  3U8J A;  2W8G A;  3WTO A;  2BG9 B;  5JME A;  5HEG A;  3LSV A;  4QAC A;  1OED A;  2WN9 A;  3UUB A;  3RIA A;  2BYQ A;  5L4E A;  1OED C;  3U8M A;  3ZKR A;  5AFM A;  4BQT A;  4IL4 A;  5HEO A;  4A97 A;  4F8H A;  1UW6 A;  2YMD A;  3SH1 A;  2XQ5 A;  5AFK A;  2LKG A;  4HFB A;  4ILC A;  5HCJ A;  2Y54 A;  2Y57 A;  3UQ7 A;  4FRR A;  5L4H A;  4XK9 A;  1OED E;  5LXB A;  3WIP A;  5AFN A;  4ZK4 A;  2Y7Y A;  5J5H A;  2BG9 E;  2WNL A;  4ZJS A;  3EHZ A;  4ZK1 A;  5HEU A;  4ILA A;  2XNT A;  3C84 A;  5CFB A;  4D01 A;  5HEH A;  2PH9 A;  2XQ7 A;  2XQ3 A;  1UV6 A;  4QAA A;  3JAF A;  4NPP A;  2BYR A;  2XYS A;  2XZ6 A;  2XQA A;  3TLV A;  3RIF A;  4BFQ A;  2BG9 C;  5KE4 A;  3ZDG A;  4TWH A;  5HEJ A;  3U8N A;  5J0Z A;  2XZ5 A;  4IRE A;  2XNU A;  4HFE A;  5J5F A;  4EZ1 A;  2LLY A;  3WTJ A;  3PMZ A;  4HQP A;  2ZJV A;  2BR7 A;  3WTI A;  1UX2 A;  5IUX A;  2BR8 A;  3JAD A;  4TWD A;  5TVC A;  4HFD A;  4A98 A;  4COF A;  2YOE A;  4UM1 A;  4UM3 S;  5AFM B;  3TLS A;  3IGQ A;  2BYN A;  2BYP A;  4LMK A;  3PEO A;  5KZU A; 
#chains in the Genus database with same CATH topology
 1UCU A;  2EHO D;  2BVM A;  5J5G A;  2BS2 A;  2E9X B;  3JAE A;  3NRY A;  2CWY A;  2W66 A;  2LM2 A;  4AFG A;  3TLW A;  4GIW A;  3I0O A;  1B7T A;  4KMC A;  3LFM A;  4TV9 E;  4J2C A;  4JI8 T;  3UFG A;  3RRW A;  1MMD A;  3ZMT B;  2L8K A;  2D0U A;  2MOZ A;  4PK6 A;  4QXC B;  1OWA A;  1SE7 A;  3O1J A;  3HKB E;  4X66 T;  3TLU A;  1G73 A;  1GQE A;  2N1G A;  5IYZ E;  2V8S V;  3D0T A;  2KND A;  3VKH A;  2DLR A;  2DWK A;  4YTP A;  5AFK A;  4FRR A;  2Y54 A;  3QOF A;  4Q25 A;  4YHH T;  2CM0 A;  4DR4 T;  1WYB A;  4U3C A;  4EB6 E;  1E1H B;  2XQ3 A;  3AAE B;  4H63 H;  1IAP A;  2CCQ A;  2BKP A;  3QB5 K;  1XNQ T;  4B3T T;  3KDS E;  2B76 A;  2WMN A;  5DAB A;  4HN9 A;  4X65 T;  5HWY A;  1WCR A;  5LNK A;  3ZEF B;  4UM3 S;  5L3B B;  4O8S A;  1SUM B;  2BYP A;  4I4T E;  2YU1 A;  2JJ9 A;  3AAA B;  3BK9 A;  4V1A v;  4Z90 A;  3EI0 A;  2LSY A;  1ZP0 A;  2KIN B;  1HNW T;  1YKH B;  4DVD A;  4WV9 A;  2KXP B;  3VR8 A;  2K3W A;  2W0G A;  5F3J A;  1KK7 A;  4NUU A;  4HWD A;  2X9H A;  4QAB A;  3OTO T;  2I6H A;  3P50 A;  4ZRU A;  3OJA A;  3CQC B;  4IDP A;  3IBP A;  2BG9 A;  2C5I T;  4KHZ F;  4HFI A;  3VR9 A;  4JV5 T;  3UU6 A;  3N9O A;  4PIR A;  3HI2 A;  3U8L A;  3MZK B;  3WTO A;  2FJB A;  5C3J A;  1FMW A;  1MMG A;  2IC6 A;  5JME A;  1OED A;  3N9N A;  2D0T A;  4DO0 A;  3QNU A;  4O4J E;  2YIN A;  3T8O A;  2W63 A;  2CLY B;  4A97 A;  3EUH A;  1N33 T;  3Q9D A;  2UXX B;  3RC3 A;  4JBW F;  3B5M A;  4N78 D;  4X1Y E;  1KEY A;  2HN2 A;  3JAF A;  2BYR A;  3SFD A;  2NOX A;  2YEV C;  2XQA A;  2XUE A;  1YQ4 A;  3FZM B;  3TLV A;  4GK5 E;  3PJA A;  4CI3 B;  5FYM A;  3P7I A;  2DWG A;  5ETW A;  3C98 B;  5JDF A;  5CA0 E;  3ONX A;  4UF0 B;  2WWV A;  4EV6 A;  4UM1 A;  3CWZ B;  3ZC1 A;  1D0Z A;  5TAO A;  5KZU A;  4CXW A;  4DV6 T;  4AKI A;  2H88 A;  2IDO B;  3N2O A;  2WWU A;  1T8B A;  2SPC A;  4PK4 A;  4PJM A;  2LRL A;  4CN4 A;  2X0L B;  3PU3 A;  2IHR 1;  3N9P A;  4HGA A;  5JDQ A;  4X5T A;  3RRC A;  5J1G A;  4DMW A;  2WDV A;  1JNZ A;  4KI0 F;  2W8F A;  1KNR A;  4QX7 B;  5L3D B;  4YT0 A;  2C9T A;  3SQ6 A;  3AXJ B;  3GUA A;  3PUV F;  4XBF B;  1E2A A;  4GYS A;  1FMV A;  2CXF A;  4FJO A;  5HEG A;  3UUX B;  1W0B A;  3LBX A;  3VKG A;  5LCY A;  5LXB A;  1SHZ C;  3LK3 B;  3CX8 B;  4D01 A;  2WU5 A;  4H9R C;  5GON E;  2R6G F;  5HEH A;  4ZI3 D;  3C64 A;  2QA7 A;  2PG8 A;  3U78 A;  1WYC A;  3ZDG A;  5HEJ A;  4GK0 E;  2LHR A;  2N9D A;  1D1A A;  2RA1 A;  4QKN A;  2XZ5 A;  3PUX F;  3C4X A;  4IDQ A;  2NTY A;  2WMO A;  3ZT6 A;  3P4R A;  5FP3 A;  4DV0 T;  4ZI2 C;  3ONL C;  4DR3 T;  4OYJ A;  2Z6E A;  3PTR B;  4HFC A;  2LRK A;  3HKE E;  3AE2 A;  4TNW A;  4DID B;  2LOS A;  4ZEY A;  4PNI A;  2Q9Q B;  2FJA A;  3ZN0 B;  4EXT A;  3K1S A;  3MKD A;  4ZI7 E;  3ZJ1 A;  2VL0 A;  4UY2 A;  1OED B;  3UQ4 A;  5JDM A;  5FMN A;  3AEB A;  5LB7 B;  3FZK B;  3ZMV B;  5HYA A;  3K8P C;  5M4Y A;  2ZM8 A;  5CB4 E;  4CI1 B;  3P4Q A;  1KFY A;  2BG9 B;  2VAS A;  3PDY A;  1YD8 G;  5EK4 A;  2VB6 A;  4B3S T;  3CKD A;  3CX7 B;  4ILU A;  4U31 A;  3UQ7 A;  5JRC B;  4AKH A;  4ZK4 A;  3ZCI A;  2K9A A;  2V5C A;  4DV2 T;  1NWM X;  2GK9 A;  2XNT A;  5LP6 E;  2VQE T;  3SRZ A;  2WY2 A;  2YU2 A;  4I50 E;  3MAC A;  4BA9 A;  3P8C D;  3DP7 A;  4EZ1 A;  4DV1 T;  2CLY C;  5CJ5 A;  3K3O A;  3W15 B;  1I94 T;  3PE0 A;  2WAU A;  1NAF A;  2UXC T;  2CXL A;  2V7M A;  5AQQ B;  2LSJ A;  3ZT5 A;  2V7K A;  3I0Q A;  3P4P A;  4DR7 T;  1U4Q A;  2WNJ A;  3IF8 B;  1VCS A;  2VUR A;  5BRX A;  5SYO A;  2JQ9 A;  2V7J A;  3UU4 A;  4IST A;  2HN1 A;  4DBQ A;  5FXZ A;  2CHN A;  2J4G A;  2AE9 A;  2W61 A;  1NEN A;  3L39 A;  4IE4 A;  2CMR A;  5AFL A;  3E22 E;  5JRE A;  4IDZ A;  2ZMA A;  3T1Y T;  2RP4 A;  4JI5 T;  4GOU A;  4DV5 T;  1BR4 A;  3UUL A;  4HEA A;  5FXX A;  3NVO A;  5FY7 A;  2H3R A;  1HX8 A;  4MHC A;  1N34 T;  4H9N C;  5LHI B;  2EHO C;  2E8I A;  3CX6 B;  1J1J A;  4LF4 T;  2YDQ A;  5DQW A;  3HA4 A;  3AAI A;  2LE8 A;  2W4X A;  4ISS A;  3SH1 A;  2C5K T;  1OED E;  3KBT A;  4AI6 A;  1HG5 A;  5C8Y E;  4OFZ A;  4UVA B;  3QC9 A;  3NWI A;  4CXY A;  4KUM B;  4X64 T;  2BG9 C;  2W67 A;  4AQG A;  4P1N A;  3U8N A;  4I55 E;  2JMH A;  3ETV A;  2FBW A;  4TUY E;  4HQP A;  3MA9 A;  1UX2 A;  2V26 A;  5AQM B;  4O4H E;  3FZL B;  2BYN A;  4LMK A;  4EEB A;  4H9P C;  4JI3 T;  4UM3 A;  2DHR A;  4ASK A;  4UXN B;  1VRB A;  3RQW A;  2BBJ A;  2C0S A;  3I9Y A;  3LJC A;  2W00 A;  1IZN B;  2UXD T;  3UU3 A;  4BJM A;  1HX1 B;  3KFW X;  3I1A A;  4KP3 C;  3ZDH A;  3AA7 B;  2B1E A;  1X79 A;  2QC1 B;  3QK6 A;  5A1L A;  4MLK A;  2X00 A;  5L3C B;  5E0O A;  4IE7 A;  2LEH A;  4CN1 A;  1QSD A;  3C79 A;  3AA6 B;  1MMA A;  2UUA T;  4OYK A;  4ZZB A;  1V9D A;  4ANJ A;  3LSV A;  3G06 A;  3RIA A;  2XY8 B;  2IAK A;  5LMN T;  5FL1 A;  4EED A;  3UUN A;  3AE1 A;  4NXM T;  2WU2 A;  2Y7Y A;  3C84 A;  1XMO T;  2CRB A;  2XQ7 A;  2XYS A;  3RIF A;  4YJ2 E;  2NW7 A;  1KF6 A;  4BFQ A;  1U5P A;  2V7L A;  3P4S A;  5KE4 A;  1HNZ T;  2JPF A;  5LYJ E;  3ZSS A;  4OK0 A;  1T7S A;  3WTJ A;  4WNK A;  3C4W A;  5IUX A;  4LFC T;  4AFT A;  3N9Q A;  3RC8 A;  1UUS A;  3N9M A;  2D9D A;  2K5B B;  1QLB A;  5IWA T;  4JI1 T;  1WRD A;  3AEE A;  4LFA T;  2IIU A;  5HXE A;  2IC9 A;  4E7S A;  3AVR A;  2CPT A;  3AE7 A;  5HAX A;  3BQI A;  4YTN A;  4TWF A;  4F6R C;  3ZJ2 A;  5DQV A;  4PJL A;  2M6I A;  2XTL A;  4O2A E;  5H6R B;  5JQG E;  3UFE A;  4XAX B;  5JR9 C;  2YME A;  4GKJ T;  4O2B E;  3EVY A;  5J5I A;  4X20 E;  1UUR A;  5FVL A;  2YDR A;  2XAQ B;  2DI4 A;  1ZOY A;  1D0X A;  3PUA A;  1ZHC A;  4L5G A;  3UUB A;  3FBL A;  3E08 A;  5DJQ C;  3PV0 F;  5FL0 A;  3HKC E;  5AFM A;  4BJN A;  4C90 A;  3WI3 A;  5EK2 A;  3VHL A;  1XMQ T;  2V1D B;  1X9B A;  3F57 A;  4JI6 T;  3CQX C;  4MBQ A;  4DUY T;  4M1P A;  2KMF A;  3AEF A;  5JDH A;  3UTK A;  2VKH A;  4ZXL A;  2VK9 A;  5J0Z A;  3UUM A;  5AQL B;  3PUW F;  3Q5D A;  2XM1 A;  4I0U A;  1IBM T;  1EZ3 A;  2PTF A;  2H89 A;  4AFH A;  5L47 A;  3RYF E;  4TNV A;  1BR0 A;  5CO5 A;  3TKL B;  1YKE B;  4HWC A;  2WM9 A;  3LBX B;  1LKX A;  3M65 A;  3WTM A;  4UV9 B;  3RLF F;  2EHO B;  3AE4 A;  3R84 B;  3N2G E;  3ZMZ B;  1R8I A;  3FBZ A;  2Q9Q D;  2XAF B;  4ZZC A;  3CIR A;  3FZH B;  2KT9 A;  2XQ4 A;  4AIS A;  4GYR A;  5FY1 A;  3O1I A;  1IBK T;  2X66 A;  2XQ9 A;  2W8G A;  4DR6 T;  4WBN E;  5F8P A;  1HG2 A;  4YXD A;  3OBV E;  3AB3 B;  1OED C;  2QRX A;  2XQY A;  1W9R A;  4CQI A;  2E5V A;  3I9W A;  3J9X 1;  5AQT B;  3WIP A;  3GN5 B;  4U2Y A;  2WNL A;  4ZJS A;  5HEU A;  3QB5 A;  4G2A A;  3RGL A;  4DR5 T;  3JC6 C;  4NPP A;  2XZ6 A;  3EDU A;  2LJL A;  2WCA A;  2FJE A;  3JC6 D;  3AEG A;  1ZV4 X;  1MMN A;  2X9X A;  3AEA A;  4AIU A;  2LLY A;  4U7I A;  3B13 A;  3EAB A;  2ZJV A;  3WTI A;  4X1K E;  2CWO A;  4TWD A;  3ANW A;  1O3X A;  2L9Q A;  5J2T E;  3TLS A;  3IGQ A;  3AVS A;  3PEO A;  5AFJ A;  1NEK A;  2UU9 T;  2Y6X A;  5AQN B;  1LRZ A;  1AJ3 A;  4HWH A;  4DV7 T;  3P4W A;  1WLX A;  3ZYL A;  4HFH A;  4Z8X A;  4HWF A;  4DND A;  3N5L A;  4YHJ A;  3IEE A;  2LM9 A;  4FI5 A;  2LSK A;  1W0A A;  5AQI B;  3AE6 A;  4B6X A;  5F5W A;  4HE8 A;  2K24 A;  3ZMS B;  4YJ3 E;  5EZY E;  1D1B A;  2EHO A;  3MJX A;  3GA8 A;  5LBM A;  2H7O A;  4K0U A;  4JLE A;  4ZJT A;  2I59 A;  4QWN B;  5LG4 A;  2XAS B;  3PU8 A;  2HPJ A;  1YQ3 A;  3ZN1 B;  1MIV A;  5FVK A;  2X0H A;  3PUY F;  4ZI3 C;  5LGT B;  3ZKR A;  4UV8 B;  3MK7 C;  5HXS A;  2J1D G;  1XDO A;  3ONJ A;  2JMK A;  1MIW A;  2BG9 E;  2E5L T;  2NWB A;  2ODU A;  1JNR A;  3O4X E;  4LF6 T;  3WAK A;  1MIY A;  3NRX A;  2V6X A;  2BKO A;  5LGU B;  4IRE A;  4HWI B;  5L3G B;  3KV5 A;  2NW8 A;  1D0Y A;  3AXJ A;  3PMZ A;  4H9Q C;  1W09 A;  2Y48 B;  3OKQ A;  2UUC T;  4IT4 A;  5BMV E;  2ZM6 T;  4UXU A;  2DL1 A;  3HKD E;  2V6Y B;  3J7Y q;  1VOM A;  2BDE A;  5AQU B;  2XSA A;  2XYT A;  4LML A;  3Q5E A;  2PFV A;  5EK3 A;  4TN7 B;  5LJN A;  2WS3 A;  4JYA T;  4PW8 A;  4UEM A;  1UX5 A;  5AIN A;  4ZR6 A;  4AKL A;  3WTL A;  5AFH A;  4TV8 E;  1ZEE A;  3N9L A;  2Q9Q C;  3ZPO A;  2NW9 A;  4KX6 A;  5AQF B;  4P0B A;  4CXX A;  2KWH A;  3K3N A;  2MTQ A;  3KV9 A;  3RYI E;  2WDQ A;  4IL4 A;  2Y8D A;  2QYW A;  2I0M A;  3ZYK A;  1KNP A;  3L3P A;  2XAH B;  2VKO A;  4EOZ B;  3EHZ A;  2X67 A;  5LJM A;  1UGO A;  4XZC A;  5J2U E;  2PH9 A;  5HXR A;  3ETU A;  4EGW A;  3AE5 A;  4QAA A;  4A5X A;  2V5D A;  3Q2M A;  5LOV E;  5AQP B;  2A9U A;  2WB5 A;  3JCF A;  4ZS2 A;  2F4V T;  2BVL A;  2XNU A;  1YW0 A;  2VVS A;  5FXV A;  3O9X A;  2K48 A;  3ABV A;  3L09 A;  3JAD A;  1XNR T;  4HFD A;  5AFM B;  4EAH A;  5AQG B;  3RPU A;  3IA3 A;  3DJB A;  3QUJ A;  3MXZ A;  2CXD A;  1XWM A;  4PK5 A;  2UXN B;  5L3F B;  3CVR A;  4Z91 A;  3FHN A;  4QX8 B;  1M62 A;  3RIU A;  3NKZ A;  2X68 A;  2ZLY A;  5JR9 A;  2JIW A;  4G63 A;  2LSG A;  4PJN A;  4LMJ A;  1XDP A;  1S94 A;  2DCF A;  2P9B A;  2WZI A;  4EIW A;  1H7C A;  4DBM A;  3SWH A;  2E2A A;  3HL6 A;  2XQ6 A;  4YY3 T;  4U72 A;  5AFU L;  2X9Y A;  4ALX A;  3CQG B;  2HHH T;  3ZC0 A;  4ZHQ E;  5HXH A;  4U33 A;  3E0Z A;  5JDL A;  4U7Y A;  3LG7 A;  2VKD A;  5L3E B;  4LF5 T;  2LT3 A;  1LVF A;  3C50 A;  2L3L A;  5HEO A;  2YMD A;  4JUY A;  2VWA A;  2WQY A;  2WDR A;  2HH7 A;  3ZYM A;  3HR0 A;  5CFB A;  2J47 A;  4IIJ E;  2BKN A;  2XZE A;  4IDN A;  5IHY A;  1J5W A;  3AE8 A;  5JDN A;  2X0Y A;  4MFR A;  4AQF A;  5J5F A;  2DNX A;  4NXN T;  3K3Q C;  4A56 A;  2J62 A;  3ZLI A;  2BR8 A;  4UIG A;  5TVC A;  2KLQ A;  4WYV A;  4A98 A;  4C91 A;  3A8Y C;  3N2K E;  2MPK A;  4LFB T;  2UZ6 A;  5LXT E;  2ES0 A;  4GKK T;  3AEC A;  3M3Z B;  3RHW A;  4WBO A;  2V7I A;  2PGZ A;  4QH1 A;  1S35 A;  3UU8 A;  2PBI A;  1HR0 T;  3WTK A;  4JEU B;  4PFP A;  2IW5 B;  2VQF T;  1Y64 B;  2WNC A;  2WZY A;  3AA1 B;  2W62 A;  3AE3 A;  2NTX A;  2YDS A;  2VL8 A;  4TX5 A;  3ANW B;  5C2T A;  2XNV A;  3RIU C;  2ZM2 A;  2JQH A;  1XZY A;  2KWI B;  5BR8 T;  4IE5 A;  3VU7 H;  4QAC A;  4LF7 T;  2LHN A;  3PJA J;  4P0A A;  3KBU A;  5AQV B;  5AQK B;  5FXW A;  5JR9 B;  1CHU A;  4HFB A;  5HCJ A;  4CI2 B;  3VRA A;  2G0U A;  4EYU A;  3GN5 A;  5J5H A;  3PUG A;  4JI4 T;  1Y01 A;  5ABG A;  5LHH B;  1US7 B;  3PUR A;  3PUS A;  5AQO B;  3SS1 A;  1LVK A;  4L0R A;  4DUZ T;  4COF A;  2YOE A;  4O4I E;  3F2E A;  3Q5X A;  1T98 A;  2OV9 A;  3V5S A;  2YKS A;  3UU5 A;  2MAW A;  5LG3 A;  5ADX L;  2Q9Q A;  4IE0 A;  3GWH A;  3KVB A;  1FIO A;  4BAY B;  3T1H T;  3TLT A;  4L9I A;  4UF0 A;  3LK4 2;  5BW2 A;  5AQJ B;  3UT5 E;  4EZH A;  5LMU T;  4LF8 T;  2OLT A;  1SA0 E;  2BS3 A;  5ABF A;  5HCM A;  1FJG T;  2C5J A;  4IE6 A;  1HS7 A;  4B3R T;  2UUB T;  2X51 A;  3SIO A;  2A2F X;  2YK0 A;  3WAJ A;  4WW0 A;  1HCI A;  5ABF B;  4OX9 T;  1WR0 A;  3A7M A;  2XJ7 A;  3LDQ B;  4QHO A;  1CUN A;  5ABH A;  4AKR B;  4F8H A;  2ZM0 A;  1UW6 A;  2XQ5 A;  4ZS3 A;  3KVA A;  2BS4 A;  3KIN B;  3ESL A;  4PJJ A;  1T72 A;  2XAJ B;  2NR4 A;  3SOL A;  2CE7 A;  2CEA A;  2XPK A;  3ZT7 A;  2BBH A;  3LK2 B;  2E9X C;  4HFE A;  2H7V C;  4YFS A;  5AQH B;  3F31 A;  5JH7 E;  1HNX T;  4KHP T;  3RQU A;  3SQ9 A;  3BQL A;  3X1D A;  1KNZ A;  5HWX A;  3ZCJ A;  2A3D A;  2MYS A;  1MNE A;  2WZH A;  3EAM A;  4DR1 T;  3OYX A;  5FY0 A;  4NIQ A;  1I9B A;  4YSZ A;  4U74 A;  4DMV A;  1L0V A;  4IDO A;  4EZ4 A;  2X9W A;  4H9S E;  4JEH B;  4QH5 A;  2ZJU A;  5KXJ A;  4ILB A;  3AA0 B;  2WSS V;  3NZQ A;  1VCT A;  4OHF A;  5CA1 E;  2BYS A;  2PJQ A;  4ADZ A;  4IGU A;  4IL9 A;  2FJD A;  4I43 B;  1N32 T;  3C4Z A;  4QXB B;  4UVB B;  4DV4 T;  3OYZ A;  2D5U A;  4B3M T;  4JI2 T;  2WP9 A;  2NP9 A;  2CBJ A;  4XK9 A;  5AFN A;  2CA5 A;  3GMI A;  4PFO A;  3IHR A;  5JVD E;  1HFA A;  3L8R A;  2LOP A;  2UXB T;  2KZ7 B;  2WBL A;  4WZX A;  5KMG P;  1OXZ A;  1MND A;  2BZB A;  5CGM A;  1DU2 A;  4TZ4 C;  1WFD A;  4JI7 T;  4AXP A;  3VRB A;  2FUP A;  4UR9 A;  3RKG A;  3DTO A;  2QVA A;  3CK6 A;  2ACX A;  4CZZ B;  2XAG B;  3H3M A;  3R6N A;  4QH4 A;  1N36 T;  1YXR A;  3WTH A;  4HTE A;  4NZB A;  3RF1 A;  4YLH A;  4UEL A;  2Y58 A;  2JRK A;  4NUV A;  5KDM C;  5FJV A;  3NBX X;  1UX4 A;  4AQF C;  1E7P A;  3RI5 A;  1BR2 A;  3OPC A;  1FEW A;  1IJ6 A;  3BQK A;  4XHE A;  2AXD S;  1Z0P A;  2M6B A;  4B5D A;  4HFV A;  4EYY R;  1HF8 A;  4AKG A;  2CBI A;  2ACZ A;  5LBQ B;  1IBL T;  2JQQ A;  3Q5W A;  4H63 V;  4H9O C;  3RYH E;  3S4U A;  3RX6 A;  5JTG A;  2VVN A;  2WN9 A;  4ZI2 D;  4DR2 T;  4BQT A;  1J5E T;  1HTJ F;  4ILC A;  2XHE B;  2Y57 A;  2QGS A;  5AQR B;  4QXH B;  1QUU A;  4O4L E;  3A5X A;  4ZK1 A;  4ILA A;  3O1H A;  5ABE A;  4KBM B;  5FNV E;  2D2S A;  4X62 T;  3FB2 A;  2M67 A;  3FXE B;  3CML A;  4IHJ E;  5H6Q B;  3PUQ A;  4CN6 A;  5JDG A;  2E9X D;  3AED A;  3OVU A;  1D1C A;  3FXD B;  5LA6 E;  1M7K A;  4E7Z A;  4HKA A;  2KSR A;  2BJ0 A;  4MAL A;  4LF9 T;  3NZP A;  4PAG A;  2YN6 A;  3T4M A;  4P09 A;  2VKJ A;  3KV4 A;  2IUB A;  2LKH A;  2Y56 A;  5FKY A;  4K0K T;  1Z8U A;  3RH3 A;  1WR6 A;  3U8K A;  1I6Z A;  1G8X A;  4ZOL E;  4U2Z A;  2MBG A;  4YSY A;  3CPZ A;  2RPA A;  2E9X A;  2W2U A;  3H37 A;  4DBR A;  2X00 D;  3WTN A;  5BP0 A;  5L2L A;  3U3I A;  2XQ8 A;  3RYC E;  3RKO A;  2A72 A;  2JQK A;  5KX5 E;  4UVC B;  4AQY T;  5LHG B;  4UM3 P;  4YTM A;  1IJ5 A;  3U8J A;  4YSX A;  2CHO A;  2V6Y A;  4ERR A;  2N2N A;  3EDV A;  2BYQ A;  5L4E A;  4DV3 T;  2IML A;  2OA5 A;  3H3A A;  3U8M A;  5AQS B;  2LKG A;  5JRC A;  5L4H A;  3PUZ F;  2LSI A;  1BR1 A;  1ZKE A;  3SFE A;  2XSB A;  5LGN B;  2XM2 A;  1UV6 A;  5HXC A;  3C51 A;  3FZF B;  2HPL A;  3B57 A;  3V5U A;  3ZST A;  1UK5 A;  4TWH A;  2ODV A;  2BR7 A;  4JI0 T;  3ZMU B;  3AE9 A;  3KV6 A;  4X1I E; 
#chains in the Genus database with same CATH homology
 2KSR A;  4UXU A;  4Z90 A;  3EI0 A;  3RQU A;  2BJ0 A;  2UZ6 A;  4UM3 A;  5AFJ A;  3SQ9 A;  4AFT A;  2YN6 A;  2YKS A;  3UU5 A;  3T4M A;  5J5G A;  2MAW A;  4HFC A;  5LG3 A;  2WNJ A;  3JAE A;  3RQW A;  3RHW A;  3P4W A;  4Z91 A;  4TNW A;  4QH4 A;  2LKH A;  3WTH A;  2Y56 A;  4AFH A;  4WV9 A;  3UU3 A;  3EAM A;  2XYT A;  4NZB A;  2LM2 A;  5SYO A;  4AFG A;  4HFH A;  5L47 A;  3UU4 A;  3TLW A;  4LML A;  4TNV A;  2PGZ A;  5BRX A;  4QH1 A;  1I9B A;  5CO5 A;  3U8K A;  3TLT A;  3UU8 A;  2Y58 A;  3WTK A;  4TWF A;  5FJV A;  4LMJ A;  3ZDH A;  5BW2 A;  3WTM A;  4QAB A;  4X5T A;  2M6I A;  3P50 A;  4ZRU A;  5AFL A;  2QC1 B;  5AIN A;  4ZR6 A;  2WNC A;  3RI5 A;  2VL0 A;  4UY2 A;  1OED B;  2X00 A;  2WZY A;  3UQ4 A;  3WTL A;  2W8F A;  4DBM A;  4XHE A;  2X00 D;  2BG9 A;  2XQ6 A;  3WTN A;  5BP0 A;  2YME A;  4HFI A;  5HCM A;  5AFH A;  2XQ8 A;  4QH5 A;  2ZJU A;  2M6B A;  4ALX A;  4ZZC A;  3C79 A;  4ILB A;  2C9T A;  3UU6 A;  4B5D A;  2XNV A;  4PIR A;  4ZJT A;  2XQ4 A;  5J5I A;  3SIO A;  2BYS A;  3SQ6 A;  3TLU A;  3GUA A;  4UM3 P;  3U8L A;  4IL9 A;  4ZZB A;  2XQ9 A;  3U8J A;  2W8G A;  3WTO A;  2BG9 B;  5JME A;  5HEG A;  3LSV A;  4QAC A;  1OED A;  2WN9 A;  3UUB A;  3RIA A;  2BYQ A;  5L4E A;  1OED C;  3U8M A;  3ZKR A;  5AFM A;  4BQT A;  4IL4 A;  5HEO A;  4A97 A;  4F8H A;  1UW6 A;  2YMD A;  3SH1 A;  2XQ5 A;  5AFK A;  2LKG A;  4HFB A;  4ILC A;  5HCJ A;  2Y54 A;  2Y57 A;  3UQ7 A;  4FRR A;  5L4H A;  4XK9 A;  1OED E;  5LXB A;  3WIP A;  5AFN A;  4ZK4 A;  2Y7Y A;  5J5H A;  2BG9 E;  2WNL A;  4ZJS A;  3EHZ A;  4ZK1 A;  5HEU A;  4ILA A;  2XNT A;  3C84 A;  5CFB A;  4D01 A;  5HEH A;  2PH9 A;  2XQ7 A;  2XQ3 A;  1UV6 A;  4QAA A;  3JAF A;  4NPP A;  2BYR A;  2XYS A;  2XZ6 A;  2XQA A;  3TLV A;  3RIF A;  4BFQ A;  2BG9 C;  5KE4 A;  3ZDG A;  4TWH A;  5HEJ A;  3U8N A;  5J0Z A;  2XZ5 A;  4IRE A;  2XNU A;  4HFE A;  5J5F A;  4EZ1 A;  2LLY A;  3WTJ A;  3PMZ A;  4HQP A;  2ZJV A;  2BR7 A;  3WTI A;  1UX2 A;  5IUX A;  2BR8 A;  3JAD A;  4TWD A;  5TVC A;  4HFD A;  4A98 A;  4COF A;  2YOE A;  4UM1 A;  4UM3 S;  5AFM B;  3TLS A;  3IGQ A;  2BYN A;  2BYP A;  4LMK A;  3PEO A;  5KZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...