3T4MA

Ac-achbp ligand binding domain mutated to human alpha-7 nachr (intermediate)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
KDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQNALVTHDGSVQYLPAQRLSFMCDPTGVDSEEGATCAVKFGSWSYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVRFYECCKEPYPDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords Soluble acetylcholine receptor
publication title Creating an alpha-7 nicotinic acetylcholine recognition domain from the acetylcholine binding protein: crystallographic and ligand selectivity analyses
pubmed doi rcsb
source organism Aplysia californica
total genus 49
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3t4mA00
3RI5A 4B5DA 1UW6A 2YOEA 3P4WA 3LSVA 2W8FA 4ALXA 5SYOA 5BP0A 4UY2A 4QACA 3TLVA 3WTNA 2C9TA 2XQ6A 4QH5A 3UU6A 4A97A 2BJ0A 3UU5A 2XNUA 3RHWA 3P50A 4QH1A 3RIFA 5LXBA 4XK9A 2XQ5A 3WTJA 3T4MA 2BR7A 5TVCA 3UU4A 5AFHA 3JADA 2XNTA 5HEUA 3U8MA 5JMEA 5KE4A 2XQ9A 4X5TA 4DBMA 4LMKA 4HQPA 2XQ4A 4NZBA 5AFMB 2XQAA 4TNWA 3PMZA 4ILAA 5AFMA 4UM3A 4IL4A 2PGZA 2Y58A 3UQ7A 4QH4A 2XQ3A 4HFIA 3TLWA 2WNJA 3WTIA 5KZUA 4HFCA 3TLTA 3UQ4A 4HFHA 4COFA 4LMLA 2XZ5A 3ZDGA 2BYSA 4TNVA 5HCJA 3EI0A 5AFJA 3ZKRA 5AFLA 2Y7YA 2QC1B 2WZYA 3U8JA 4F8HA 3ZDHA 4PIRA 2YKSA 3UU8A 4D01A 4A98A 5L47A 4QAAA 4Z91A 1UV6A 2XQ8A 3JAFA 4TWFA 5J5HA 5CFBA 3TLSA 2BG9E 2ZJUA 2XYTA 3GUAA 5J5GA 2BR8A 4ZJSA 2Y57A 3WTMA 3EHZA 2WNCA 3C79A 2BYNA 3PEOA 5J5IA 2Y54A 5BW2A 3C84A 5CO5A 4XHEA 3SH1A 4ZJTA 5HEJA 2XYSA 4HFBA 4UM3S 3SQ6A 4UM3P 3RQWA 3UU3A 2YN6A 5J5FA 2X00A 4BFQA 2VL0A 3SIOA 3WTLA 4IL9A 5LG3A 3WTKA 3IGQA 5L4HA 2BG9B 2BG9C 4AFGA 2XQ7A 2BYRA 4ZR6A 2BYPA 5HEOA 2BG9A 3JAEA 4WV9A 4ZZCA 3U8NA 5FJVA 4AFTA 2X00D 4AFHA 4NPPA 2BYQA 4ZRUA 1UX2A 2W8GA 2XZ6A 3WIPA 2UZ6A 2WNLA 4ZK1A 2YMEA 4ZK4A 5IUXA 5AFKA 4EZ1A 4TWDA 4BQTA 3WTHA 4FRRA 4UM1A 4TWHA 3U8KA 2YMDA 5HEGA 3TLUA 4IREA 4ZZBA 3UUBA 5BRXA 4ILCA 1I9BA 2XNVA 2ZJVA 3EAMA 5HCMA 3SQ9A 4HFEA 5AINA 4ILBA 5J0ZA 3WTOA 2WN9A 4HFDA 5L4EA 4UXUA 4Z90A 4LMJA 4QABA 3U8LA 2PH9A 5AFNA 3RIAA 2Y56A 3RQUA 5HEHA
chains in the Genus database with same CATH superfamily
3RI5A 4B5DA 1UW6A 2YOEA 3P4WA 3LSVA 2W8FA 4ALXA 5SYOA 5BP0A 4UY2A 4QACA 3TLVA 3WTNA 2C9TA 2XQ6A 4QH5A 3UU6A 4A97A 2BJ0A 3UU5A 2XNUA 3RHWA 3P50A 4QH1A 3RIFA 5LXBA 4XK9A 2XQ5A 3WTJA 3T4MA 2BR7A 5TVCA 3UU4A 5AFHA 3JADA 2XNTA 5HEUA 3U8MA 5JMEA 5KE4A 2XQ9A 4X5TA 4DBMA 4LMKA 4HQPA 2XQ4A 4NZBA 5AFMB 2XQAA 4TNWA 3PMZA 4ILAA 5AFMA 4UM3A 4IL4A 2PGZA 2Y58A 3UQ7A 4QH4A 2XQ3A 4HFIA 3TLWA 2WNJA 3WTIA 5KZUA 4HFCA 3TLTA 3UQ4A 4HFHA 4COFA 4LMLA 2XZ5A 3ZDGA 2BYSA 4TNVA 5HCJA 3EI0A 5AFJA 3ZKRA 5AFLA 2Y7YA 2QC1B 2WZYA 3U8JA 4F8HA 3ZDHA 4PIRA 2YKSA 3UU8A 4D01A 4A98A 5L47A 4QAAA 4Z91A 1UV6A 2XQ8A 3JAFA 4TWFA 5J5HA 5CFBA 3TLSA 2BG9E 2ZJUA 2XYTA 3GUAA 5J5GA 2BR8A 4ZJSA 2Y57A 3WTMA 3EHZA 2WNCA 3C79A 2BYNA 3PEOA 5J5IA 2Y54A 5BW2A 3C84A 5CO5A 4XHEA 3SH1A 4ZJTA 5HEJA 2XYSA 4HFBA 4UM3S 3SQ6A 4UM3P 3RQWA 3UU3A 2YN6A 5J5FA 2X00A 4BFQA 2VL0A 3SIOA 3WTLA 4IL9A 5LG3A 3WTKA 3IGQA 5L4HA 2BG9B 2BG9C 4AFGA 2XQ7A 2BYRA 4ZR6A 2BYPA 5HEOA 2BG9A 3JAEA 4WV9A 4ZZCA 3U8NA 5FJVA 4AFTA 2X00D 4AFHA 4NPPA 2BYQA 4ZRUA 1UX2A 2W8GA 2XZ6A 3WIPA 2UZ6A 2WNLA 4ZK1A 2YMEA 4ZK4A 5IUXA 5AFKA 4EZ1A 4TWDA 4BQTA 3WTHA 4FRRA 4UM1A 4TWHA 3U8KA 2YMDA 5HEGA 3TLUA 4IREA 4ZZBA 3UUBA 5BRXA 4ILCA 1I9BA 2XNVA 2ZJVA 3EAMA 5HCMA 3SQ9A 4HFEA 5AINA 4ILBA 5J0ZA 3WTOA 2WN9A 4HFDA 5L4EA 4UXUA 4Z90A 4LMJA 4QABA 3U8LA 2PH9A 5AFNA 3RIAA 2Y56A 3RQUA 5HEHA
chains in the Genus database with same CATH topology
3RI5A 4B5DA 1UW6A 2YOEA 3P4WA 3LSVA 2W8FA 4ALXA 5SYOA 5BP0A 4UY2A 4QACA 3TLVA 3WTNA 2C9TA 2XQ6A 4QH5A 3UU6A 4A97A 2BJ0A 3UU5A 2XNUA 3RHWA 3P50A 4QH1A 3RIFA 5LXBA 4XK9A 2XQ5A 3WTJA 3T4MA 2BR7A 5TVCA 3UU4A 5AFHA 3JADA 2XNTA 5HEUA 3U8MA 5JMEA 5KE4A 2XQ9A 4X5TA 4DBMA 4LMKA 4HQPA 2XQ4A 4NZBA 5AFMB 2XQAA 4TNWA 3PMZA 4ILAA 5AFMA 4UM3A 4IL4A 2PGZA 2Y58A 3UQ7A 4QH4A 2XQ3A 4HFIA 3TLWA 2WNJA 3WTIA 5KZUA 4HFCA 3TLTA 3UQ4A 4HFHA 4COFA 4LMLA 2XZ5A 3ZDGA 2BYSA 4TNVA 5HCJA 3EI0A 5AFJA 3ZKRA 5AFLA 2Y7YA 2QC1B 2WZYA 3U8JA 4F8HA 3ZDHA 4PIRA 2YKSA 3UU8A 4D01A 4A98A 5L47A 4QAAA 4Z91A 1UV6A 2XQ8A 3JAFA 4TWFA 5J5HA 5CFBA 3TLSA 2BG9E 2ZJUA 2XYTA 3GUAA 5J5GA 2BR8A 4ZJSA 2Y57A 3WTMA 3EHZA 2WNCA 3C79A 2BYNA 3PEOA 5J5IA 2Y54A 5BW2A 3C84A 5CO5A 4XHEA 3SH1A 4ZJTA 5HEJA 2XYSA 4HFBA 4UM3S 3SQ6A 4UM3P 3RQWA 3UU3A 2YN6A 5J5FA 2X00A 4BFQA 2VL0A 3SIOA 3WTLA 4IL9A 5LG3A 3WTKA 3IGQA 5L4HA 2BG9B 2BG9C 4AFGA 2XQ7A 2BYRA 4ZR6A 2BYPA 5HEOA 2BG9A 3JAEA 4WV9A 4ZZCA 3U8NA 5FJVA 4AFTA 2X00D 4AFHA 4NPPA 2BYQA 4ZRUA 1UX2A 2W8GA 2XZ6A 3WIPA 2UZ6A 2WNLA 4ZK1A 2YMEA 4ZK4A 5IUXA 5AFKA 4EZ1A 4TWDA 4BQTA 3WTHA 4FRRA 4UM1A 4TWHA 3U8KA 2YMDA 5HEGA 3TLUA 4IREA 4ZZBA 3UUBA 5BRXA 4ILCA 1I9BA 2XNVA 2ZJVA 3EAMA 5HCMA 3SQ9A 4HFEA 5AINA 4ILBA 5J0ZA 3WTOA 2WN9A 4HFDA 5L4EA 4UXUA 4Z90A 4LMJA 4QABA 3U8LA 2PH9A 5AFNA 3RIAA 2Y56A 3RQUA 5HEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RI5 A;  4B5D A;  1UW6 A;  2YOE A;  3P4W A;  3LSV A;  2W8F A;  4ALX A;  5SYO A;  5BP0 A;  4UY2 A;  4QAC A;  3TLV A;  3WTN A;  2C9T A;  2XQ6 A;  4QH5 A;  3UU6 A;  4A97 A;  2BJ0 A;  3UU5 A;  2XNU A;  3RHW A;  3P50 A;  4QH1 A;  3RIF A;  5LXB A;  4XK9 A;  2XQ5 A;  3WTJ A;  3T4M A;  2BR7 A;  5TVC A;  3UU4 A;  5AFH A;  3JAD A;  2XNT A;  5HEU A;  3U8M A;  5JME A;  5KE4 A;  2XQ9 A;  4X5T A;  4DBM A;  4LMK A;  4HQP A;  2XQ4 A;  4NZB A;  5AFM B;  2XQA A;  4TNW A;  3PMZ A;  4ILA A;  5AFM A;  4UM3 A;  4IL4 A;  2PGZ A;  2Y58 A;  3UQ7 A;  4QH4 A;  2XQ3 A;  4HFI A;  3TLW A;  2WNJ A;  3WTI A;  5KZU A;  4HFC A;  3TLT A;  3UQ4 A;  4HFH A;  4COF A;  4LML A;  2XZ5 A;  3ZDG A;  2BYS A;  4TNV A;  5HCJ A;  3EI0 A;  5AFJ A;  3ZKR A;  5AFL A;  2Y7Y A;  2QC1 B;  2WZY A;  3U8J A;  4F8H A;  3ZDH A;  4PIR A;  2YKS A;  3UU8 A;  4D01 A;  4A98 A;  5L47 A;  4QAA A;  4Z91 A;  1UV6 A;  2XQ8 A;  3JAF A;  4TWF A;  5J5H A;  5CFB A;  3TLS A;  2BG9 E;  2ZJU A;  2XYT A;  3GUA A;  5J5G A;  2BR8 A;  4ZJS A;  2Y57 A;  3WTM A;  3EHZ A;  2WNC A;  3C79 A;  2BYN A;  3PEO A;  5J5I A;  2Y54 A;  5BW2 A;  3C84 A;  5CO5 A;  4XHE A;  3SH1 A;  4ZJT A;  5HEJ A;  2XYS A;  4HFB A;  4UM3 S;  3SQ6 A;  4UM3 P;  3RQW A;  3UU3 A;  2YN6 A;  5J5F A;  2X00 A;  4BFQ A;  2VL0 A;  3SIO A;  3WTL A;  4IL9 A;  5LG3 A;  3WTK A;  3IGQ A;  5L4H A;  2BG9 B;  2BG9 C;  4AFG A;  2XQ7 A;  2BYR A;  4ZR6 A;  2BYP A;  5HEO A;  2BG9 A;  3JAE A;  4WV9 A;  4ZZC A;  3U8N A;  5FJV A;  4AFT A;  2X00 D;  4AFH A;  4NPP A;  2BYQ A;  4ZRU A;  1UX2 A;  2W8G A;  2XZ6 A;  3WIP A;  2UZ6 A;  2WNL A;  4ZK1 A;  2YME A;  4ZK4 A;  5IUX A;  5AFK A;  4EZ1 A;  4TWD A;  4BQT A;  3WTH A;  4FRR A;  4UM1 A;  4TWH A;  3U8K A;  2YMD A;  5HEG A;  3TLU A;  4IRE A;  4ZZB A;  3UUB A;  5BRX A;  4ILC A;  1I9B A;  2XNV A;  2ZJV A;  3EAM A;  5HCM A;  3SQ9 A;  4HFE A;  5AIN A;  4ILB A;  5J0Z A;  3WTO A;  2WN9 A;  4HFD A;  5L4E A;  4UXU A;  4Z90 A;  4LMJ A;  4QAB A;  3U8L A;  2PH9 A;  5AFN A;  3RIA A;  2Y56 A;  3RQU A;  5HEH A; 
#chains in the Genus database with same CATH topology
 3RI5 A;  4B5D A;  1UW6 A;  2YOE A;  3P4W A;  3LSV A;  2W8F A;  4ALX A;  5SYO A;  5BP0 A;  4UY2 A;  4QAC A;  3TLV A;  3WTN A;  2C9T A;  2XQ6 A;  4QH5 A;  3UU6 A;  4A97 A;  2BJ0 A;  3UU5 A;  2XNU A;  3RHW A;  3P50 A;  4QH1 A;  3RIF A;  5LXB A;  4XK9 A;  2XQ5 A;  3WTJ A;  3T4M A;  2BR7 A;  5TVC A;  3UU4 A;  5AFH A;  3JAD A;  2XNT A;  5HEU A;  3U8M A;  5JME A;  5KE4 A;  2XQ9 A;  4X5T A;  4DBM A;  4LMK A;  4HQP A;  2XQ4 A;  4NZB A;  5AFM B;  2XQA A;  4TNW A;  3PMZ A;  4ILA A;  5AFM A;  4UM3 A;  4IL4 A;  2PGZ A;  2Y58 A;  3UQ7 A;  4QH4 A;  2XQ3 A;  4HFI A;  3TLW A;  2WNJ A;  3WTI A;  5KZU A;  4HFC A;  3TLT A;  3UQ4 A;  4HFH A;  4COF A;  4LML A;  2XZ5 A;  3ZDG A;  2BYS A;  4TNV A;  5HCJ A;  3EI0 A;  5AFJ A;  3ZKR A;  5AFL A;  2Y7Y A;  2QC1 B;  2WZY A;  3U8J A;  4F8H A;  3ZDH A;  4PIR A;  2YKS A;  3UU8 A;  4D01 A;  4A98 A;  5L47 A;  4QAA A;  4Z91 A;  1UV6 A;  2XQ8 A;  3JAF A;  4TWF A;  5J5H A;  5CFB A;  3TLS A;  2BG9 E;  2ZJU A;  2XYT A;  3GUA A;  5J5G A;  2BR8 A;  4ZJS A;  2Y57 A;  3WTM A;  3EHZ A;  2WNC A;  3C79 A;  2BYN A;  3PEO A;  5J5I A;  2Y54 A;  5BW2 A;  3C84 A;  5CO5 A;  4XHE A;  3SH1 A;  4ZJT A;  5HEJ A;  2XYS A;  4HFB A;  4UM3 S;  3SQ6 A;  4UM3 P;  3RQW A;  3UU3 A;  2YN6 A;  5J5F A;  2X00 A;  4BFQ A;  2VL0 A;  3SIO A;  3WTL A;  4IL9 A;  5LG3 A;  3WTK A;  3IGQ A;  5L4H A;  2BG9 B;  2BG9 C;  4AFG A;  2XQ7 A;  2BYR A;  4ZR6 A;  2BYP A;  5HEO A;  2BG9 A;  3JAE A;  4WV9 A;  4ZZC A;  3U8N A;  5FJV A;  4AFT A;  2X00 D;  4AFH A;  4NPP A;  2BYQ A;  4ZRU A;  1UX2 A;  2W8G A;  2XZ6 A;  3WIP A;  2UZ6 A;  2WNL A;  4ZK1 A;  2YME A;  4ZK4 A;  5IUX A;  5AFK A;  4EZ1 A;  4TWD A;  4BQT A;  3WTH A;  4FRR A;  4UM1 A;  4TWH A;  3U8K A;  2YMD A;  5HEG A;  3TLU A;  4IRE A;  4ZZB A;  3UUB A;  5BRX A;  4ILC A;  1I9B A;  2XNV A;  2ZJV A;  3EAM A;  5HCM A;  3SQ9 A;  4HFE A;  5AIN A;  4ILB A;  5J0Z A;  3WTO A;  2WN9 A;  4HFD A;  5L4E A;  4UXU A;  4Z90 A;  4LMJ A;  4QAB A;  3U8L A;  2PH9 A;  5AFN A;  3RIA A;  2Y56 A;  3RQU A;  5HEH A; 
#chains in the Genus database with same CATH homology
 3RI5 A;  4B5D A;  1UW6 A;  2YOE A;  3P4W A;  3LSV A;  2W8F A;  4ALX A;  5SYO A;  5BP0 A;  4UY2 A;  4QAC A;  3TLV A;  3WTN A;  2C9T A;  2XQ6 A;  4QH5 A;  3UU6 A;  4A97 A;  2BJ0 A;  3UU5 A;  2XNU A;  3RHW A;  3P50 A;  4QH1 A;  3RIF A;  5LXB A;  4XK9 A;  2XQ5 A;  3WTJ A;  3T4M A;  2BR7 A;  5TVC A;  3UU4 A;  5AFH A;  3JAD A;  2XNT A;  5HEU A;  3U8M A;  5JME A;  5KE4 A;  2XQ9 A;  4X5T A;  4DBM A;  4LMK A;  4HQP A;  2XQ4 A;  4NZB A;  5AFM B;  2XQA A;  4TNW A;  3PMZ A;  4ILA A;  5AFM A;  4UM3 A;  4IL4 A;  2PGZ A;  2Y58 A;  3UQ7 A;  4QH4 A;  2XQ3 A;  4HFI A;  3TLW A;  2WNJ A;  3WTI A;  5KZU A;  4HFC A;  3TLT A;  3UQ4 A;  4HFH A;  4COF A;  4LML A;  2XZ5 A;  3ZDG A;  2BYS A;  4TNV A;  5HCJ A;  3EI0 A;  5AFJ A;  3ZKR A;  5AFL A;  2Y7Y A;  2QC1 B;  2WZY A;  3U8J A;  4F8H A;  3ZDH A;  4PIR A;  2YKS A;  3UU8 A;  4D01 A;  4A98 A;  5L47 A;  4QAA A;  4Z91 A;  1UV6 A;  2XQ8 A;  3JAF A;  4TWF A;  5J5H A;  5CFB A;  3TLS A;  2BG9 E;  2ZJU A;  2XYT A;  3GUA A;  5J5G A;  2BR8 A;  4ZJS A;  2Y57 A;  3WTM A;  3EHZ A;  2WNC A;  3C79 A;  2BYN A;  3PEO A;  5J5I A;  2Y54 A;  5BW2 A;  3C84 A;  5CO5 A;  4XHE A;  3SH1 A;  4ZJT A;  5HEJ A;  2XYS A;  4HFB A;  4UM3 S;  3SQ6 A;  4UM3 P;  3RQW A;  3UU3 A;  2YN6 A;  5J5F A;  2X00 A;  4BFQ A;  2VL0 A;  3SIO A;  3WTL A;  4IL9 A;  5LG3 A;  3WTK A;  3IGQ A;  5L4H A;  2BG9 B;  2BG9 C;  4AFG A;  2XQ7 A;  2BYR A;  4ZR6 A;  2BYP A;  5HEO A;  2BG9 A;  3JAE A;  4WV9 A;  4ZZC A;  3U8N A;  5FJV A;  4AFT A;  2X00 D;  4AFH A;  4NPP A;  2BYQ A;  4ZRU A;  1UX2 A;  2W8G A;  2XZ6 A;  3WIP A;  2UZ6 A;  2WNL A;  4ZK1 A;  2YME A;  4ZK4 A;  5IUX A;  5AFK A;  4EZ1 A;  4TWD A;  4BQT A;  3WTH A;  4FRR A;  4UM1 A;  4TWH A;  3U8K A;  2YMD A;  5HEG A;  3TLU A;  4IRE A;  4ZZB A;  3UUB A;  5BRX A;  4ILC A;  1I9B A;  2XNV A;  2ZJV A;  3EAM A;  5HCM A;  3SQ9 A;  4HFE A;  5AIN A;  4ILB A;  5J0Z A;  3WTO A;  2WN9 A;  4HFD A;  5L4E A;  4UXU A;  4Z90 A;  4LMJ A;  4QAB A;  3U8L A;  2PH9 A;  5AFN A;  3RIA A;  2Y56 A;  3RQU A;  5HEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...