3T4MA

Ac-achbp ligand binding domain mutated to human alpha-7 nachr (intermediate)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
KDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQNALVTHDGSVQYLPAQRLSFMCDPTGVDSEEGATCAVKFGSWSYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVRFYECCKEPYPDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Creating an alpha-7 nicotinic acetylcholine recognition domain from the acetylcholine binding protein: crystallographic and ligand selectivity analyses
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 49
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3t4mA00
5J0ZA 3U8KA 4AFHA 5HCJA 2BJ0A 4IL4A 4B5DA 2XNTA 2XQ3A 3JAFA 5AFNA 4XK9A 3SQ9A 2XYTA 5HCMA 2XQ7A 4XHEA 2W8GA 5TVCA 2BYSA 5HEHA 3U8MA 5L47A 1UX2A 4LMKA 5J5HA 3EI0A 4ZK1A 2YMDA 3EAMA 3TLVA 4TWHA 2WN9A 4X5TA 3T4MA 5J5FA 2BR7A 2XQ6A 5CFBA 4COFA 5JMEA 5KE4A 5AFMB 2X00D 4TWDA 5AFMA 5L4EA 3UU8A 2Y57A 4ZJSA 4IL9A 3UU5A 4ZRUA 4IREA 3RHWA 3WTMA 4QH4A 5SYOA 2BYPA 4UXUA 3UQ7A 2XQ8A 3C79A 3WTIA 3WTJA 3RIFA 4BFQA 4LMJA 5HEOA 3UUBA 1UW6A 4TNVA 3RQUA 4HFCA 3ZDGA 4ZK4A 2C9TA 5AFJA 2XZ6A 5FJVA 2WNLA 5BRXA 4AFTA 2Y7YA 3P50A 3LSVA 2BG9E 4HFEA 3TLTA 4EZ1A 4BQTA 2PH9A 4HFDA 5CO5A 4ALXA 5J5GA 4QAAA 5BP0A 3PEOA 2ZJUA 4ZZCA 4TWFA 2XQ5A 3PMZA 5AFHA 4UM1A 2BR8A 5HEUA 3U8LA 3TLUA 2XZ5A 3JAEA 4ZZBA 3C84A 3UU4A 2WNCA 2BG9C 2XNUA 2BG9B 4ILCA 3UU3A 4DBMA 2BG9A 5AFKA 2BYQA 2BYRA 5LG3A 4QACA 3RI5A 4HFHA 2YN6A 4UM3A 3SH1A 3IGQA 3UQ4A 3UU6A 2BYNA 4ZJTA 4WV9A 2X00A 4QH1A 5L4HA 2PGZA 4AFGA 3ZKRA 4FRRA 4A98A 2Y54A 2YKSA 3EHZA 5KZUA 3WTHA 2W8FA 2QC1B 4QH5A 3U8NA 2ZJVA 1UV6A 2YMEA 3TLSA 3WTKA 2XQ9A 2XQAA 4HQPA 4ILAA 5HEGA 3ZDHA 2XNVA 4QABA 3GUAA 4HFIA 4UM3S 5J5IA 4D01A 4F8HA 4LMLA 4ILBA 3WIPA 3RIAA 2Y58A 5AINA 2XQ4A 5HEJA 5AFLA 3WTNA 3JADA 3TLWA 4ZR6A 2VL0A 4UY2A 4Z91A 4NPPA 2XYSA 2WNJA 3WTOA 2Y56A 5BW2A 4NZBA 4PIRA 2WZYA 5LXBA 1I9BA 2UZ6A 4Z90A 3SIOA 4A97A 2YOEA 3U8JA 5IUXA 4TNWA 3SQ6A 3RQWA 4UM3P 3WTLA 3P4WA 4HFBA
chains in the Genus database with same CATH superfamily
5J0ZA 3U8KA 4AFHA 5HCJA 2BJ0A 4IL4A 4B5DA 2XNTA 2XQ3A 3JAFA 5AFNA 4XK9A 3SQ9A 2XYTA 5HCMA 2XQ7A 4XHEA 2W8GA 5TVCA 2BYSA 5HEHA 3U8MA 5L47A 1UX2A 4LMKA 5J5HA 3EI0A 4ZK1A 2YMDA 3EAMA 3TLVA 4TWHA 2WN9A 4X5TA 3T4MA 5J5FA 2BR7A 2XQ6A 5CFBA 4COFA 5JMEA 5KE4A 5AFMB 2X00D 4TWDA 5AFMA 5L4EA 3UU8A 2Y57A 4ZJSA 4IL9A 3UU5A 4ZRUA 4IREA 3RHWA 3WTMA 4QH4A 5SYOA 2BYPA 4UXUA 3UQ7A 2XQ8A 3C79A 3WTIA 3WTJA 3RIFA 4BFQA 4LMJA 5HEOA 3UUBA 1UW6A 4TNVA 3RQUA 4HFCA 3ZDGA 4ZK4A 2C9TA 5AFJA 2XZ6A 5FJVA 2WNLA 5BRXA 4AFTA 2Y7YA 3P50A 3LSVA 2BG9E 4HFEA 3TLTA 4EZ1A 4BQTA 2PH9A 4HFDA 5CO5A 4ALXA 5J5GA 4QAAA 5BP0A 3PEOA 2ZJUA 4ZZCA 4TWFA 2XQ5A 3PMZA 5AFHA 4UM1A 2BR8A 5HEUA 3U8LA 3TLUA 2XZ5A 3JAEA 4ZZBA 3C84A 3UU4A 2WNCA 2BG9C 2XNUA 2BG9B 4ILCA 3UU3A 4DBMA 2BG9A 5AFKA 2BYQA 2BYRA 5LG3A 4QACA 3RI5A 4HFHA 2YN6A 4UM3A 3SH1A 3IGQA 3UQ4A 3UU6A 2BYNA 4ZJTA 4WV9A 2X00A 4QH1A 5L4HA 2PGZA 4AFGA 3ZKRA 4FRRA 4A98A 2Y54A 2YKSA 3EHZA 5KZUA 3WTHA 2W8FA 2QC1B 4QH5A 3U8NA 2ZJVA 1UV6A 2YMEA 3TLSA 3WTKA 2XQ9A 2XQAA 4HQPA 4ILAA 5HEGA 3ZDHA 2XNVA 4QABA 3GUAA 4HFIA 4UM3S 5J5IA 4D01A 4F8HA 4LMLA 4ILBA 3WIPA 3RIAA 2Y58A 5AINA 2XQ4A 5HEJA 5AFLA 3WTNA 3JADA 3TLWA 4ZR6A 2VL0A 4UY2A 4Z91A 4NPPA 2XYSA 2WNJA 3WTOA 2Y56A 5BW2A 4NZBA 4PIRA 2WZYA 5LXBA 1I9BA 2UZ6A 4Z90A 3SIOA 4A97A 2YOEA 3U8JA 5IUXA 4TNWA 3SQ6A 3RQWA 4UM3P 3WTLA 3P4WA 4HFBA
chains in the Genus database with same CATH topology
5J0ZA 3U8KA 4AFHA 5HCJA 2BJ0A 4IL4A 4B5DA 2XNTA 2XQ3A 3JAFA 5AFNA 4XK9A 3SQ9A 2XYTA 5HCMA 2XQ7A 4XHEA 2W8GA 5TVCA 2BYSA 5HEHA 3U8MA 5L47A 1UX2A 4LMKA 5J5HA 3EI0A 4ZK1A 2YMDA 3EAMA 3TLVA 4TWHA 2WN9A 4X5TA 3T4MA 5J5FA 2BR7A 2XQ6A 5CFBA 4COFA 5JMEA 5KE4A 5AFMB 2X00D 4TWDA 5AFMA 5L4EA 3UU8A 2Y57A 4ZJSA 4IL9A 3UU5A 4ZRUA 4IREA 3RHWA 3WTMA 4QH4A 5SYOA 2BYPA 4UXUA 3UQ7A 2XQ8A 3C79A 3WTIA 3WTJA 3RIFA 4BFQA 4LMJA 5HEOA 3UUBA 1UW6A 4TNVA 3RQUA 4HFCA 3ZDGA 4ZK4A 2C9TA 5AFJA 2XZ6A 5FJVA 2WNLA 5BRXA 4AFTA 2Y7YA 3P50A 3LSVA 2BG9E 4HFEA 3TLTA 4EZ1A 4BQTA 2PH9A 4HFDA 5CO5A 4ALXA 5J5GA 4QAAA 5BP0A 3PEOA 2ZJUA 4ZZCA 4TWFA 2XQ5A 3PMZA 5AFHA 4UM1A 2BR8A 5HEUA 3U8LA 3TLUA 2XZ5A 3JAEA 4ZZBA 3C84A 3UU4A 2WNCA 2BG9C 2XNUA 2BG9B 4ILCA 3UU3A 4DBMA 2BG9A 5AFKA 2BYQA 2BYRA 5LG3A 4QACA 3RI5A 4HFHA 2YN6A 4UM3A 3SH1A 3IGQA 3UQ4A 3UU6A 2BYNA 4ZJTA 4WV9A 2X00A 4QH1A 5L4HA 2PGZA 4AFGA 3ZKRA 4FRRA 4A98A 2Y54A 2YKSA 3EHZA 5KZUA 3WTHA 2W8FA 2QC1B 4QH5A 3U8NA 2ZJVA 1UV6A 2YMEA 3TLSA 3WTKA 2XQ9A 2XQAA 4HQPA 4ILAA 5HEGA 3ZDHA 2XNVA 4QABA 3GUAA 4HFIA 4UM3S 5J5IA 4D01A 4F8HA 4LMLA 4ILBA 3WIPA 3RIAA 2Y58A 5AINA 2XQ4A 5HEJA 5AFLA 3WTNA 3JADA 3TLWA 4ZR6A 2VL0A 4UY2A 4Z91A 4NPPA 2XYSA 2WNJA 3WTOA 2Y56A 5BW2A 4NZBA 4PIRA 2WZYA 5LXBA 1I9BA 2UZ6A 4Z90A 3SIOA 4A97A 2YOEA 3U8JA 5IUXA 4TNWA 3SQ6A 3RQWA 4UM3P 3WTLA 3P4WA 4HFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J0Z A;  3U8K A;  4AFH A;  5HCJ A;  2BJ0 A;  4IL4 A;  4B5D A;  2XNT A;  2XQ3 A;  3JAF A;  5AFN A;  4XK9 A;  3SQ9 A;  2XYT A;  5HCM A;  2XQ7 A;  4XHE A;  2W8G A;  5TVC A;  2BYS A;  5HEH A;  3U8M A;  5L47 A;  1UX2 A;  4LMK A;  5J5H A;  3EI0 A;  4ZK1 A;  2YMD A;  3EAM A;  3TLV A;  4TWH A;  2WN9 A;  4X5T A;  3T4M A;  5J5F A;  2BR7 A;  2XQ6 A;  5CFB A;  4COF A;  5JME A;  5KE4 A;  5AFM B;  2X00 D;  4TWD A;  5AFM A;  5L4E A;  3UU8 A;  2Y57 A;  4ZJS A;  4IL9 A;  3UU5 A;  4ZRU A;  4IRE A;  3RHW A;  3WTM A;  4QH4 A;  5SYO A;  2BYP A;  4UXU A;  3UQ7 A;  2XQ8 A;  3C79 A;  3WTI A;  3WTJ A;  3RIF A;  4BFQ A;  4LMJ A;  5HEO A;  3UUB A;  1UW6 A;  4TNV A;  3RQU A;  4HFC A;  3ZDG A;  4ZK4 A;  2C9T A;  5AFJ A;  2XZ6 A;  5FJV A;  2WNL A;  5BRX A;  4AFT A;  2Y7Y A;  3P50 A;  3LSV A;  2BG9 E;  4HFE A;  3TLT A;  4EZ1 A;  4BQT A;  2PH9 A;  4HFD A;  5CO5 A;  4ALX A;  5J5G A;  4QAA A;  5BP0 A;  3PEO A;  2ZJU A;  4ZZC A;  4TWF A;  2XQ5 A;  3PMZ A;  5AFH A;  4UM1 A;  2BR8 A;  5HEU A;  3U8L A;  3TLU A;  2XZ5 A;  3JAE A;  4ZZB A;  3C84 A;  3UU4 A;  2WNC A;  2BG9 C;  2XNU A;  2BG9 B;  4ILC A;  3UU3 A;  4DBM A;  2BG9 A;  5AFK A;  2BYQ A;  2BYR A;  5LG3 A;  4QAC A;  3RI5 A;  4HFH A;  2YN6 A;  4UM3 A;  3SH1 A;  3IGQ A;  3UQ4 A;  3UU6 A;  2BYN A;  4ZJT A;  4WV9 A;  2X00 A;  4QH1 A;  5L4H A;  2PGZ A;  4AFG A;  3ZKR A;  4FRR A;  4A98 A;  2Y54 A;  2YKS A;  3EHZ A;  5KZU A;  3WTH A;  2W8F A;  2QC1 B;  4QH5 A;  3U8N A;  2ZJV A;  1UV6 A;  2YME A;  3TLS A;  3WTK A;  2XQ9 A;  2XQA A;  4HQP A;  4ILA A;  5HEG A;  3ZDH A;  2XNV A;  4QAB A;  3GUA A;  4HFI A;  4UM3 S;  5J5I A;  4D01 A;  4F8H A;  4LML A;  4ILB A;  3WIP A;  3RIA A;  2Y58 A;  5AIN A;  2XQ4 A;  5HEJ A;  5AFL A;  3WTN A;  3JAD A;  3TLW A;  4ZR6 A;  2VL0 A;  4UY2 A;  4Z91 A;  4NPP A;  2XYS A;  2WNJ A;  3WTO A;  2Y56 A;  5BW2 A;  4NZB A;  4PIR A;  2WZY A;  5LXB A;  1I9B A;  2UZ6 A;  4Z90 A;  3SIO A;  4A97 A;  2YOE A;  3U8J A;  5IUX A;  4TNW A;  3SQ6 A;  3RQW A;  4UM3 P;  3WTL A;  3P4W A;  4HFB A; 
#chains in the Genus database with same CATH topology
 5J0Z A;  3U8K A;  4AFH A;  5HCJ A;  2BJ0 A;  4IL4 A;  4B5D A;  2XNT A;  2XQ3 A;  3JAF A;  5AFN A;  4XK9 A;  3SQ9 A;  2XYT A;  5HCM A;  2XQ7 A;  4XHE A;  2W8G A;  5TVC A;  2BYS A;  5HEH A;  3U8M A;  5L47 A;  1UX2 A;  4LMK A;  5J5H A;  3EI0 A;  4ZK1 A;  2YMD A;  3EAM A;  3TLV A;  4TWH A;  2WN9 A;  4X5T A;  3T4M A;  5J5F A;  2BR7 A;  2XQ6 A;  5CFB A;  4COF A;  5JME A;  5KE4 A;  5AFM B;  2X00 D;  4TWD A;  5AFM A;  5L4E A;  3UU8 A;  2Y57 A;  4ZJS A;  4IL9 A;  3UU5 A;  4ZRU A;  4IRE A;  3RHW A;  3WTM A;  4QH4 A;  5SYO A;  2BYP A;  4UXU A;  3UQ7 A;  2XQ8 A;  3C79 A;  3WTI A;  3WTJ A;  3RIF A;  4BFQ A;  4LMJ A;  5HEO A;  3UUB A;  1UW6 A;  4TNV A;  3RQU A;  4HFC A;  3ZDG A;  4ZK4 A;  2C9T A;  5AFJ A;  2XZ6 A;  5FJV A;  2WNL A;  5BRX A;  4AFT A;  2Y7Y A;  3P50 A;  3LSV A;  2BG9 E;  4HFE A;  3TLT A;  4EZ1 A;  4BQT A;  2PH9 A;  4HFD A;  5CO5 A;  4ALX A;  5J5G A;  4QAA A;  5BP0 A;  3PEO A;  2ZJU A;  4ZZC A;  4TWF A;  2XQ5 A;  3PMZ A;  5AFH A;  4UM1 A;  2BR8 A;  5HEU A;  3U8L A;  3TLU A;  2XZ5 A;  3JAE A;  4ZZB A;  3C84 A;  3UU4 A;  2WNC A;  2BG9 C;  2XNU A;  2BG9 B;  4ILC A;  3UU3 A;  4DBM A;  2BG9 A;  5AFK A;  2BYQ A;  2BYR A;  5LG3 A;  4QAC A;  3RI5 A;  4HFH A;  2YN6 A;  4UM3 A;  3SH1 A;  3IGQ A;  3UQ4 A;  3UU6 A;  2BYN A;  4ZJT A;  4WV9 A;  2X00 A;  4QH1 A;  5L4H A;  2PGZ A;  4AFG A;  3ZKR A;  4FRR A;  4A98 A;  2Y54 A;  2YKS A;  3EHZ A;  5KZU A;  3WTH A;  2W8F A;  2QC1 B;  4QH5 A;  3U8N A;  2ZJV A;  1UV6 A;  2YME A;  3TLS A;  3WTK A;  2XQ9 A;  2XQA A;  4HQP A;  4ILA A;  5HEG A;  3ZDH A;  2XNV A;  4QAB A;  3GUA A;  4HFI A;  4UM3 S;  5J5I A;  4D01 A;  4F8H A;  4LML A;  4ILB A;  3WIP A;  3RIA A;  2Y58 A;  5AIN A;  2XQ4 A;  5HEJ A;  5AFL A;  3WTN A;  3JAD A;  3TLW A;  4ZR6 A;  2VL0 A;  4UY2 A;  4Z91 A;  4NPP A;  2XYS A;  2WNJ A;  3WTO A;  2Y56 A;  5BW2 A;  4NZB A;  4PIR A;  2WZY A;  5LXB A;  1I9B A;  2UZ6 A;  4Z90 A;  3SIO A;  4A97 A;  2YOE A;  3U8J A;  5IUX A;  4TNW A;  3SQ6 A;  3RQW A;  4UM3 P;  3WTL A;  3P4W A;  4HFB A; 
#chains in the Genus database with same CATH homology
 5J0Z A;  3U8K A;  4AFH A;  5HCJ A;  2BJ0 A;  4IL4 A;  4B5D A;  2XNT A;  2XQ3 A;  3JAF A;  5AFN A;  4XK9 A;  3SQ9 A;  2XYT A;  5HCM A;  2XQ7 A;  4XHE A;  2W8G A;  5TVC A;  2BYS A;  5HEH A;  3U8M A;  5L47 A;  1UX2 A;  4LMK A;  5J5H A;  3EI0 A;  4ZK1 A;  2YMD A;  3EAM A;  3TLV A;  4TWH A;  2WN9 A;  4X5T A;  3T4M A;  5J5F A;  2BR7 A;  2XQ6 A;  5CFB A;  4COF A;  5JME A;  5KE4 A;  5AFM B;  2X00 D;  4TWD A;  5AFM A;  5L4E A;  3UU8 A;  2Y57 A;  4ZJS A;  4IL9 A;  3UU5 A;  4ZRU A;  4IRE A;  3RHW A;  3WTM A;  4QH4 A;  5SYO A;  2BYP A;  4UXU A;  3UQ7 A;  2XQ8 A;  3C79 A;  3WTI A;  3WTJ A;  3RIF A;  4BFQ A;  4LMJ A;  5HEO A;  3UUB A;  1UW6 A;  4TNV A;  3RQU A;  4HFC A;  3ZDG A;  4ZK4 A;  2C9T A;  5AFJ A;  2XZ6 A;  5FJV A;  2WNL A;  5BRX A;  4AFT A;  2Y7Y A;  3P50 A;  3LSV A;  2BG9 E;  4HFE A;  3TLT A;  4EZ1 A;  4BQT A;  2PH9 A;  4HFD A;  5CO5 A;  4ALX A;  5J5G A;  4QAA A;  5BP0 A;  3PEO A;  2ZJU A;  4ZZC A;  4TWF A;  2XQ5 A;  3PMZ A;  5AFH A;  4UM1 A;  2BR8 A;  5HEU A;  3U8L A;  3TLU A;  2XZ5 A;  3JAE A;  4ZZB A;  3C84 A;  3UU4 A;  2WNC A;  2BG9 C;  2XNU A;  2BG9 B;  4ILC A;  3UU3 A;  4DBM A;  2BG9 A;  5AFK A;  2BYQ A;  2BYR A;  5LG3 A;  4QAC A;  3RI5 A;  4HFH A;  2YN6 A;  4UM3 A;  3SH1 A;  3IGQ A;  3UQ4 A;  3UU6 A;  2BYN A;  4ZJT A;  4WV9 A;  2X00 A;  4QH1 A;  5L4H A;  2PGZ A;  4AFG A;  3ZKR A;  4FRR A;  4A98 A;  2Y54 A;  2YKS A;  3EHZ A;  5KZU A;  3WTH A;  2W8F A;  2QC1 B;  4QH5 A;  3U8N A;  2ZJV A;  1UV6 A;  2YME A;  3TLS A;  3WTK A;  2XQ9 A;  2XQA A;  4HQP A;  4ILA A;  5HEG A;  3ZDH A;  2XNV A;  4QAB A;  3GUA A;  4HFI A;  4UM3 S;  5J5I A;  4D01 A;  4F8H A;  4LML A;  4ILB A;  3WIP A;  3RIA A;  2Y58 A;  5AIN A;  2XQ4 A;  5HEJ A;  5AFL A;  3WTN A;  3JAD A;  3TLW A;  4ZR6 A;  2VL0 A;  4UY2 A;  4Z91 A;  4NPP A;  2XYS A;  2WNJ A;  3WTO A;  2Y56 A;  5BW2 A;  4NZB A;  4PIR A;  2WZY A;  5LXB A;  1I9B A;  2UZ6 A;  4Z90 A;  3SIO A;  4A97 A;  2YOE A;  3U8J A;  5IUX A;  4TNW A;  3SQ6 A;  3RQW A;  4UM3 P;  3WTL A;  3P4W A;  4HFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...