3T4MA

Ac-achbp ligand binding domain mutated to human alpha-7 nachr (intermediate)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
b'KDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQNALVTHDGSVQYLPAQRLSFMCDPTGVDSEEGATCAVKFGSWSYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVRFYECCKEPYPDVNLVVKFRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Creating an alpha-7 nicotinic acetylcholine recognition domain from the acetylcholine binding protein: crystallographic and ligand selectivity analyses
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 49
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3t4mA00
3WTLA 5KE4A 2ZJVA 2Y57A 4Z91A 2YKSA 4TWFA 4ZZCA 2BR8A 3ZDHA 4QACA 2WNCA 2WZYA 2XQ9A 2XQAA 2YOEA 3UU8A 3GUAA 5HCMA 2YN6A 4X5TA 2BG9E 2X00A 2VL0A 3TLWA 3UQ4A 4AFGA 4HFHA 1I9BA 3TLUA 2XQ7A 4ILBA 5CO5A 4B5DA 4QH1A 5FJVA 4UY2A 3SIOA 4HFCA 2W8FA 4D01A 4F8HA 4UXUA 2BG9C 3C84A 4UM3S 2XQ6A 3U8NA 5JMEA 2BYNA 3SH1A 4LMJA 2PGZA 5J5FA 4EZ1A 3RQWA 5KZUA 5L47A 4QABA 3C79A 5BP0A 4LMKA 2WNJA 3P50A 1UV6A 3WTJA 5LG3A 3UU4A 4TNWA 4QH4A 4ZRUA 5HEJA 4COFA 4FRRA 5BW2A 5AFNA 3ZKRA 4HFEA 4LMLA 2YMEA 2BYPA 4TWDA 2XQ3A 5HEGA 4IL9A 4A98A 3WTHA 2XNVA 4DBMA 4QH5A 2BYRA 5HEHA 5LXBA 5J0ZA 3RQUA 4IL4A 3SQ6A 5AFJA 2BJ0A 4BFQA 5BRXA 3WTOA 2XNUA 2BYSA 3LSVA 2Y7YA 3U8JA 4ZZBA 3TLTA 2XQ5A 5AFKA 3JADA 4XHEA 4ALXA 4QAAA 3UU6A 3SQ9A 2X00D 5L4EA 5J5HA 4HFDA 2UZ6A 5HCJA 4AFTA 3WIPA 2XQ8A 4UM1A 4A97A 3RIAA 4XK9A 3TLVA 3PEOA 5L4HA 5AFLA 2YMDA 2WNLA 4ZJSA 3UU3A 2BG9A 4TNVA 3UUBA 4ZR6A 3IGQA 5IUXA 2BG9B 3EHZA 2XZ6A 4HQPA 2W8GA 3UQ7A 5SYOA 1UW6A 4PIRA 2Y56A 3WTNA 3JAFA 4IREA 3WTMA 2XNTA 2Y54A 4ZJTA 4HFIA 4UM3P 3RHWA 3P4WA 3PMZA 2BYQA 4UM3A 4ZK4A 5TVCA 4Z90A 3TLSA 2XYSA 4ILAA 3T4MA 4NZBA 3JAEA 4ZK1A 5CFBA 5HEUA 4TWHA 2QC1B 3RIFA 3EAMA 3U8LA 3U8KA 4BQTA 4ILCA 2C9TA 4AFHA 3WTIA 5AFMA 3U8MA 5AFHA 2XZ5A 3WTKA 5AFMB 5AINA 2XQ4A 5HEOA 4NPPA 4HFBA 3ZDGA 2ZJUA 4WV9A 3UU5A 2Y58A 1UX2A 2BR7A 5J5IA 3RI5A 2PH9A 2XYTA 5J5GA 3EI0A 2WN9A
chains in the Genus database with same CATH superfamily
3WTLA 5KE4A 2ZJVA 2Y57A 4Z91A 2YKSA 4TWFA 4ZZCA 2BR8A 3ZDHA 4QACA 2WNCA 2WZYA 2XQ9A 2XQAA 2YOEA 3UU8A 3GUAA 5HCMA 2YN6A 4X5TA 2BG9E 2X00A 2VL0A 3TLWA 3UQ4A 4AFGA 4HFHA 1I9BA 3TLUA 2XQ7A 4ILBA 5CO5A 4B5DA 4QH1A 5FJVA 4UY2A 3SIOA 4HFCA 2W8FA 4D01A 4F8HA 4UXUA 2BG9C 3C84A 4UM3S 2XQ6A 3U8NA 5JMEA 2BYNA 3SH1A 4LMJA 2PGZA 5J5FA 4EZ1A 3RQWA 5KZUA 5L47A 4QABA 3C79A 5BP0A 4LMKA 2WNJA 3P50A 1UV6A 3WTJA 5LG3A 3UU4A 4TNWA 4QH4A 4ZRUA 5HEJA 4COFA 4FRRA 5BW2A 5AFNA 3ZKRA 4HFEA 4LMLA 2YMEA 2BYPA 4TWDA 2XQ3A 5HEGA 4IL9A 4A98A 3WTHA 2XNVA 4DBMA 4QH5A 2BYRA 5HEHA 5LXBA 5J0ZA 3RQUA 4IL4A 3SQ6A 5AFJA 2BJ0A 4BFQA 5BRXA 3WTOA 2XNUA 2BYSA 3LSVA 2Y7YA 3U8JA 4ZZBA 3TLTA 2XQ5A 5AFKA 3JADA 4XHEA 4ALXA 4QAAA 3UU6A 3SQ9A 2X00D 5L4EA 5J5HA 4HFDA 2UZ6A 5HCJA 4AFTA 3WIPA 2XQ8A 4UM1A 4A97A 3RIAA 4XK9A 3TLVA 3PEOA 5L4HA 5AFLA 2YMDA 2WNLA 4ZJSA 3UU3A 2BG9A 4TNVA 3UUBA 4ZR6A 3IGQA 5IUXA 2BG9B 3EHZA 2XZ6A 4HQPA 2W8GA 3UQ7A 5SYOA 1UW6A 4PIRA 2Y56A 3WTNA 3JAFA 4IREA 3WTMA 2XNTA 2Y54A 4ZJTA 4HFIA 4UM3P 3RHWA 3P4WA 3PMZA 2BYQA 4UM3A 4ZK4A 5TVCA 4Z90A 3TLSA 2XYSA 4ILAA 3T4MA 4NZBA 3JAEA 4ZK1A 5CFBA 5HEUA 4TWHA 2QC1B 3RIFA 3EAMA 3U8LA 3U8KA 4BQTA 4ILCA 2C9TA 4AFHA 3WTIA 5AFMA 3U8MA 5AFHA 2XZ5A 3WTKA 5AFMB 5AINA 2XQ4A 5HEOA 4NPPA 4HFBA 3ZDGA 2ZJUA 4WV9A 3UU5A 2Y58A 1UX2A 2BR7A 5J5IA 3RI5A 2PH9A 2XYTA 5J5GA 3EI0A 2WN9A
chains in the Genus database with same CATH topology
3WTLA 5KE4A 2ZJVA 2Y57A 4Z91A 2YKSA 4TWFA 4ZZCA 2BR8A 3ZDHA 4QACA 2WNCA 2WZYA 2XQ9A 2XQAA 2YOEA 3UU8A 3GUAA 5HCMA 2YN6A 4X5TA 2BG9E 2X00A 2VL0A 3TLWA 3UQ4A 4AFGA 4HFHA 1I9BA 3TLUA 2XQ7A 4ILBA 5CO5A 4B5DA 4QH1A 5FJVA 4UY2A 3SIOA 4HFCA 2W8FA 4D01A 4F8HA 4UXUA 2BG9C 3C84A 4UM3S 2XQ6A 3U8NA 5JMEA 2BYNA 3SH1A 4LMJA 2PGZA 5J5FA 4EZ1A 3RQWA 5KZUA 5L47A 4QABA 3C79A 5BP0A 4LMKA 2WNJA 3P50A 1UV6A 3WTJA 5LG3A 3UU4A 4TNWA 4QH4A 4ZRUA 5HEJA 4COFA 4FRRA 5BW2A 5AFNA 3ZKRA 4HFEA 4LMLA 2YMEA 2BYPA 4TWDA 2XQ3A 5HEGA 4IL9A 4A98A 3WTHA 2XNVA 4DBMA 4QH5A 2BYRA 5HEHA 5LXBA 5J0ZA 3RQUA 4IL4A 3SQ6A 5AFJA 2BJ0A 4BFQA 5BRXA 3WTOA 2XNUA 2BYSA 3LSVA 2Y7YA 3U8JA 4ZZBA 3TLTA 2XQ5A 5AFKA 3JADA 4XHEA 4ALXA 4QAAA 3UU6A 3SQ9A 2X00D 5L4EA 5J5HA 4HFDA 2UZ6A 5HCJA 4AFTA 3WIPA 2XQ8A 4UM1A 4A97A 3RIAA 4XK9A 3TLVA 3PEOA 5L4HA 5AFLA 2YMDA 2WNLA 4ZJSA 3UU3A 2BG9A 4TNVA 3UUBA 4ZR6A 3IGQA 5IUXA 2BG9B 3EHZA 2XZ6A 4HQPA 2W8GA 3UQ7A 5SYOA 1UW6A 4PIRA 2Y56A 3WTNA 3JAFA 4IREA 3WTMA 2XNTA 2Y54A 4ZJTA 4HFIA 4UM3P 3RHWA 3P4WA 3PMZA 2BYQA 4UM3A 4ZK4A 5TVCA 4Z90A 3TLSA 2XYSA 4ILAA 3T4MA 4NZBA 3JAEA 4ZK1A 5CFBA 5HEUA 4TWHA 2QC1B 3RIFA 3EAMA 3U8LA 3U8KA 4BQTA 4ILCA 2C9TA 4AFHA 3WTIA 5AFMA 3U8MA 5AFHA 2XZ5A 3WTKA 5AFMB 5AINA 2XQ4A 5HEOA 4NPPA 4HFBA 3ZDGA 2ZJUA 4WV9A 3UU5A 2Y58A 1UX2A 2BR7A 5J5IA 3RI5A 2PH9A 2XYTA 5J5GA 3EI0A 2WN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTL A;  5KE4 A;  2ZJV A;  2Y57 A;  4Z91 A;  2YKS A;  4TWF A;  4ZZC A;  2BR8 A;  3ZDH A;  4QAC A;  2WNC A;  2WZY A;  2XQ9 A;  2XQA A;  2YOE A;  3UU8 A;  3GUA A;  5HCM A;  2YN6 A;  4X5T A;  2BG9 E;  2X00 A;  2VL0 A;  3TLW A;  3UQ4 A;  4AFG A;  4HFH A;  1I9B A;  3TLU A;  2XQ7 A;  4ILB A;  5CO5 A;  4B5D A;  4QH1 A;  5FJV A;  4UY2 A;  3SIO A;  4HFC A;  2W8F A;  4D01 A;  4F8H A;  4UXU A;  2BG9 C;  3C84 A;  4UM3 S;  2XQ6 A;  3U8N A;  5JME A;  2BYN A;  3SH1 A;  4LMJ A;  2PGZ A;  5J5F A;  4EZ1 A;  3RQW A;  5KZU A;  5L47 A;  4QAB A;  3C79 A;  5BP0 A;  4LMK A;  2WNJ A;  3P50 A;  1UV6 A;  3WTJ A;  5LG3 A;  3UU4 A;  4TNW A;  4QH4 A;  4ZRU A;  5HEJ A;  4COF A;  4FRR A;  5BW2 A;  5AFN A;  3ZKR A;  4HFE A;  4LML A;  2YME A;  2BYP A;  4TWD A;  2XQ3 A;  5HEG A;  4IL9 A;  4A98 A;  3WTH A;  2XNV A;  4DBM A;  4QH5 A;  2BYR A;  5HEH A;  5LXB A;  5J0Z A;  3RQU A;  4IL4 A;  3SQ6 A;  5AFJ A;  2BJ0 A;  4BFQ A;  5BRX A;  3WTO A;  2XNU A;  2BYS A;  3LSV A;  2Y7Y A;  3U8J A;  4ZZB A;  3TLT A;  2XQ5 A;  5AFK A;  3JAD A;  4XHE A;  4ALX A;  4QAA A;  3UU6 A;  3SQ9 A;  2X00 D;  5L4E A;  5J5H A;  4HFD A;  2UZ6 A;  5HCJ A;  4AFT A;  3WIP A;  2XQ8 A;  4UM1 A;  4A97 A;  3RIA A;  4XK9 A;  3TLV A;  3PEO A;  5L4H A;  5AFL A;  2YMD A;  2WNL A;  4ZJS A;  3UU3 A;  2BG9 A;  4TNV A;  3UUB A;  4ZR6 A;  3IGQ A;  5IUX A;  2BG9 B;  3EHZ A;  2XZ6 A;  4HQP A;  2W8G A;  3UQ7 A;  5SYO A;  1UW6 A;  4PIR A;  2Y56 A;  3WTN A;  3JAF A;  4IRE A;  3WTM A;  2XNT A;  2Y54 A;  4ZJT A;  4HFI A;  4UM3 P;  3RHW A;  3P4W A;  3PMZ A;  2BYQ A;  4UM3 A;  4ZK4 A;  5TVC A;  4Z90 A;  3TLS A;  2XYS A;  4ILA A;  3T4M A;  4NZB A;  3JAE A;  4ZK1 A;  5CFB A;  5HEU A;  4TWH A;  2QC1 B;  3RIF A;  3EAM A;  3U8L A;  3U8K A;  4BQT A;  4ILC A;  2C9T A;  4AFH A;  3WTI A;  5AFM A;  3U8M A;  5AFH A;  2XZ5 A;  3WTK A;  5AFM B;  5AIN A;  2XQ4 A;  5HEO A;  4NPP A;  4HFB A;  3ZDG A;  2ZJU A;  4WV9 A;  3UU5 A;  2Y58 A;  1UX2 A;  2BR7 A;  5J5I A;  3RI5 A;  2PH9 A;  2XYT A;  5J5G A;  3EI0 A;  2WN9 A; 
#chains in the Genus database with same CATH topology
 3WTL A;  5KE4 A;  2ZJV A;  2Y57 A;  4Z91 A;  2YKS A;  4TWF A;  4ZZC A;  2BR8 A;  3ZDH A;  4QAC A;  2WNC A;  2WZY A;  2XQ9 A;  2XQA A;  2YOE A;  3UU8 A;  3GUA A;  5HCM A;  2YN6 A;  4X5T A;  2BG9 E;  2X00 A;  2VL0 A;  3TLW A;  3UQ4 A;  4AFG A;  4HFH A;  1I9B A;  3TLU A;  2XQ7 A;  4ILB A;  5CO5 A;  4B5D A;  4QH1 A;  5FJV A;  4UY2 A;  3SIO A;  4HFC A;  2W8F A;  4D01 A;  4F8H A;  4UXU A;  2BG9 C;  3C84 A;  4UM3 S;  2XQ6 A;  3U8N A;  5JME A;  2BYN A;  3SH1 A;  4LMJ A;  2PGZ A;  5J5F A;  4EZ1 A;  3RQW A;  5KZU A;  5L47 A;  4QAB A;  3C79 A;  5BP0 A;  4LMK A;  2WNJ A;  3P50 A;  1UV6 A;  3WTJ A;  5LG3 A;  3UU4 A;  4TNW A;  4QH4 A;  4ZRU A;  5HEJ A;  4COF A;  4FRR A;  5BW2 A;  5AFN A;  3ZKR A;  4HFE A;  4LML A;  2YME A;  2BYP A;  4TWD A;  2XQ3 A;  5HEG A;  4IL9 A;  4A98 A;  3WTH A;  2XNV A;  4DBM A;  4QH5 A;  2BYR A;  5HEH A;  5LXB A;  5J0Z A;  3RQU A;  4IL4 A;  3SQ6 A;  5AFJ A;  2BJ0 A;  4BFQ A;  5BRX A;  3WTO A;  2XNU A;  2BYS A;  3LSV A;  2Y7Y A;  3U8J A;  4ZZB A;  3TLT A;  2XQ5 A;  5AFK A;  3JAD A;  4XHE A;  4ALX A;  4QAA A;  3UU6 A;  3SQ9 A;  2X00 D;  5L4E A;  5J5H A;  4HFD A;  2UZ6 A;  5HCJ A;  4AFT A;  3WIP A;  2XQ8 A;  4UM1 A;  4A97 A;  3RIA A;  4XK9 A;  3TLV A;  3PEO A;  5L4H A;  5AFL A;  2YMD A;  2WNL A;  4ZJS A;  3UU3 A;  2BG9 A;  4TNV A;  3UUB A;  4ZR6 A;  3IGQ A;  5IUX A;  2BG9 B;  3EHZ A;  2XZ6 A;  4HQP A;  2W8G A;  3UQ7 A;  5SYO A;  1UW6 A;  4PIR A;  2Y56 A;  3WTN A;  3JAF A;  4IRE A;  3WTM A;  2XNT A;  2Y54 A;  4ZJT A;  4HFI A;  4UM3 P;  3RHW A;  3P4W A;  3PMZ A;  2BYQ A;  4UM3 A;  4ZK4 A;  5TVC A;  4Z90 A;  3TLS A;  2XYS A;  4ILA A;  3T4M A;  4NZB A;  3JAE A;  4ZK1 A;  5CFB A;  5HEU A;  4TWH A;  2QC1 B;  3RIF A;  3EAM A;  3U8L A;  3U8K A;  4BQT A;  4ILC A;  2C9T A;  4AFH A;  3WTI A;  5AFM A;  3U8M A;  5AFH A;  2XZ5 A;  3WTK A;  5AFM B;  5AIN A;  2XQ4 A;  5HEO A;  4NPP A;  4HFB A;  3ZDG A;  2ZJU A;  4WV9 A;  3UU5 A;  2Y58 A;  1UX2 A;  2BR7 A;  5J5I A;  3RI5 A;  2PH9 A;  2XYT A;  5J5G A;  3EI0 A;  2WN9 A; 
#chains in the Genus database with same CATH homology
 3WTL A;  5KE4 A;  2ZJV A;  2Y57 A;  4Z91 A;  2YKS A;  4TWF A;  4ZZC A;  2BR8 A;  3ZDH A;  4QAC A;  2WNC A;  2WZY A;  2XQ9 A;  2XQA A;  2YOE A;  3UU8 A;  3GUA A;  5HCM A;  2YN6 A;  4X5T A;  2BG9 E;  2X00 A;  2VL0 A;  3TLW A;  3UQ4 A;  4AFG A;  4HFH A;  1I9B A;  3TLU A;  2XQ7 A;  4ILB A;  5CO5 A;  4B5D A;  4QH1 A;  5FJV A;  4UY2 A;  3SIO A;  4HFC A;  2W8F A;  4D01 A;  4F8H A;  4UXU A;  2BG9 C;  3C84 A;  4UM3 S;  2XQ6 A;  3U8N A;  5JME A;  2BYN A;  3SH1 A;  4LMJ A;  2PGZ A;  5J5F A;  4EZ1 A;  3RQW A;  5KZU A;  5L47 A;  4QAB A;  3C79 A;  5BP0 A;  4LMK A;  2WNJ A;  3P50 A;  1UV6 A;  3WTJ A;  5LG3 A;  3UU4 A;  4TNW A;  4QH4 A;  4ZRU A;  5HEJ A;  4COF A;  4FRR A;  5BW2 A;  5AFN A;  3ZKR A;  4HFE A;  4LML A;  2YME A;  2BYP A;  4TWD A;  2XQ3 A;  5HEG A;  4IL9 A;  4A98 A;  3WTH A;  2XNV A;  4DBM A;  4QH5 A;  2BYR A;  5HEH A;  5LXB A;  5J0Z A;  3RQU A;  4IL4 A;  3SQ6 A;  5AFJ A;  2BJ0 A;  4BFQ A;  5BRX A;  3WTO A;  2XNU A;  2BYS A;  3LSV A;  2Y7Y A;  3U8J A;  4ZZB A;  3TLT A;  2XQ5 A;  5AFK A;  3JAD A;  4XHE A;  4ALX A;  4QAA A;  3UU6 A;  3SQ9 A;  2X00 D;  5L4E A;  5J5H A;  4HFD A;  2UZ6 A;  5HCJ A;  4AFT A;  3WIP A;  2XQ8 A;  4UM1 A;  4A97 A;  3RIA A;  4XK9 A;  3TLV A;  3PEO A;  5L4H A;  5AFL A;  2YMD A;  2WNL A;  4ZJS A;  3UU3 A;  2BG9 A;  4TNV A;  3UUB A;  4ZR6 A;  3IGQ A;  5IUX A;  2BG9 B;  3EHZ A;  2XZ6 A;  4HQP A;  2W8G A;  3UQ7 A;  5SYO A;  1UW6 A;  4PIR A;  2Y56 A;  3WTN A;  3JAF A;  4IRE A;  3WTM A;  2XNT A;  2Y54 A;  4ZJT A;  4HFI A;  4UM3 P;  3RHW A;  3P4W A;  3PMZ A;  2BYQ A;  4UM3 A;  4ZK4 A;  5TVC A;  4Z90 A;  3TLS A;  2XYS A;  4ILA A;  3T4M A;  4NZB A;  3JAE A;  4ZK1 A;  5CFB A;  5HEU A;  4TWH A;  2QC1 B;  3RIF A;  3EAM A;  3U8L A;  3U8K A;  4BQT A;  4ILC A;  2C9T A;  4AFH A;  3WTI A;  5AFM A;  3U8M A;  5AFH A;  2XZ5 A;  3WTK A;  5AFM B;  5AIN A;  2XQ4 A;  5HEO A;  4NPP A;  4HFB A;  3ZDG A;  2ZJU A;  4WV9 A;  3UU5 A;  2Y58 A;  1UX2 A;  2BR7 A;  5J5I A;  3RI5 A;  2PH9 A;  2XYT A;  5J5G A;  3EI0 A;  2WN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...