2QC1B

Crystal structure of the extracellular domain of the nicotinic acetylcholine receptor 1 subunit bound to alpha-bungarotoxin at 1.9 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
KSEHETRLEAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTRTYDGSAVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-bungarotoxin
publication title Crystal structure of the extracellular domain of nAChR alpha1 bound to alpha-bungarotoxin at 1.94 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 46
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2qc1B00
2UZ6A 4NPPA 2BG9E 3U8KA 4F8HA 5J0ZA 3RQWA 3WTHA 3UQ7A 3EI0A 3WTNA 3TLSA 3TLUA 4TNWA 3U8JA 5J5IA 2XNUA 4HFBA 3RIFA 3JADA 4IL9A 3UUBA 4ZRUA 2BYQA 2WNJA 4ALXA 2BYPA 2Y54A 4XHEA 2BYSA 4EZ1A 2WNCA 4ZZBA 2WZYA 2VL0A 5IUXA 2BJ0A 4TWHA 5AFNA 5HCJA 2XQ6A 5LG3A 3ZDHA 3UU3A 3RHWA 3WTIA 4B5DA 3PEOA 5HEJA 3P4WA 4HFEA 4ZJSA 4ZJTA 3UU4A 5J5GA 4COFA 1UV6A 2X00A 2XQ4A 4HFHA 4ILCA 5KE4A 2ZJUA 4PIRA 2WNLA 4D01A 4BQTA 4AFHA 3C84A 5JMEA 2XZ6A 3EHZA 3UQ4A 4ZR6A 2BG9A 4Z91A 2Y7YA 4UXUA 3SH1A 3WIPA 5AFHA 2W8GA 4QH4A 5CO5A 1UW6A 3SQ6A 5AFMB 2XZ5A 4LMKA 4QACA 3U8LA 3WTMA 5BRXA 3WTKA 4A97A 5SYOA 2Y58A 3UU5A 3RIAA 5LXBA 2YN6A 3EAMA 5BP0A 1UX2A 5HEUA 2XQAA 4HFCA 3U8MA 3TLVA 2Y56A 2XQ9A 5KZUA 5HCMA 4WV9A 4UM3A 4TWDA 4QAAA 4UM3P 2W8FA 2YMDA 2YKSA 3WTJA 4DBMA 5HEOA 4X5TA 5L47A 5BW2A 4TWFA 4HFDA 5AFJA 2XYSA 3T4MA 2Y57A 3ZDGA 4ILBA 4ZZCA 4QH1A 3UU8A 3C79A 3RQUA 5L4HA 3UU6A 3JAEA 3TLWA 4BFQA 2YOEA 3LSVA 2WN9A 1I9BA 4LMLA 5J5FA 4AFGA 4ILAA 3JAFA 2BG9B 3SQ9A 2XQ5A 4XK9A 3SIOA 4QH5A 4FRRA 3TLTA 2ZJVA 3WTOA 2BYRA 2QC1B 4HFIA 2XQ7A 4IREA 2YMEA 2BR7A 3RI5A 2XQ8A 4LMJA 5AFKA 3WTLA 4HQPA 2BYNA 5TVCA 5AINA 5HEGA 5AFLA 4ZK4A 2XYTA 5L4EA 3GUAA 3U8NA 4TNVA 2C9TA 3ZKRA 4IL4A 4UM3S 2XNTA 4Z90A 4NZBA 3PMZA 4ZK1A 2XNVA 5J5HA 3IGQA 4A98A 2PH9A 4QABA 2BG9C 5AFMA 2BR8A 4UY2A 2X00D 4AFTA 2XQ3A 4UM1A 5FJVA 3P50A 5CFBA 2PGZA 5HEHA
chains in the Genus database with same CATH superfamily
2UZ6A 4NPPA 2BG9E 3U8KA 4F8HA 5J0ZA 3RQWA 3WTHA 3UQ7A 3EI0A 3WTNA 3TLSA 3TLUA 4TNWA 3U8JA 5J5IA 2XNUA 4HFBA 3RIFA 3JADA 4IL9A 3UUBA 4ZRUA 2BYQA 2WNJA 4ALXA 2BYPA 2Y54A 4XHEA 2BYSA 4EZ1A 2WNCA 4ZZBA 2WZYA 2VL0A 5IUXA 2BJ0A 4TWHA 5AFNA 5HCJA 2XQ6A 5LG3A 3ZDHA 3UU3A 3RHWA 3WTIA 4B5DA 3PEOA 5HEJA 3P4WA 4HFEA 4ZJSA 4ZJTA 3UU4A 5J5GA 4COFA 1UV6A 2X00A 2XQ4A 4HFHA 4ILCA 5KE4A 2ZJUA 4PIRA 2WNLA 4D01A 4BQTA 4AFHA 3C84A 5JMEA 2XZ6A 3EHZA 3UQ4A 4ZR6A 2BG9A 4Z91A 2Y7YA 4UXUA 3SH1A 3WIPA 5AFHA 2W8GA 4QH4A 5CO5A 1UW6A 3SQ6A 5AFMB 2XZ5A 4LMKA 4QACA 3U8LA 3WTMA 5BRXA 3WTKA 4A97A 5SYOA 2Y58A 3UU5A 3RIAA 5LXBA 2YN6A 3EAMA 5BP0A 1UX2A 5HEUA 2XQAA 4HFCA 3U8MA 3TLVA 2Y56A 2XQ9A 5KZUA 5HCMA 4WV9A 4UM3A 4TWDA 4QAAA 4UM3P 2W8FA 2YMDA 2YKSA 3WTJA 4DBMA 5HEOA 4X5TA 5L47A 5BW2A 4TWFA 4HFDA 5AFJA 2XYSA 3T4MA 2Y57A 3ZDGA 4ILBA 4ZZCA 4QH1A 3UU8A 3C79A 3RQUA 5L4HA 3UU6A 3JAEA 3TLWA 4BFQA 2YOEA 3LSVA 2WN9A 1I9BA 4LMLA 5J5FA 4AFGA 4ILAA 3JAFA 2BG9B 3SQ9A 2XQ5A 4XK9A 3SIOA 4QH5A 4FRRA 3TLTA 2ZJVA 3WTOA 2BYRA 2QC1B 4HFIA 2XQ7A 4IREA 2YMEA 2BR7A 3RI5A 2XQ8A 4LMJA 5AFKA 3WTLA 4HQPA 2BYNA 5TVCA 5AINA 5HEGA 5AFLA 4ZK4A 2XYTA 5L4EA 3GUAA 3U8NA 4TNVA 2C9TA 3ZKRA 4IL4A 4UM3S 2XNTA 4Z90A 4NZBA 3PMZA 4ZK1A 2XNVA 5J5HA 3IGQA 4A98A 2PH9A 4QABA 2BG9C 5AFMA 2BR8A 4UY2A 2X00D 4AFTA 2XQ3A 4UM1A 5FJVA 3P50A 5CFBA 2PGZA 5HEHA
chains in the Genus database with same CATH topology
2UZ6A 4NPPA 2BG9E 3U8KA 4F8HA 5J0ZA 3RQWA 3WTHA 3UQ7A 3EI0A 3WTNA 3TLSA 3TLUA 4TNWA 3U8JA 5J5IA 2XNUA 4HFBA 3RIFA 3JADA 4IL9A 3UUBA 4ZRUA 2BYQA 2WNJA 4ALXA 2BYPA 2Y54A 4XHEA 2BYSA 4EZ1A 2WNCA 4ZZBA 2WZYA 2VL0A 5IUXA 2BJ0A 4TWHA 5AFNA 5HCJA 2XQ6A 5LG3A 3ZDHA 3UU3A 3RHWA 3WTIA 4B5DA 3PEOA 5HEJA 3P4WA 4HFEA 4ZJSA 4ZJTA 3UU4A 5J5GA 4COFA 1UV6A 2X00A 2XQ4A 4HFHA 4ILCA 5KE4A 2ZJUA 4PIRA 2WNLA 4D01A 4BQTA 4AFHA 3C84A 5JMEA 2XZ6A 3EHZA 3UQ4A 4ZR6A 2BG9A 4Z91A 2Y7YA 4UXUA 3SH1A 3WIPA 5AFHA 2W8GA 4QH4A 5CO5A 1UW6A 3SQ6A 5AFMB 2XZ5A 4LMKA 4QACA 3U8LA 3WTMA 5BRXA 3WTKA 4A97A 5SYOA 2Y58A 3UU5A 3RIAA 5LXBA 2YN6A 3EAMA 5BP0A 1UX2A 5HEUA 2XQAA 4HFCA 3U8MA 3TLVA 2Y56A 2XQ9A 5KZUA 5HCMA 4WV9A 4UM3A 4TWDA 4QAAA 4UM3P 2W8FA 2YMDA 2YKSA 3WTJA 4DBMA 5HEOA 4X5TA 5L47A 5BW2A 4TWFA 4HFDA 5AFJA 2XYSA 3T4MA 2Y57A 3ZDGA 4ILBA 4ZZCA 4QH1A 3UU8A 3C79A 3RQUA 5L4HA 3UU6A 3JAEA 3TLWA 4BFQA 2YOEA 3LSVA 2WN9A 1I9BA 4LMLA 5J5FA 4AFGA 4ILAA 3JAFA 2BG9B 3SQ9A 2XQ5A 4XK9A 3SIOA 4QH5A 4FRRA 3TLTA 2ZJVA 3WTOA 2BYRA 2QC1B 4HFIA 2XQ7A 4IREA 2YMEA 2BR7A 3RI5A 2XQ8A 4LMJA 5AFKA 3WTLA 4HQPA 2BYNA 5TVCA 5AINA 5HEGA 5AFLA 4ZK4A 2XYTA 5L4EA 3GUAA 3U8NA 4TNVA 2C9TA 3ZKRA 4IL4A 4UM3S 2XNTA 4Z90A 4NZBA 3PMZA 4ZK1A 2XNVA 5J5HA 3IGQA 4A98A 2PH9A 4QABA 2BG9C 5AFMA 2BR8A 4UY2A 2X00D 4AFTA 2XQ3A 4UM1A 5FJVA 3P50A 5CFBA 2PGZA 5HEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ6 A;  4NPP A;  2BG9 E;  3U8K A;  4F8H A;  5J0Z A;  3RQW A;  3WTH A;  3UQ7 A;  3EI0 A;  3WTN A;  3TLS A;  3TLU A;  4TNW A;  3U8J A;  5J5I A;  2XNU A;  4HFB A;  3RIF A;  3JAD A;  4IL9 A;  3UUB A;  4ZRU A;  2BYQ A;  2WNJ A;  4ALX A;  2BYP A;  2Y54 A;  4XHE A;  2BYS A;  4EZ1 A;  2WNC A;  4ZZB A;  2WZY A;  2VL0 A;  5IUX A;  2BJ0 A;  4TWH A;  5AFN A;  5HCJ A;  2XQ6 A;  5LG3 A;  3ZDH A;  3UU3 A;  3RHW A;  3WTI A;  4B5D A;  3PEO A;  5HEJ A;  3P4W A;  4HFE A;  4ZJS A;  4ZJT A;  3UU4 A;  5J5G A;  4COF A;  1UV6 A;  2X00 A;  2XQ4 A;  4HFH A;  4ILC A;  5KE4 A;  2ZJU A;  4PIR A;  2WNL A;  4D01 A;  4BQT A;  4AFH A;  3C84 A;  5JME A;  2XZ6 A;  3EHZ A;  3UQ4 A;  4ZR6 A;  2BG9 A;  4Z91 A;  2Y7Y A;  4UXU A;  3SH1 A;  3WIP A;  5AFH A;  2W8G A;  4QH4 A;  5CO5 A;  1UW6 A;  3SQ6 A;  5AFM B;  2XZ5 A;  4LMK A;  4QAC A;  3U8L A;  3WTM A;  5BRX A;  3WTK A;  4A97 A;  5SYO A;  2Y58 A;  3UU5 A;  3RIA A;  5LXB A;  2YN6 A;  3EAM A;  5BP0 A;  1UX2 A;  5HEU A;  2XQA A;  4HFC A;  3U8M A;  3TLV A;  2Y56 A;  2XQ9 A;  5KZU A;  5HCM A;  4WV9 A;  4UM3 A;  4TWD A;  4QAA A;  4UM3 P;  2W8F A;  2YMD A;  2YKS A;  3WTJ A;  4DBM A;  5HEO A;  4X5T A;  5L47 A;  5BW2 A;  4TWF A;  4HFD A;  5AFJ A;  2XYS A;  3T4M A;  2Y57 A;  3ZDG A;  4ILB A;  4ZZC A;  4QH1 A;  3UU8 A;  3C79 A;  3RQU A;  5L4H A;  3UU6 A;  3JAE A;  3TLW A;  4BFQ A;  2YOE A;  3LSV A;  2WN9 A;  1I9B A;  4LML A;  5J5F A;  4AFG A;  4ILA A;  3JAF A;  2BG9 B;  3SQ9 A;  2XQ5 A;  4XK9 A;  3SIO A;  4QH5 A;  4FRR A;  3TLT A;  2ZJV A;  3WTO A;  2BYR A;  2QC1 B;  4HFI A;  2XQ7 A;  4IRE A;  2YME A;  2BR7 A;  3RI5 A;  2XQ8 A;  4LMJ A;  5AFK A;  3WTL A;  4HQP A;  2BYN A;  5TVC A;  5AIN A;  5HEG A;  5AFL A;  4ZK4 A;  2XYT A;  5L4E A;  3GUA A;  3U8N A;  4TNV A;  2C9T A;  3ZKR A;  4IL4 A;  4UM3 S;  2XNT A;  4Z90 A;  4NZB A;  3PMZ A;  4ZK1 A;  2XNV A;  5J5H A;  3IGQ A;  4A98 A;  2PH9 A;  4QAB A;  2BG9 C;  5AFM A;  2BR8 A;  4UY2 A;  2X00 D;  4AFT A;  2XQ3 A;  4UM1 A;  5FJV A;  3P50 A;  5CFB A;  2PGZ A;  5HEH A; 
#chains in the Genus database with same CATH topology
 2UZ6 A;  4NPP A;  2BG9 E;  3U8K A;  4F8H A;  5J0Z A;  3RQW A;  3WTH A;  3UQ7 A;  3EI0 A;  3WTN A;  3TLS A;  3TLU A;  4TNW A;  3U8J A;  5J5I A;  2XNU A;  4HFB A;  3RIF A;  3JAD A;  4IL9 A;  3UUB A;  4ZRU A;  2BYQ A;  2WNJ A;  4ALX A;  2BYP A;  2Y54 A;  4XHE A;  2BYS A;  4EZ1 A;  2WNC A;  4ZZB A;  2WZY A;  2VL0 A;  5IUX A;  2BJ0 A;  4TWH A;  5AFN A;  5HCJ A;  2XQ6 A;  5LG3 A;  3ZDH A;  3UU3 A;  3RHW A;  3WTI A;  4B5D A;  3PEO A;  5HEJ A;  3P4W A;  4HFE A;  4ZJS A;  4ZJT A;  3UU4 A;  5J5G A;  4COF A;  1UV6 A;  2X00 A;  2XQ4 A;  4HFH A;  4ILC A;  5KE4 A;  2ZJU A;  4PIR A;  2WNL A;  4D01 A;  4BQT A;  4AFH A;  3C84 A;  5JME A;  2XZ6 A;  3EHZ A;  3UQ4 A;  4ZR6 A;  2BG9 A;  4Z91 A;  2Y7Y A;  4UXU A;  3SH1 A;  3WIP A;  5AFH A;  2W8G A;  4QH4 A;  5CO5 A;  1UW6 A;  3SQ6 A;  5AFM B;  2XZ5 A;  4LMK A;  4QAC A;  3U8L A;  3WTM A;  5BRX A;  3WTK A;  4A97 A;  5SYO A;  2Y58 A;  3UU5 A;  3RIA A;  5LXB A;  2YN6 A;  3EAM A;  5BP0 A;  1UX2 A;  5HEU A;  2XQA A;  4HFC A;  3U8M A;  3TLV A;  2Y56 A;  2XQ9 A;  5KZU A;  5HCM A;  4WV9 A;  4UM3 A;  4TWD A;  4QAA A;  4UM3 P;  2W8F A;  2YMD A;  2YKS A;  3WTJ A;  4DBM A;  5HEO A;  4X5T A;  5L47 A;  5BW2 A;  4TWF A;  4HFD A;  5AFJ A;  2XYS A;  3T4M A;  2Y57 A;  3ZDG A;  4ILB A;  4ZZC A;  4QH1 A;  3UU8 A;  3C79 A;  3RQU A;  5L4H A;  3UU6 A;  3JAE A;  3TLW A;  4BFQ A;  2YOE A;  3LSV A;  2WN9 A;  1I9B A;  4LML A;  5J5F A;  4AFG A;  4ILA A;  3JAF A;  2BG9 B;  3SQ9 A;  2XQ5 A;  4XK9 A;  3SIO A;  4QH5 A;  4FRR A;  3TLT A;  2ZJV A;  3WTO A;  2BYR A;  2QC1 B;  4HFI A;  2XQ7 A;  4IRE A;  2YME A;  2BR7 A;  3RI5 A;  2XQ8 A;  4LMJ A;  5AFK A;  3WTL A;  4HQP A;  2BYN A;  5TVC A;  5AIN A;  5HEG A;  5AFL A;  4ZK4 A;  2XYT A;  5L4E A;  3GUA A;  3U8N A;  4TNV A;  2C9T A;  3ZKR A;  4IL4 A;  4UM3 S;  2XNT A;  4Z90 A;  4NZB A;  3PMZ A;  4ZK1 A;  2XNV A;  5J5H A;  3IGQ A;  4A98 A;  2PH9 A;  4QAB A;  2BG9 C;  5AFM A;  2BR8 A;  4UY2 A;  2X00 D;  4AFT A;  2XQ3 A;  4UM1 A;  5FJV A;  3P50 A;  5CFB A;  2PGZ A;  5HEH A; 
#chains in the Genus database with same CATH homology
 2UZ6 A;  4NPP A;  2BG9 E;  3U8K A;  4F8H A;  5J0Z A;  3RQW A;  3WTH A;  3UQ7 A;  3EI0 A;  3WTN A;  3TLS A;  3TLU A;  4TNW A;  3U8J A;  5J5I A;  2XNU A;  4HFB A;  3RIF A;  3JAD A;  4IL9 A;  3UUB A;  4ZRU A;  2BYQ A;  2WNJ A;  4ALX A;  2BYP A;  2Y54 A;  4XHE A;  2BYS A;  4EZ1 A;  2WNC A;  4ZZB A;  2WZY A;  2VL0 A;  5IUX A;  2BJ0 A;  4TWH A;  5AFN A;  5HCJ A;  2XQ6 A;  5LG3 A;  3ZDH A;  3UU3 A;  3RHW A;  3WTI A;  4B5D A;  3PEO A;  5HEJ A;  3P4W A;  4HFE A;  4ZJS A;  4ZJT A;  3UU4 A;  5J5G A;  4COF A;  1UV6 A;  2X00 A;  2XQ4 A;  4HFH A;  4ILC A;  5KE4 A;  2ZJU A;  4PIR A;  2WNL A;  4D01 A;  4BQT A;  4AFH A;  3C84 A;  5JME A;  2XZ6 A;  3EHZ A;  3UQ4 A;  4ZR6 A;  2BG9 A;  4Z91 A;  2Y7Y A;  4UXU A;  3SH1 A;  3WIP A;  5AFH A;  2W8G A;  4QH4 A;  5CO5 A;  1UW6 A;  3SQ6 A;  5AFM B;  2XZ5 A;  4LMK A;  4QAC A;  3U8L A;  3WTM A;  5BRX A;  3WTK A;  4A97 A;  5SYO A;  2Y58 A;  3UU5 A;  3RIA A;  5LXB A;  2YN6 A;  3EAM A;  5BP0 A;  1UX2 A;  5HEU A;  2XQA A;  4HFC A;  3U8M A;  3TLV A;  2Y56 A;  2XQ9 A;  5KZU A;  5HCM A;  4WV9 A;  4UM3 A;  4TWD A;  4QAA A;  4UM3 P;  2W8F A;  2YMD A;  2YKS A;  3WTJ A;  4DBM A;  5HEO A;  4X5T A;  5L47 A;  5BW2 A;  4TWF A;  4HFD A;  5AFJ A;  2XYS A;  3T4M A;  2Y57 A;  3ZDG A;  4ILB A;  4ZZC A;  4QH1 A;  3UU8 A;  3C79 A;  3RQU A;  5L4H A;  3UU6 A;  3JAE A;  3TLW A;  4BFQ A;  2YOE A;  3LSV A;  2WN9 A;  1I9B A;  4LML A;  5J5F A;  4AFG A;  4ILA A;  3JAF A;  2BG9 B;  3SQ9 A;  2XQ5 A;  4XK9 A;  3SIO A;  4QH5 A;  4FRR A;  3TLT A;  2ZJV A;  3WTO A;  2BYR A;  2QC1 B;  4HFI A;  2XQ7 A;  4IRE A;  2YME A;  2BR7 A;  3RI5 A;  2XQ8 A;  4LMJ A;  5AFK A;  3WTL A;  4HQP A;  2BYN A;  5TVC A;  5AIN A;  5HEG A;  5AFL A;  4ZK4 A;  2XYT A;  5L4E A;  3GUA A;  3U8N A;  4TNV A;  2C9T A;  3ZKR A;  4IL4 A;  4UM3 S;  2XNT A;  4Z90 A;  4NZB A;  3PMZ A;  4ZK1 A;  2XNV A;  5J5H A;  3IGQ A;  4A98 A;  2PH9 A;  4QAB A;  2BG9 C;  5AFM A;  2BR8 A;  4UY2 A;  2X00 D;  4AFT A;  2XQ3 A;  4UM1 A;  5FJV A;  3P50 A;  5CFB A;  2PGZ A;  5HEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...