2QC1B

Crystal structure of the extracellular domain of the nicotinic acetylcholine receptor 1 subunit bound to alpha-bungarotoxin at 1.9 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
KSEHETRLEAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTRTYDGSAVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Alpha-bungarotoxin
publication title Crystal structure of the extracellular domain of nAChR alpha1 bound to alpha-bungarotoxin at 1.94 A resolution.
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2qc1B00
4ILAA 4ZR6A 2WZYA 3UU6A 2XNUA 2X00D 2Y57A 5IUXA 2BYRA 4XHEA 2BR8A 3UQ4A 2XNVA 2BYQA 2XNTA 4QH5A 5TVCA 3RIFA 3WIPA 3UQ7A 5J5FA 1I9BA 2XZ6A 3TLVA 4QABA 4HFEA 2W8FA 5JMEA 2BR7A 2UZ6A 2BG9A 4TWFA 4UM3A 3SH1A 3EHZA 3U8KA 2YMDA 5CFBA 4ZRUA 2WN9A 4ILBA 5HEUA 2XQ3A 4FRRA 4IL9A 4TWHA 4ZK4A 2YMEA 4HFIA 3WTKA 2BJ0A 2WNLA 3UU8A 2YKSA 4TNWA 4HFBA 3TLUA 5AFNA 5AINA 4AFGA 3UU4A 1UX2A 3IGQA 5CO5A 3SQ9A 4AFHA 5J5IA 2ZJVA 5HEOA 3TLWA 3U8MA 3WTMA 4PIRA 3JADA 3P4WA 2Y56A 2Y58A 4LMKA 4COFA 5KZUA 4QH1A 2XQAA 5AFMA 3LSVA 4ALXA 2WNJA 2XQ6A 2W8GA 3WTIA 4ZZBA 3UU5A 5LG3A 3C84A 3PEOA 5AFLA 5J5GA 2BG9B 4IL4A 3ZKRA 5HEGA 2XQ5A 4XK9A 3U8NA 4TWDA 4BQTA 4QACA 4QH4A 2XQ9A 3RQWA 4TNVA 3C79A 3ZDHA 4D01A 5SYOA 4QAAA 2YOEA 3TLTA 2BYPA 2Y54A 1UV6A 4LMLA 3SIOA 3P50A 3SQ6A 2XQ8A 4Z90A 3WTLA 5HCMA 4A97A 3RHWA 5J5HA 3WTNA 5LXBA 4UY2A 4A98A 4B5DA 4F8HA 5L47A 4BFQA 4NPPA 5BP0A 5AFMB 2XYSA 4UM3S 4UM1A 4UM3P 3RI5A 3U8JA 5HEJA 2BYSA 3WTJA 4HFHA 2PH9A 4IREA 3EAMA 4EZ1A 2XQ4A 2XZ5A 3T4MA 2BYNA 5AFHA 3RQUA 2XQ7A 4HQPA 4ZJSA 2Y7YA 2X00A 2BG9C 5BW2A 5L4EA 5FJVA 4WV9A 4Z91A 4ZJTA 2XYTA 3JAFA 5AFKA 2VL0A 4AFTA 2ZJUA 2C9TA 3UUBA 4X5TA 3U8LA 4DBMA 3WTOA 5KE4A 4UXUA 3EI0A 2BG9E 4HFCA 3RIAA 3ZDGA 3UU3A 4ILCA 3JAEA 3TLSA 3PMZA 2PGZA 5AFJA 4NZBA 4ZK1A 5J0ZA 2WNCA 3WTHA 4LMJA 4HFDA 4ZZCA 2YN6A 5BRXA 1UW6A 2QC1B 5L4HA 5HCJA 5HEHA 3GUAA
chains in the Genus database with same CATH superfamily
4ILAA 4ZR6A 2WZYA 3UU6A 2XNUA 2X00D 2Y57A 5IUXA 2BYRA 4XHEA 2BR8A 3UQ4A 2XNVA 2BYQA 2XNTA 4QH5A 5TVCA 3RIFA 3WIPA 3UQ7A 5J5FA 1I9BA 2XZ6A 3TLVA 4QABA 4HFEA 2W8FA 5JMEA 2BR7A 2UZ6A 2BG9A 4TWFA 4UM3A 3SH1A 3EHZA 3U8KA 2YMDA 5CFBA 4ZRUA 2WN9A 4ILBA 5HEUA 2XQ3A 4FRRA 4IL9A 4TWHA 4ZK4A 2YMEA 4HFIA 3WTKA 2BJ0A 2WNLA 3UU8A 2YKSA 4TNWA 4HFBA 3TLUA 5AFNA 5AINA 4AFGA 3UU4A 1UX2A 3IGQA 5CO5A 3SQ9A 4AFHA 5J5IA 2ZJVA 5HEOA 3TLWA 3U8MA 3WTMA 4PIRA 3JADA 3P4WA 2Y56A 2Y58A 4LMKA 4COFA 5KZUA 4QH1A 2XQAA 5AFMA 3LSVA 4ALXA 2WNJA 2XQ6A 2W8GA 3WTIA 4ZZBA 3UU5A 5LG3A 3C84A 3PEOA 5AFLA 5J5GA 2BG9B 4IL4A 3ZKRA 5HEGA 2XQ5A 4XK9A 3U8NA 4TWDA 4BQTA 4QACA 4QH4A 2XQ9A 3RQWA 4TNVA 3C79A 3ZDHA 4D01A 5SYOA 4QAAA 2YOEA 3TLTA 2BYPA 2Y54A 1UV6A 4LMLA 3SIOA 3P50A 3SQ6A 2XQ8A 4Z90A 3WTLA 5HCMA 4A97A 3RHWA 5J5HA 3WTNA 5LXBA 4UY2A 4A98A 4B5DA 4F8HA 5L47A 4BFQA 4NPPA 5BP0A 5AFMB 2XYSA 4UM3S 4UM1A 4UM3P 3RI5A 3U8JA 5HEJA 2BYSA 3WTJA 4HFHA 2PH9A 4IREA 3EAMA 4EZ1A 2XQ4A 2XZ5A 3T4MA 2BYNA 5AFHA 3RQUA 2XQ7A 4HQPA 4ZJSA 2Y7YA 2X00A 2BG9C 5BW2A 5L4EA 5FJVA 4WV9A 4Z91A 4ZJTA 2XYTA 3JAFA 5AFKA 2VL0A 4AFTA 2ZJUA 2C9TA 3UUBA 4X5TA 3U8LA 4DBMA 3WTOA 5KE4A 4UXUA 3EI0A 2BG9E 4HFCA 3RIAA 3ZDGA 3UU3A 4ILCA 3JAEA 3TLSA 3PMZA 2PGZA 5AFJA 4NZBA 4ZK1A 5J0ZA 2WNCA 3WTHA 4LMJA 4HFDA 4ZZCA 2YN6A 5BRXA 1UW6A 2QC1B 5L4HA 5HCJA 5HEHA 3GUAA
chains in the Genus database with same CATH topology
4ILAA 4ZR6A 2WZYA 3UU6A 2XNUA 2X00D 2Y57A 5IUXA 2BYRA 4XHEA 2BR8A 3UQ4A 2XNVA 2BYQA 2XNTA 4QH5A 5TVCA 3RIFA 3WIPA 3UQ7A 5J5FA 1I9BA 2XZ6A 3TLVA 4QABA 4HFEA 2W8FA 5JMEA 2BR7A 2UZ6A 2BG9A 4TWFA 4UM3A 3SH1A 3EHZA 3U8KA 2YMDA 5CFBA 4ZRUA 2WN9A 4ILBA 5HEUA 2XQ3A 4FRRA 4IL9A 4TWHA 4ZK4A 2YMEA 4HFIA 3WTKA 2BJ0A 2WNLA 3UU8A 2YKSA 4TNWA 4HFBA 3TLUA 5AFNA 5AINA 4AFGA 3UU4A 1UX2A 3IGQA 5CO5A 3SQ9A 4AFHA 5J5IA 2ZJVA 5HEOA 3TLWA 3U8MA 3WTMA 4PIRA 3JADA 3P4WA 2Y56A 2Y58A 4LMKA 4COFA 5KZUA 4QH1A 2XQAA 5AFMA 3LSVA 4ALXA 2WNJA 2XQ6A 2W8GA 3WTIA 4ZZBA 3UU5A 5LG3A 3C84A 3PEOA 5AFLA 5J5GA 2BG9B 4IL4A 3ZKRA 5HEGA 2XQ5A 4XK9A 3U8NA 4TWDA 4BQTA 4QACA 4QH4A 2XQ9A 3RQWA 4TNVA 3C79A 3ZDHA 4D01A 5SYOA 4QAAA 2YOEA 3TLTA 2BYPA 2Y54A 1UV6A 4LMLA 3SIOA 3P50A 3SQ6A 2XQ8A 4Z90A 3WTLA 5HCMA 4A97A 3RHWA 5J5HA 3WTNA 5LXBA 4UY2A 4A98A 4B5DA 4F8HA 5L47A 4BFQA 4NPPA 5BP0A 5AFMB 2XYSA 4UM3S 4UM1A 4UM3P 3RI5A 3U8JA 5HEJA 2BYSA 3WTJA 4HFHA 2PH9A 4IREA 3EAMA 4EZ1A 2XQ4A 2XZ5A 3T4MA 2BYNA 5AFHA 3RQUA 2XQ7A 4HQPA 4ZJSA 2Y7YA 2X00A 2BG9C 5BW2A 5L4EA 5FJVA 4WV9A 4Z91A 4ZJTA 2XYTA 3JAFA 5AFKA 2VL0A 4AFTA 2ZJUA 2C9TA 3UUBA 4X5TA 3U8LA 4DBMA 3WTOA 5KE4A 4UXUA 3EI0A 2BG9E 4HFCA 3RIAA 3ZDGA 3UU3A 4ILCA 3JAEA 3TLSA 3PMZA 2PGZA 5AFJA 4NZBA 4ZK1A 5J0ZA 2WNCA 3WTHA 4LMJA 4HFDA 4ZZCA 2YN6A 5BRXA 1UW6A 2QC1B 5L4HA 5HCJA 5HEHA 3GUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILA A;  4ZR6 A;  2WZY A;  3UU6 A;  2XNU A;  2X00 D;  2Y57 A;  5IUX A;  2BYR A;  4XHE A;  2BR8 A;  3UQ4 A;  2XNV A;  2BYQ A;  2XNT A;  4QH5 A;  5TVC A;  3RIF A;  3WIP A;  3UQ7 A;  5J5F A;  1I9B A;  2XZ6 A;  3TLV A;  4QAB A;  4HFE A;  2W8F A;  5JME A;  2BR7 A;  2UZ6 A;  2BG9 A;  4TWF A;  4UM3 A;  3SH1 A;  3EHZ A;  3U8K A;  2YMD A;  5CFB A;  4ZRU A;  2WN9 A;  4ILB A;  5HEU A;  2XQ3 A;  4FRR A;  4IL9 A;  4TWH A;  4ZK4 A;  2YME A;  4HFI A;  3WTK A;  2BJ0 A;  2WNL A;  3UU8 A;  2YKS A;  4TNW A;  4HFB A;  3TLU A;  5AFN A;  5AIN A;  4AFG A;  3UU4 A;  1UX2 A;  3IGQ A;  5CO5 A;  3SQ9 A;  4AFH A;  5J5I A;  2ZJV A;  5HEO A;  3TLW A;  3U8M A;  3WTM A;  4PIR A;  3JAD A;  3P4W A;  2Y56 A;  2Y58 A;  4LMK A;  4COF A;  5KZU A;  4QH1 A;  2XQA A;  5AFM A;  3LSV A;  4ALX A;  2WNJ A;  2XQ6 A;  2W8G A;  3WTI A;  4ZZB A;  3UU5 A;  5LG3 A;  3C84 A;  3PEO A;  5AFL A;  5J5G A;  2BG9 B;  4IL4 A;  3ZKR A;  5HEG A;  2XQ5 A;  4XK9 A;  3U8N A;  4TWD A;  4BQT A;  4QAC A;  4QH4 A;  2XQ9 A;  3RQW A;  4TNV A;  3C79 A;  3ZDH A;  4D01 A;  5SYO A;  4QAA A;  2YOE A;  3TLT A;  2BYP A;  2Y54 A;  1UV6 A;  4LML A;  3SIO A;  3P50 A;  3SQ6 A;  2XQ8 A;  4Z90 A;  3WTL A;  5HCM A;  4A97 A;  3RHW A;  5J5H A;  3WTN A;  5LXB A;  4UY2 A;  4A98 A;  4B5D A;  4F8H A;  5L47 A;  4BFQ A;  4NPP A;  5BP0 A;  5AFM B;  2XYS A;  4UM3 S;  4UM1 A;  4UM3 P;  3RI5 A;  3U8J A;  5HEJ A;  2BYS A;  3WTJ A;  4HFH A;  2PH9 A;  4IRE A;  3EAM A;  4EZ1 A;  2XQ4 A;  2XZ5 A;  3T4M A;  2BYN A;  5AFH A;  3RQU A;  2XQ7 A;  4HQP A;  4ZJS A;  2Y7Y A;  2X00 A;  2BG9 C;  5BW2 A;  5L4E A;  5FJV A;  4WV9 A;  4Z91 A;  4ZJT A;  2XYT A;  3JAF A;  5AFK A;  2VL0 A;  4AFT A;  2ZJU A;  2C9T A;  3UUB A;  4X5T A;  3U8L A;  4DBM A;  3WTO A;  5KE4 A;  4UXU A;  3EI0 A;  2BG9 E;  4HFC A;  3RIA A;  3ZDG A;  3UU3 A;  4ILC A;  3JAE A;  3TLS A;  3PMZ A;  2PGZ A;  5AFJ A;  4NZB A;  4ZK1 A;  5J0Z A;  2WNC A;  3WTH A;  4LMJ A;  4HFD A;  4ZZC A;  2YN6 A;  5BRX A;  1UW6 A;  2QC1 B;  5L4H A;  5HCJ A;  5HEH A;  3GUA A; 
#chains in the Genus database with same CATH topology
 4ILA A;  4ZR6 A;  2WZY A;  3UU6 A;  2XNU A;  2X00 D;  2Y57 A;  5IUX A;  2BYR A;  4XHE A;  2BR8 A;  3UQ4 A;  2XNV A;  2BYQ A;  2XNT A;  4QH5 A;  5TVC A;  3RIF A;  3WIP A;  3UQ7 A;  5J5F A;  1I9B A;  2XZ6 A;  3TLV A;  4QAB A;  4HFE A;  2W8F A;  5JME A;  2BR7 A;  2UZ6 A;  2BG9 A;  4TWF A;  4UM3 A;  3SH1 A;  3EHZ A;  3U8K A;  2YMD A;  5CFB A;  4ZRU A;  2WN9 A;  4ILB A;  5HEU A;  2XQ3 A;  4FRR A;  4IL9 A;  4TWH A;  4ZK4 A;  2YME A;  4HFI A;  3WTK A;  2BJ0 A;  2WNL A;  3UU8 A;  2YKS A;  4TNW A;  4HFB A;  3TLU A;  5AFN A;  5AIN A;  4AFG A;  3UU4 A;  1UX2 A;  3IGQ A;  5CO5 A;  3SQ9 A;  4AFH A;  5J5I A;  2ZJV A;  5HEO A;  3TLW A;  3U8M A;  3WTM A;  4PIR A;  3JAD A;  3P4W A;  2Y56 A;  2Y58 A;  4LMK A;  4COF A;  5KZU A;  4QH1 A;  2XQA A;  5AFM A;  3LSV A;  4ALX A;  2WNJ A;  2XQ6 A;  2W8G A;  3WTI A;  4ZZB A;  3UU5 A;  5LG3 A;  3C84 A;  3PEO A;  5AFL A;  5J5G A;  2BG9 B;  4IL4 A;  3ZKR A;  5HEG A;  2XQ5 A;  4XK9 A;  3U8N A;  4TWD A;  4BQT A;  4QAC A;  4QH4 A;  2XQ9 A;  3RQW A;  4TNV A;  3C79 A;  3ZDH A;  4D01 A;  5SYO A;  4QAA A;  2YOE A;  3TLT A;  2BYP A;  2Y54 A;  1UV6 A;  4LML A;  3SIO A;  3P50 A;  3SQ6 A;  2XQ8 A;  4Z90 A;  3WTL A;  5HCM A;  4A97 A;  3RHW A;  5J5H A;  3WTN A;  5LXB A;  4UY2 A;  4A98 A;  4B5D A;  4F8H A;  5L47 A;  4BFQ A;  4NPP A;  5BP0 A;  5AFM B;  2XYS A;  4UM3 S;  4UM1 A;  4UM3 P;  3RI5 A;  3U8J A;  5HEJ A;  2BYS A;  3WTJ A;  4HFH A;  2PH9 A;  4IRE A;  3EAM A;  4EZ1 A;  2XQ4 A;  2XZ5 A;  3T4M A;  2BYN A;  5AFH A;  3RQU A;  2XQ7 A;  4HQP A;  4ZJS A;  2Y7Y A;  2X00 A;  2BG9 C;  5BW2 A;  5L4E A;  5FJV A;  4WV9 A;  4Z91 A;  4ZJT A;  2XYT A;  3JAF A;  5AFK A;  2VL0 A;  4AFT A;  2ZJU A;  2C9T A;  3UUB A;  4X5T A;  3U8L A;  4DBM A;  3WTO A;  5KE4 A;  4UXU A;  3EI0 A;  2BG9 E;  4HFC A;  3RIA A;  3ZDG A;  3UU3 A;  4ILC A;  3JAE A;  3TLS A;  3PMZ A;  2PGZ A;  5AFJ A;  4NZB A;  4ZK1 A;  5J0Z A;  2WNC A;  3WTH A;  4LMJ A;  4HFD A;  4ZZC A;  2YN6 A;  5BRX A;  1UW6 A;  2QC1 B;  5L4H A;  5HCJ A;  5HEH A;  3GUA A; 
#chains in the Genus database with same CATH homology
 4ILA A;  4ZR6 A;  2WZY A;  3UU6 A;  2XNU A;  2X00 D;  2Y57 A;  5IUX A;  2BYR A;  4XHE A;  2BR8 A;  3UQ4 A;  2XNV A;  2BYQ A;  2XNT A;  4QH5 A;  5TVC A;  3RIF A;  3WIP A;  3UQ7 A;  5J5F A;  1I9B A;  2XZ6 A;  3TLV A;  4QAB A;  4HFE A;  2W8F A;  5JME A;  2BR7 A;  2UZ6 A;  2BG9 A;  4TWF A;  4UM3 A;  3SH1 A;  3EHZ A;  3U8K A;  2YMD A;  5CFB A;  4ZRU A;  2WN9 A;  4ILB A;  5HEU A;  2XQ3 A;  4FRR A;  4IL9 A;  4TWH A;  4ZK4 A;  2YME A;  4HFI A;  3WTK A;  2BJ0 A;  2WNL A;  3UU8 A;  2YKS A;  4TNW A;  4HFB A;  3TLU A;  5AFN A;  5AIN A;  4AFG A;  3UU4 A;  1UX2 A;  3IGQ A;  5CO5 A;  3SQ9 A;  4AFH A;  5J5I A;  2ZJV A;  5HEO A;  3TLW A;  3U8M A;  3WTM A;  4PIR A;  3JAD A;  3P4W A;  2Y56 A;  2Y58 A;  4LMK A;  4COF A;  5KZU A;  4QH1 A;  2XQA A;  5AFM A;  3LSV A;  4ALX A;  2WNJ A;  2XQ6 A;  2W8G A;  3WTI A;  4ZZB A;  3UU5 A;  5LG3 A;  3C84 A;  3PEO A;  5AFL A;  5J5G A;  2BG9 B;  4IL4 A;  3ZKR A;  5HEG A;  2XQ5 A;  4XK9 A;  3U8N A;  4TWD A;  4BQT A;  4QAC A;  4QH4 A;  2XQ9 A;  3RQW A;  4TNV A;  3C79 A;  3ZDH A;  4D01 A;  5SYO A;  4QAA A;  2YOE A;  3TLT A;  2BYP A;  2Y54 A;  1UV6 A;  4LML A;  3SIO A;  3P50 A;  3SQ6 A;  2XQ8 A;  4Z90 A;  3WTL A;  5HCM A;  4A97 A;  3RHW A;  5J5H A;  3WTN A;  5LXB A;  4UY2 A;  4A98 A;  4B5D A;  4F8H A;  5L47 A;  4BFQ A;  4NPP A;  5BP0 A;  5AFM B;  2XYS A;  4UM3 S;  4UM1 A;  4UM3 P;  3RI5 A;  3U8J A;  5HEJ A;  2BYS A;  3WTJ A;  4HFH A;  2PH9 A;  4IRE A;  3EAM A;  4EZ1 A;  2XQ4 A;  2XZ5 A;  3T4M A;  2BYN A;  5AFH A;  3RQU A;  2XQ7 A;  4HQP A;  4ZJS A;  2Y7Y A;  2X00 A;  2BG9 C;  5BW2 A;  5L4E A;  5FJV A;  4WV9 A;  4Z91 A;  4ZJT A;  2XYT A;  3JAF A;  5AFK A;  2VL0 A;  4AFT A;  2ZJU A;  2C9T A;  3UUB A;  4X5T A;  3U8L A;  4DBM A;  3WTO A;  5KE4 A;  4UXU A;  3EI0 A;  2BG9 E;  4HFC A;  3RIA A;  3ZDG A;  3UU3 A;  4ILC A;  3JAE A;  3TLS A;  3PMZ A;  2PGZ A;  5AFJ A;  4NZB A;  4ZK1 A;  5J0Z A;  2WNC A;  3WTH A;  4LMJ A;  4HFD A;  4ZZC A;  2YN6 A;  5BRX A;  1UW6 A;  2QC1 B;  5L4H A;  5HCJ A;  5HEH A;  3GUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...