2XQ8A

Pentameric ligand gated ion channel glic in complex with zinc ion (zn2+)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
b'PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq8A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq8A01
3U8NA 4QH4A 3WTHA 3EI0A 4COFA 2WN9A 3TLTA 4XK9A 3SIOA 3ZDHA 2Y54A 4IL4A 3UU3A 4ZJSA 4D01A 2PGZA 5L4HA 3TLWA 5HEOA 5FJVA 2W8GA 4X5TA 3RHWA 3WTNA 2WNLA 3WTIA 4HFDA 5LXBA 2BG9B 4AFGA 4UM3S 2BG9A 1OEDC 4HFHA 3P50A 3UU6A 3C79A 5J0ZA 5AFMB 5J5GA 2Y7YA 5AFMA 5L4EA 2XQ8A 2XQ5A 3RIAA 3UU5A 1I9BA 4ILBA 2WZYA 2XZ5A 4ZZCA 3PMZA 4UM1A 4ZK4A 3WTJA 5J5HA 4F8HA 5IUXA 4PIRA 4IL9A 5KE4A 5CO5A 2XNVA 4BQTA 2BR8A 3WTOA 2BYQA 2YN6A 2XQ9A 3JAFA 4ILCA 5HCMA 2XQ7A 4Z91A 3RQUA 2XYSA 2XNTA 2LKGA 2M6IA 4FRRA 4QABA 4LMKA 2LLYA 3EHZA 2XQAA 2MAWA 5HEUA 5AFJA 1OEDB 4ZZBA 1OEDA 2Y57A 4UXUA 3RIFA 2XYTA 4WV9A 3UQ7A 2LM2A 3UUBA 4XHEA 3UU4A 4LMLA 5HCJA 2KSRA 1OEDE 4NPPA 3TLSA 2WNCA 5AFNA 2BYNA 4QAAA 4HFBA 5CFBA 5HEJA 4UM3P 4ZRUA 5KZUA 2C9TA 2YMDA 2YOEA 2BR7A 2XZ6A 4HFIA 4TNVA 2Y58A 2LKHA 2XQ6A 3TLVA 1UX2A 4ALXA 2YMEA 4AFTA 3SQ6A 2X00D 4A98A 2BYSA 3SH1A 5AFKA 5SYOA 2ZJVA 3WTMA 4QH1A 5J5IA 2M6BA 2VL0A 3RI5A 3LSVA 4ZK1A 2YKSA 4TNWA 4HQPA 4QACA 2QC1B 4TWDA 1UV6A 5HEHA 3TLUA 2BYPA 2X00A 5BRXA 5L47A 4HFEA 2BYRA 5J5FA 4UM3A 3JADA 4LMJA 2W8FA 3RQWA 3P4WA 3JAEA 2XNUA 4AFHA 3UU8A 4A97A 4ILAA 5HEGA 5BW2A 4DBMA 4IREA 2XQ4A 4TWHA 2ZJUA 3EAMA 3IGQA 5AFLA 2WNJA 3SQ9A 3ZDGA 2BG9C 5LG3A 3U8MA 4EZ1A 1UW6A 4ZJTA 3U8KA 4UY2A 3WTKA 2BJ0A 2Y56A 2PH9A 5BP0A 3T4MA 4Z90A 4NZBA 2XQ3A 5TVCA 4ZR6A 3U8JA 4TWFA 3C84A 3WTLA 4BFQA 2BG9E 4QH5A 4HFCA 5AINA 2UZ6A 4B5DA 3PEOA 3GUAA 3UQ4A 5AFHA 3U8LA 5JMEA 3ZKRA 3WIPA
chains in the Genus database with same CATH superfamily
3UU3A 5L4HA 4K0UA 4MHCA 4HEAA 4JUYA 1DU2A 2IAKA 1MNEA 4X1KE 4YHJA 2LT3A 2E9XB 3OYXA 5JTGA 5AQFB 3LK42 2Y48B 2BKPA 5LMUT 2BR8A 3U3IA 1CUNA 3FXDB 1NWMX 2V7MA 2LHNA 2NW7A 2MAWA 1MMDA 4P09A 2XYTA 4DBRA 2JQKA 3Q5WA 4PJMA 1O3XA 4NPPA 3KV4A 4IE5A 4HGAA 4QAAA 4JEHB 4YTMA 2J1DG 3IEEA 5AQPB 2NTYA 2BS2A 1WYBA 3AAEB 1YQ4A 4EV6A 2KLQA 3N9OA 3RI5A 3RYHE 1HTJF 3PUXF 5AQJB 3JADA 4LMJA 4OYKA 4Z8XA 2WCAA 4HWIB 2KINB 4ILAA 2B1EA 2P9BA 2JMHA 1N33T 3R84B 4JI0T 3NZQA 1N36T 2DCFA 3RYCE 1WRDA 4X62T 3HKDE 2J62A 3O1JA 1WYCA 3WIPA 3E0ZA 4DR1T 2E5LT 2QRXA 4CXXA 5AQIB 2C5KT 1CHUA 5FJVA 3SS1A 3C50A 4EGWA 3AA1B 3NRXA 2Y7YA 4QXHB 2XSBA 3PMZA 4ZZCA 1ZHCA 2CRBA 2NWBA 2C0SA 4EAHA 3ZT6A 1MMGA 4B3RT 3N9LA 2YN6A 5LJNA 3AE1A 3RQUA 3ZN1B 2BKOA 4DV7T 4ILUA 4JI3T 3UQ7A 2BZBA 2YDQA 2VKOA 4ZEYA 2LM9A 3MZKB 4JV5T 4WBOA 3AA0B 5CA0E 3RYFE 2LHRA 4UELA 2KMFA 4JBWF 4XZCA 3G06A 2H7OA 4O8SA 3SFDA 4YT0A 1HCIA 5BRXA 5AQRB 4YSXA 5JH7E 1QSDA 3H3MA 2XQ4A 2BVMA 3N9NA 3B13A 3AE6A 1XZYA 2K24A 2CE7A 2CHOA 2ZM2A 5F8PA 2Y8DA 3SOLA 4PJJA 2RPAA 1J1JA 1M62A 1UK5A 2YDSA 5AFHA 2IUBA 4O4LE 4O4IE 3RRWA 3EI0A 2Y54A 1LKXA 2OV9A 3AEFA 2HH7A 2W62A 2E9XD 2BS3A 2BG9A 3LBXA 3QB5K 3KV9A 1XNRT 4F8HA 3CWZB 4IL9A 5L3BB 2I0MA 2XAGB 2LKGA 4N78D 2M6IA 3ZMVB 1U4QA 4WZXA 5AFJA 4XBFB 2W4XA 3LK2B 1WR6A 5LGTB 5L3GB 5BR8T 2XM1A 4LF6T 4HWDA 4ISSA 4ADZA 4KUMB 4LF5T 2LSIA 4MBQA 2IDOB 3RC3A 2BYNA 4EXTA 1WR0A 2VQFT 1HFAA 2V5DA 3N2KE 2XTLA 3C98B 3RC8A 4H9SE 3AEBA 3BQIA 4CQIA 5AQKB 2VB6A 3CMLA 1MIYA 5EK2A 1HG5A 4UEMA 2C5IT 5HEGA 3KDSE 3MA9A 3ZT5A 4DBMA 1D1AA 1Z8UA 4TUYE 3OYZA 4JLEA 2BG9C 2KT9A 4YFSA 2BBJA 3WTKA 2LSYA 3T4MA 3V5UA 3OJAA 3PUVF 1HG2A 2BG9E 4X64T 4QH5A 1HR0T 2X9XA 3OKQA 5FYMA 2V6YA 3N9QA 2D9DA 3ZPOA 3GMIA 3CQCB 4QX8B 4DV6T 3FZLB 2W8GA 3NRYA 4U3CA 1I9BA 4ILBA 5ETWA 4U7IA 3UFGA 3VRBA 3P4SA 3CVRA 3HKBE 1XMQT 5LOVE 3ZC0A 2UXDT 3LK3B 2H7VC 2RP4A 3N9PA 4GIWA 5HXHA 5AQNB 3HL6A 2LEHA 2K48A 4WV9A 2V5CA 2FJAA 5AQSB 2X68A 2DNXA 3ESLA 3PV0F 4UM3P 3JC6D 5KZUA 5ADXL 2H88A 5FXXA 5LXTE 4BJNA 5J2UE 4UVAB 2X00D 2FUPA 3CX6B 5HXEA 1D0YA 1W9RA 5J5FA 5IHYA 2LSKA 4PK6A 4P0BA 4KP3C 3Q2MA 3IF8B 3QK6A 2XAJB 4U2YA 3SWHA 5C8YE 3EVYA 5JR9B 1SHZC 4J2CA 2CMRA 5LNKA 1UX5A 4B5DA 3H3AA 5JMEA 3U8LA 2D0TA 3P8CD 1IBKT 3ZMZB 5HAXA 2UUBT 4COFA 2GK9A 2PGZA 1HNZT 2YK0A 3RHWA 3UUMA 3WTIA 2DWGA 3C79A 3ZCJA 5J2TE 2DLRA 2F4VT 4AQFA 4KHZF 3HKCE 4CI3B 5IUXA 2FJDA 3IBPA 2X9YA 4OK0A 4AIUA 5JDNA 4GYSA 2MOZA 1IJ6A 2W67A 4QABA 5JDFA 3UULA 3EDVA 4UV9B 3C51A 5AQHB 4ZOLE 3UT5E 5L3CB 4TV9E 2ZLYA 4HFBA 3AXJB 4V1Av 2BR7A 4MLKA 3T1HT 2LKHA 2XAQB 3VR8A 4ZI3D 4EZ4A 3T1YT 2ZJVA 1IZNB 5FY1A 2ACXA 4AKRB 4HQPA 3CQGB 5LHIB 5KDMC 1X79A 1J5ET 4BAYB 2I59A 2D0UA 3B5MA 5AQMB 3FBLA 4DUYT 4X1YE 1M7KA 3L39A 3A8YC 3MXZA 4TX5A 4UY2A 2PG8A 4YSYA 4AQFC 3PTRB 5HYAA 3KBTA 4HFCA 2UZ6A 1G8XA 3UQ4A 3CIRA 4BJMA 2A3DA 4L9IA 1VOMA 2IC6A 2WB5A 5JDHA 3IHRA 1S94A 1S35A 1UCUA 4QXCB 4XAXB 5L2LA 4HWCA 4DR7T 5ABHA 1KNZA 4X65T 3WTJA 2WP9A 4FJOA 2V7LA 1IAPA 3WTOA 2PJQA 2XQ7A 2V7IA 3ZYMA 2XYSA 4DR4T 4GYRA 2V8SV 4ZZBA 1OEDA 4CXYA 3RIFA 3ANWA 4AXPA 2W2UA 3O9XA 3WAJA 1KF6A 5HCJA 5FL0A 2UUAT 2VK9A 3S4UA 5AQUB 4I55E 4DR6T 5JR9A 1WCRA 2L8KA 4DV0T 2M6BA 4UVBB 3F31A 1UV6A 1Y01A 3V5SA 4YSZA 3PU8A 4ASKA 4KHPT 3AE4A 3I0QA 1OXZA 4WNKA 3OTOT 4A97A 5L3EB 4ZS2A 3F57A 2R6GF 4NUVA 3AE2A 4H9NC 3ZDGA 1ZOYA 2ODVA 4A5XA 5BMVE 2BJ0A 5BP0A 1HF8A 1LVKA 2AE9A 2PTFA 4U7YA 3ZKRA 5JDMA 4P1NA 2V7KA 5FVLA 3U8NA 3ONXA 4YY3T 5CA1E 4IDPA 3TLWA 3MJXA 2FJBA 2VVSA 3MACA 3B57A 1OEDC 3AECA 2W61A 5AFMB 4AKGA 3K3OA 2XSAA 2XZ5A 3LFMA 3RIAA 2WZIA 2JQQA 4PK5A 1J5WA 3FBZA 4DV4T 2KXPB 3NZPA 2Y57A 4UV8B 5CGMA 2KSRA 5KMGP 3CQXC 1MNDA 1FMVA 5HEJA 4JI4T 4AKHA 2EHOB 2KZ7B 2XZ6A 3RF1A 1UX2A 2WU5A 2VURA 2XM2A 3X1DA 3EDUA 1ZKEA 2XASB 5LYJE 2W66A 3AE8A 5AQOB 2YDRA 2BYRA 1ZV4X 3P4WA 4AKLA 2V6XA 4C90A 4KI0F 3I9WA 4IREA 4I4TE 2H3RA 2WNJA 4IDOA 3TKLB 2HN1A 4NZBA 3U8JA 5JRCB 4TN7B 3RX6A 1ZP0A 4MFRA 2WDRA 3KV6A 1LVFA 5E0OA 2WN9A 4B3TT 3GWHA 4CXWA 2JMKA 2LRLA 3AE7A 2JIWA 3QUJA 2CBJA 5FY0A 2E9XA 5KE4A 1W0AA 5DQVA 3CX7B 5DJQC 2XZEA 4ILCA 2DWKA 5AQTB 5C2TA 3K3NA 3ONJA 3AVSA 3NKZA 5LGUB 3U78A 1HX8A 5IWAT 3KVAA 3UUBA 3A5XA 4ISTA 3ZEFB 4KMCA 5AQVB 2YOEA 3J7Yq 2Y58A 2XQ6A 3OBVE 4ANJA 5ABFB 3MKDA 3ETVA 2G0UA 3UU8A 4PK4A 4O4HE 3PDYA 5FXZA 2LOPA 4X66T 4YTNA 4H63V 5FL1A 5AFLA 2VWAA 4DV1T 2K3WA 2IIUA 2NOXA 5HXCA 3ZYLA 2E9XC 2D2SA 3NWIA 3ZJ2A 4DIDB 4DMVA 4LF7T 3VU7H 4HN9A 5EK4A 5LHGB 5LA6E 4IL4A 4D01A 2VKJA 4DR2T 3I0OA 2W00A 4LFBT 4GKJT 2IW5B 4UM3S 4HFHA 5J0ZA 2HPLA 4EYUA 1QLBA 1MMAA 3OPCA 1UURA 2Q9QB 5LBMA 1MMNA 2XAFB 3JAFA 4NIQA 2FJEA 3H37A 2CLYC 1E1HB 2N2NA 1XWMA 2FBWA 5LBQB 5JDGA 2EHOD 3PJAJ 4PAGA 2JQ9A 2YMDA 5AQGB 4PJNA 3PUWF 4AFTA 3SQ6A 2J47A 2CEAA 2YEVC 4ZI2D 2VL0A 4TWDA 2LJLA 2X00A 2CM0A 4HFEA 4GKKT 2ZMAA 3ZJ1A 2DL1A 3GN5B 5JDLA 2ZM6T 4HE8A 2V1DB 1MIWA 4QHOA 2WWUA 4QXBB 4F6RC 2XY8B 2V26A 2Y56A 5LMNT 2HPJA 3C4WA 1MIVA 3I1AA 3PUAA 4H9PC 3PU3A 2V7JA 4UXNB 2ZM8A 1D1BA 3AE9A 3HKEE 3RRCA 3TLTA 4ZJSA 1KNPA 3P4PA 4X5TA 4HFDA 1XDPA 1KK7A 5FXVA 4PJLA 4YXDA 2JRKA 1VCTA 2UUCT 4ZK4A 3WTHA 5FP3A 3T8OA 4KX6A 4AISA 2KNDA 5L3FB 2NR4A 1KEYA 1VCSA 5LHHB 4HKAA 2WSSV 4DMWA 3JC6C 3ZC1A 3Q5EA 2XQAA 2IC9A 4DVDA 4IDZA 2VKDA 1AJ3A 4KBMB 3UU4A 3MK7C 2CPTA 3AE5A 2YINA 4EEBA 3AVRA 1YKHB 3AEGA 4TNVA 1BR0A 3UUXB 5HWYA 2BYSA 2LSJA 2WDQA 5J1GA 3SFEA 4IGUA 4ZK1A 2YKSA 4DR5T 2D5UA 1UGOA 1W09A 3E22E 2W8FA 3JAEA 4LFAT 1GQEA 3Q5DA 4L5GA 1HNXT 4EYYR 1SUMB 5CJ5A 5ABEA 4DNDA 3AAAB 3FZKB 4B3ST 3IGQA 3SQ9A 4DBQA 5FKYA 1UW6A 4UR9A 5JREA 2VVNA 1QUUA 1I6ZA 4GK5E 3QB5A 4JI5T 2E5VA 3PURA 4NUUA 3ZDHA 3AA6B 3VKGA 2WDVA 3RKGA 1JNRA 4H9RC 2X0YA 2Q9QD 4HFVA 4E7SA 2CHNA 1HX1B 2JPFA 5F3JA 4WW0A 3P7IA 4IT4A 3FZHB 1Z0PA 4NXMT 4Z91A 3PE0A 5FMNA 1N32T 3ZN0B 3QNUA 4LMKA 3CKDA 2CWYA 2YU2A 5EZYE 3FZMB 2WMNA 3O1IA 1T8BA 4FI5A 3ZLIA 1IBLT 3TLSA 3UTKA 4JI7T 2VKHA 4ZI7E 2X9HA 2Y6XA 3AAIA 4JEUB 3ZCIA 4LFCT 4QH1A 5J5IA 1X9BA 1YXRA 5KX5E 2WU2A 3TLUA 2BYPA 2NTXA 1SE7A 1BR2A 3CPZA 2IMLA 2ZJUA 4JI1T 1SA0E 2MTQA 3HI2A 3BQLA 2CWOA 4B3MT 3U8MA 3U8KA 2PH9A 3KFWX 4TWFA 3CX8B 3D0TA 5AINA 3BQKA 1D1CA 4JI2T 2CXLA 5AQLB 5AQQB 2K9AA 4ZS3A 5AFUL 3EABA 4UF0B 4YJ3E 3K8PC 2PBIA 3KBUA 4XK9A 3SIOA 3Q9DA 3O4XE 3F2EA 3NVOA 2BG9B 4AFGA 3LBXB 3RKOA 5J5GA 2W63A 5L4EA 2XQ5A 5SYOA 4DV2T 4NXNT 1W0BA 4YJ2E 5HXSA 4JYAT 1KNRA 4ERRA 2IHR1 5KXJA 4WBNE 5HCMA 4O2BE 2UXNB 1HNWT 3CK6A 4K0KT 3VKHA 2Z6EA 2LLYA 2CLYB 2JQHA 3ZMUB 4G63A 4BA9A 5C3JA 4LMLA 3LDQB 1Y64B 1OEDE 4PFPA 2XUEA 3AXJA 2QVAA 1BR4A 5L3DB 3TLVA 4ALXA 5TAOA 5JR9C 2RA1A 4X20E 5DABA 3ZMSB 3JCFA 2C5JA 4TNWA 3FXEB 4AQYT 2WAUA 5ABGA 3E08A 3FB2A 4UM3A 2DHRA 4AFHA 5HXRA 5JVDE 3EAMA 2DI4A 2VASA 2CXFA 3N2OA 2MPKA 4I43B 4Z90A 2XQ3A 4ZR6A 4YLHA 3C84A 2BKNA 1WFDA 5FVKA 3AEAA 3GUAA 3DJBA 4GK0E 2V6YB 3HR0A 2B76A 2JJ9A 1NAFA 3VRAA 1JNZA 3AB3B 3AA7B 4EIWA 3ONLC 3NBXX 4OYJA 3UU6A 3UU5A 2WZYA 4DV3T 2N9DA 3VHLA 1E2AA 4OFZA 3P4QA 2XJ7A 2VL8A 5LG4A 4DO0A 5HWXA 1FIOA 4FRRA 2XHEB 4PW8A 4JI8T 4QWNB 4PFOA 2LM2A 4ZHQE 4G2AA 2MYSA 4H9QC 1D0ZA 2H89A 5LCYA 4EEDA 2W0GA 2XQYA 2X0LB 4AQGA 1EZ3A 2K5BB 4AKIA 2M67A 3RIUA 2X51A 1D0XA 2CBIA 1E7PA 2A9UA 3LSVA 3PUSA 4QACA 2UXCT 5HEHA 1FJGT 3RLFF 2LRKA 4WYVA 5LP6E 3AEDA 4UF0A 3C64A 5BW2A 4LF9T 1T98A 3WI3A 1B7TA 4IDNA 4HWHA 3FZFB 3WAKA 4U2ZA 1HS7A 3C4ZA 4Q25A 4TZ4C 4A56A 1UUSA 4QH4A 2VQET 4O2AE 3PUYF 5A1LA 1XMOT 5HEOA 3O1HA 2BBHA 4PNIA 3P50A 5AFMA 4UM1A 4OX9T 5J5HA 3DTOA 2BVLA 2WWVA 4BQTA 2ES0A 1I94T 1WLXA 3GA8A 5CB4E 2XQ9A 2XPKA 4UVCB 3ZYKA 1T72A 3RIUC 3FHNA 3EHZA 2OA5A 4UXUA 1VRBA 4XHEA 5FNVE 2KWHA 1NEKA 2LE8A 4CI1B 4DUZT 4P0AA 2WNCA 5AFNA 2L9QA 2NW8A 3PUZF 4ZXLA 2LOSA 2EHOA 5IYZE 3UFEA 3SH1A 5AFKA 3AEEA 4EZHA 2X9WA 2QC1B 1N34T 2N1GA 2CCQA 5FY7A 5L47A 3ETUA 4DR3T 1IJ5A 5LJMA 3LJCA 4TWHA 3P4RA 1FEWA 1YQ3A 4M1PA 4O4JE 3EUHA 4I0UA 3W15B 1UX4A 4ZJTA 5M4YA 1YW0A 2ODUA 2WBLA 5JRCA 4BFQA 2E8IA 4YTPA 1ZEEA 3PEOA 5GONE 5JDQA 4EB6E 4EOZB 4OHFA 5EK3A 1LRZA 1YD8G 2PFVA 4DV5T 2NP9A 2WMOA 1FMWA 3N2GE 3M3ZB 2XAHB 4CI2B 4IE4A 4PIRA 5CO5A 4GOUA 3PUGA 2EHOC 2BYQA 4U72A 5LGNB 5HEUA 4X1IE 2UU9T 1OEDB 3ANWB 4B6XA 2WQYA 2UXBT 4ZI2C 2AXDS 3ZSTA 4AI6A 1IBMT 5DQWA 4LF4T 4C91A 5CFBA 1G73A 3L3PA 4QX7B 3PUQA 3KV5A 2X66A 4IIJE 2YMEA 3WTMA 3KVBA 3RYIE 1XNQT 3M65A 4IE6A 3BK9A 5ABFA 2QGSA 5JQGE 2L3LA 2WY2A 5F5WA 3A7MA 3RQWA 3L8RA 2UXXB 4IE7A 3N9MA 5FXWA 4H9OC 3RPUA 1T7SA 2I6HA 2YU1A 3AE3A 3ZT7A 2BS4A 4EZ1A 3DP7A 2X67A 5TVCA 4IHJE 3ZSSA 2WS3A 3L09A 2SPCA 2OLTA 3LG7A 2E2AA 3ABVA 2QA7A 4MALA 1YKEB 4H63H 4L0RA 2ACZA 2A2FX 3J9X1 3WTNA 3PJAA 2MBGA 2WNLA 3I9YA 3RH3A 5LXBA 2HHHT 3IA3A 2QYWA 2WZHA 2XQ8A 3HA4A 4I50E 2X0HA 3UUNA 2XNVA 2LSGA 2Q9QA 1OWAA 4QKNA 4CZZB 4IDQA 1R8IA 4TV8E 2XNTA 1U5PA 1XDOA 5H6RB 2J4GA 3QC9A 4CN4A 4HTEA 3VR9A 4HWFA 4UIGA 1US7B 4ZRUA 3Q5XA 1L0VA 2C9TA 4IE0A 2HN2A 4HFIA 2ZM0A 4A98A 3QOFA 4U33A 1KFYA 2NW9A 4U74A 4ZI3C 4CN6A 3SRZA 3K1SA 3KINB 4JI6T 2XNUA 3GN5A 1H7CA 3C4XA 2WM9A 3ZMTB 2BDEA 3K3QC 4CN1A 4E7ZA 4LF8T 5LG3A 3N5LA 3R6NA 5LB7B 2CXDA 1NENA 3WTLA 2A72A 1V9DA 2CA5A 1BR1A 4YHHT 3OVUA 5H6QB 2Q9QC 4U31A 2KWIB 3RGLA
chains in the Genus database with same CATH topology
3U8NA 4QH4A 3WTHA 3EI0A 4COFA 2WN9A 3TLTA 4XK9A 3SIOA 3ZDHA 2Y54A 4IL4A 3UU3A 4ZJSA 4D01A 2PGZA 5L4HA 3TLWA 5HEOA 5FJVA 2W8GA 4X5TA 3RHWA 3WTNA 2WNLA 3WTIA 4HFDA 5LXBA 2BG9B 4AFGA 4UM3S 2BG9A 1OEDC 4HFHA 3P50A 3UU6A 3C79A 5J0ZA 5AFMB 5J5GA 2Y7YA 5AFMA 5L4EA 2XQ8A 2XQ5A 3RIAA 3UU5A 1I9BA 4ILBA 2WZYA 2XZ5A 4ZZCA 3PMZA 4UM1A 4ZK4A 3WTJA 5J5HA 4F8HA 5IUXA 4PIRA 4IL9A 5KE4A 5CO5A 2XNVA 4BQTA 2BR8A 3WTOA 2BYQA 2YN6A 2XQ9A 3JAFA 4ILCA 5HCMA 2XQ7A 4Z91A 3RQUA 2XYSA 2XNTA 2LKGA 2M6IA 4FRRA 4QABA 4LMKA 2LLYA 3EHZA 2XQAA 2MAWA 5HEUA 5AFJA 1OEDB 4ZZBA 1OEDA 2Y57A 4UXUA 3RIFA 2XYTA 4WV9A 3UQ7A 2LM2A 3UUBA 4XHEA 3UU4A 4LMLA 5HCJA 2KSRA 1OEDE 4NPPA 3TLSA 2WNCA 5AFNA 2BYNA 4QAAA 4HFBA 5CFBA 5HEJA 4UM3P 4ZRUA 5KZUA 2C9TA 2YMDA 2YOEA 2BR7A 2XZ6A 4HFIA 4TNVA 2Y58A 2LKHA 2XQ6A 3TLVA 1UX2A 4ALXA 2YMEA 4AFTA 3SQ6A 2X00D 4A98A 2BYSA 3SH1A 5AFKA 5SYOA 2ZJVA 3WTMA 4QH1A 5J5IA 2M6BA 2VL0A 3RI5A 3LSVA 4ZK1A 2YKSA 4TNWA 4HQPA 4QACA 2QC1B 4TWDA 1UV6A 5HEHA 3TLUA 2BYPA 2X00A 5BRXA 5L47A 4HFEA 2BYRA 5J5FA 4UM3A 3JADA 4LMJA 2W8FA 3RQWA 3P4WA 3JAEA 2XNUA 4AFHA 3UU8A 4A97A 4ILAA 5HEGA 5BW2A 4DBMA 4IREA 2XQ4A 4TWHA 2ZJUA 3EAMA 3IGQA 5AFLA 2WNJA 3SQ9A 3ZDGA 2BG9C 5LG3A 3U8MA 4EZ1A 1UW6A 4ZJTA 3U8KA 4UY2A 3WTKA 2BJ0A 2Y56A 2PH9A 5BP0A 3T4MA 4Z90A 4NZBA 2XQ3A 5TVCA 4ZR6A 3U8JA 4TWFA 3C84A 3WTLA 4BFQA 2BG9E 4QH5A 4HFCA 5AINA 2UZ6A 4B5DA 3PEOA 3GUAA 3UQ4A 5AFHA 3U8LA 5JMEA 3ZKRA 3WIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8N A;  4QH4 A;  3WTH A;  3EI0 A;  4COF A;  2WN9 A;  3TLT A;  4XK9 A;  3SIO A;  3ZDH A;  2Y54 A;  4IL4 A;  3UU3 A;  4ZJS A;  4D01 A;  2PGZ A;  5L4H A;  3TLW A;  5HEO A;  5FJV A;  2W8G A;  4X5T A;  3RHW A;  3WTN A;  2WNL A;  3WTI A;  4HFD A;  5LXB A;  2BG9 B;  4AFG A;  4UM3 S;  2BG9 A;  1OED C;  4HFH A;  3P50 A;  3UU6 A;  3C79 A;  5J0Z A;  5AFM B;  5J5G A;  2Y7Y A;  5AFM A;  5L4E A;  2XQ8 A;  2XQ5 A;  3RIA A;  3UU5 A;  1I9B A;  4ILB A;  2WZY A;  2XZ5 A;  4ZZC A;  3PMZ A;  4UM1 A;  4ZK4 A;  3WTJ A;  5J5H A;  4F8H A;  5IUX A;  4PIR A;  4IL9 A;  5KE4 A;  5CO5 A;  2XNV A;  4BQT A;  2BR8 A;  3WTO A;  2BYQ A;  2YN6 A;  2XQ9 A;  3JAF A;  4ILC A;  5HCM A;  2XQ7 A;  4Z91 A;  3RQU A;  2XYS A;  2XNT A;  2LKG A;  2M6I A;  4FRR A;  4QAB A;  4LMK A;  2LLY A;  3EHZ A;  2XQA A;  2MAW A;  5HEU A;  5AFJ A;  1OED B;  4ZZB A;  1OED A;  2Y57 A;  4UXU A;  3RIF A;  2XYT A;  4WV9 A;  3UQ7 A;  2LM2 A;  3UUB A;  4XHE A;  3UU4 A;  4LML A;  5HCJ A;  2KSR A;  1OED E;  4NPP A;  3TLS A;  2WNC A;  5AFN A;  2BYN A;  4QAA A;  4HFB A;  5CFB A;  5HEJ A;  4UM3 P;  4ZRU A;  5KZU A;  2C9T A;  2YMD A;  2YOE A;  2BR7 A;  2XZ6 A;  4HFI A;  4TNV A;  2Y58 A;  2LKH A;  2XQ6 A;  3TLV A;  1UX2 A;  4ALX A;  2YME A;  4AFT A;  3SQ6 A;  2X00 D;  4A98 A;  2BYS A;  3SH1 A;  5AFK A;  5SYO A;  2ZJV A;  3WTM A;  4QH1 A;  5J5I A;  2M6B A;  2VL0 A;  3RI5 A;  3LSV A;  4ZK1 A;  2YKS A;  4TNW A;  4HQP A;  4QAC A;  2QC1 B;  4TWD A;  1UV6 A;  5HEH A;  3TLU A;  2BYP A;  2X00 A;  5BRX A;  5L47 A;  4HFE A;  2BYR A;  5J5F A;  4UM3 A;  3JAD A;  4LMJ A;  2W8F A;  3RQW A;  3P4W A;  3JAE A;  2XNU A;  4AFH A;  3UU8 A;  4A97 A;  4ILA A;  5HEG A;  5BW2 A;  4DBM A;  4IRE A;  2XQ4 A;  4TWH A;  2ZJU A;  3EAM A;  3IGQ A;  5AFL A;  2WNJ A;  3SQ9 A;  3ZDG A;  2BG9 C;  5LG3 A;  3U8M A;  4EZ1 A;  1UW6 A;  4ZJT A;  3U8K A;  4UY2 A;  3WTK A;  2BJ0 A;  2Y56 A;  2PH9 A;  5BP0 A;  3T4M A;  4Z90 A;  4NZB A;  2XQ3 A;  5TVC A;  4ZR6 A;  3U8J A;  4TWF A;  3C84 A;  3WTL A;  4BFQ A;  2BG9 E;  4QH5 A;  4HFC A;  5AIN A;  2UZ6 A;  4B5D A;  3PEO A;  3GUA A;  3UQ4 A;  5AFH A;  3U8L A;  5JME A;  3ZKR A;  3WIP A; 
#chains in the Genus database with same CATH topology
 3UU3 A;  5L4H A;  4K0U A;  4MHC A;  4HEA A;  4JUY A;  1DU2 A;  2IAK A;  1MNE A;  4X1K E;  4YHJ A;  2LT3 A;  2E9X B;  3OYX A;  5JTG A;  5AQF B;  3LK4 2;  2Y48 B;  2BKP A;  5LMU T;  2BR8 A;  3U3I A;  1CUN A;  3FXD B;  1NWM X;  2V7M A;  2LHN A;  2NW7 A;  2MAW A;  1MMD A;  4P09 A;  2XYT A;  4DBR A;  2JQK A;  3Q5W A;  4PJM A;  1O3X A;  4NPP A;  3KV4 A;  4IE5 A;  4HGA A;  4QAA A;  4JEH B;  4YTM A;  2J1D G;  3IEE A;  5AQP B;  2NTY A;  2BS2 A;  1WYB A;  3AAE B;  1YQ4 A;  4EV6 A;  2KLQ A;  3N9O A;  3RI5 A;  3RYH E;  1HTJ F;  3PUX F;  5AQJ B;  3JAD A;  4LMJ A;  4OYK A;  4Z8X A;  2WCA A;  4HWI B;  2KIN B;  4ILA A;  2B1E A;  2P9B A;  2JMH A;  1N33 T;  3R84 B;  4JI0 T;  3NZQ A;  1N36 T;  2DCF A;  3RYC E;  1WRD A;  4X62 T;  3HKD E;  2J62 A;  3O1J A;  1WYC A;  3WIP A;  3E0Z A;  4DR1 T;  2E5L T;  2QRX A;  4CXX A;  5AQI B;  2C5K T;  1CHU A;  5FJV A;  3SS1 A;  3C50 A;  4EGW A;  3AA1 B;  3NRX A;  2Y7Y A;  4QXH B;  2XSB A;  3PMZ A;  4ZZC A;  1ZHC A;  2CRB A;  2NWB A;  2C0S A;  4EAH A;  3ZT6 A;  1MMG A;  4B3R T;  3N9L A;  2YN6 A;  5LJN A;  3AE1 A;  3RQU A;  3ZN1 B;  2BKO A;  4DV7 T;  4ILU A;  4JI3 T;  3UQ7 A;  2BZB A;  2YDQ A;  2VKO A;  4ZEY A;  2LM9 A;  3MZK B;  4JV5 T;  4WBO A;  3AA0 B;  5CA0 E;  3RYF E;  2LHR A;  4UEL A;  2KMF A;  4JBW F;  4XZC A;  3G06 A;  2H7O A;  4O8S A;  3SFD A;  4YT0 A;  1HCI A;  5BRX A;  5AQR B;  4YSX A;  5JH7 E;  1QSD A;  3H3M A;  2XQ4 A;  2BVM A;  3N9N A;  3B13 A;  3AE6 A;  1XZY A;  2K24 A;  2CE7 A;  2CHO A;  2ZM2 A;  5F8P A;  2Y8D A;  3SOL A;  4PJJ A;  2RPA A;  1J1J A;  1M62 A;  1UK5 A;  2YDS A;  5AFH A;  2IUB A;  4O4L E;  4O4I E;  3RRW A;  3EI0 A;  2Y54 A;  1LKX A;  2OV9 A;  3AEF A;  2HH7 A;  2W62 A;  2E9X D;  2BS3 A;  2BG9 A;  3LBX A;  3QB5 K;  3KV9 A;  1XNR T;  4F8H A;  3CWZ B;  4IL9 A;  5L3B B;  2I0M A;  2XAG B;  2LKG A;  4N78 D;  2M6I A;  3ZMV B;  1U4Q A;  4WZX A;  5AFJ A;  4XBF B;  2W4X A;  3LK2 B;  1WR6 A;  5LGT B;  5L3G B;  5BR8 T;  2XM1 A;  4LF6 T;  4HWD A;  4ISS A;  4ADZ A;  4KUM B;  4LF5 T;  2LSI A;  4MBQ A;  2IDO B;  3RC3 A;  2BYN A;  4EXT A;  1WR0 A;  2VQF T;  1HFA A;  2V5D A;  3N2K E;  2XTL A;  3C98 B;  3RC8 A;  4H9S E;  3AEB A;  3BQI A;  4CQI A;  5AQK B;  2VB6 A;  3CML A;  1MIY A;  5EK2 A;  1HG5 A;  4UEM A;  2C5I T;  5HEG A;  3KDS E;  3MA9 A;  3ZT5 A;  4DBM A;  1D1A A;  1Z8U A;  4TUY E;  3OYZ A;  4JLE A;  2BG9 C;  2KT9 A;  4YFS A;  2BBJ A;  3WTK A;  2LSY A;  3T4M A;  3V5U A;  3OJA A;  3PUV F;  1HG2 A;  2BG9 E;  4X64 T;  4QH5 A;  1HR0 T;  2X9X A;  3OKQ A;  5FYM A;  2V6Y A;  3N9Q A;  2D9D A;  3ZPO A;  3GMI A;  3CQC B;  4QX8 B;  4DV6 T;  3FZL B;  2W8G A;  3NRY A;  4U3C A;  1I9B A;  4ILB A;  5ETW A;  4U7I A;  3UFG A;  3VRB A;  3P4S A;  3CVR A;  3HKB E;  1XMQ T;  5LOV E;  3ZC0 A;  2UXD T;  3LK3 B;  2H7V C;  2RP4 A;  3N9P A;  4GIW A;  5HXH A;  5AQN B;  3HL6 A;  2LEH A;  2K48 A;  4WV9 A;  2V5C A;  2FJA A;  5AQS B;  2X68 A;  2DNX A;  3ESL A;  3PV0 F;  4UM3 P;  3JC6 D;  5KZU A;  5ADX L;  2H88 A;  5FXX A;  5LXT E;  4BJN A;  5J2U E;  4UVA B;  2X00 D;  2FUP A;  3CX6 B;  5HXE A;  1D0Y A;  1W9R A;  5J5F A;  5IHY A;  2LSK A;  4PK6 A;  4P0B A;  4KP3 C;  3Q2M A;  3IF8 B;  3QK6 A;  2XAJ B;  4U2Y A;  3SWH A;  5C8Y E;  3EVY A;  5JR9 B;  1SHZ C;  4J2C A;  2CMR A;  5LNK A;  1UX5 A;  4B5D A;  3H3A A;  5JME A;  3U8L A;  2D0T A;  3P8C D;  1IBK T;  3ZMZ B;  5HAX A;  2UUB T;  4COF A;  2GK9 A;  2PGZ A;  1HNZ T;  2YK0 A;  3RHW A;  3UUM A;  3WTI A;  2DWG A;  3C79 A;  3ZCJ A;  5J2T E;  2DLR A;  2F4V T;  4AQF A;  4KHZ F;  3HKC E;  4CI3 B;  5IUX A;  2FJD A;  3IBP A;  2X9Y A;  4OK0 A;  4AIU A;  5JDN A;  4GYS A;  2MOZ A;  1IJ6 A;  2W67 A;  4QAB A;  5JDF A;  3UUL A;  3EDV A;  4UV9 B;  3C51 A;  5AQH B;  4ZOL E;  3UT5 E;  5L3C B;  4TV9 E;  2ZLY A;  4HFB A;  3AXJ B;  4V1A v;  2BR7 A;  4MLK A;  3T1H T;  2LKH A;  2XAQ B;  3VR8 A;  4ZI3 D;  4EZ4 A;  3T1Y T;  2ZJV A;  1IZN B;  5FY1 A;  2ACX A;  4AKR B;  4HQP A;  3CQG B;  5LHI B;  5KDM C;  1X79 A;  1J5E T;  4BAY B;  2I59 A;  2D0U A;  3B5M A;  5AQM B;  3FBL A;  4DUY T;  4X1Y E;  1M7K A;  3L39 A;  3A8Y C;  3MXZ A;  4TX5 A;  4UY2 A;  2PG8 A;  4YSY A;  4AQF C;  3PTR B;  5HYA A;  3KBT A;  4HFC A;  2UZ6 A;  1G8X A;  3UQ4 A;  3CIR A;  4BJM A;  2A3D A;  4L9I A;  1VOM A;  2IC6 A;  2WB5 A;  5JDH A;  3IHR A;  1S94 A;  1S35 A;  1UCU A;  4QXC B;  4XAX B;  5L2L A;  4HWC A;  4DR7 T;  5ABH A;  1KNZ A;  4X65 T;  3WTJ A;  2WP9 A;  4FJO A;  2V7L A;  1IAP A;  3WTO A;  2PJQ A;  2XQ7 A;  2V7I A;  3ZYM A;  2XYS A;  4DR4 T;  4GYR A;  2V8S V;  4ZZB A;  1OED A;  4CXY A;  3RIF A;  3ANW A;  4AXP A;  2W2U A;  3O9X A;  3WAJ A;  1KF6 A;  5HCJ A;  5FL0 A;  2UUA T;  2VK9 A;  3S4U A;  5AQU B;  4I55 E;  4DR6 T;  5JR9 A;  1WCR A;  2L8K A;  4DV0 T;  2M6B A;  4UVB B;  3F31 A;  1UV6 A;  1Y01 A;  3V5S A;  4YSZ A;  3PU8 A;  4ASK A;  4KHP T;  3AE4 A;  3I0Q A;  1OXZ A;  4WNK A;  3OTO T;  4A97 A;  5L3E B;  4ZS2 A;  3F57 A;  2R6G F;  4NUV A;  3AE2 A;  4H9N C;  3ZDG A;  1ZOY A;  2ODV A;  4A5X A;  5BMV E;  2BJ0 A;  5BP0 A;  1HF8 A;  1LVK A;  2AE9 A;  2PTF A;  4U7Y A;  3ZKR A;  5JDM A;  4P1N A;  2V7K A;  5FVL A;  3U8N A;  3ONX A;  4YY3 T;  5CA1 E;  4IDP A;  3TLW A;  3MJX A;  2FJB A;  2VVS A;  3MAC A;  3B57 A;  1OED C;  3AEC A;  2W61 A;  5AFM B;  4AKG A;  3K3O A;  2XSA A;  2XZ5 A;  3LFM A;  3RIA A;  2WZI A;  2JQQ A;  4PK5 A;  1J5W A;  3FBZ A;  4DV4 T;  2KXP B;  3NZP A;  2Y57 A;  4UV8 B;  5CGM A;  2KSR A;  5KMG P;  3CQX C;  1MND A;  1FMV A;  5HEJ A;  4JI4 T;  4AKH A;  2EHO B;  2KZ7 B;  2XZ6 A;  3RF1 A;  1UX2 A;  2WU5 A;  2VUR A;  2XM2 A;  3X1D A;  3EDU A;  1ZKE A;  2XAS B;  5LYJ E;  2W66 A;  3AE8 A;  5AQO B;  2YDR A;  2BYR A;  1ZV4 X;  3P4W A;  4AKL A;  2V6X A;  4C90 A;  4KI0 F;  3I9W A;  4IRE A;  4I4T E;  2H3R A;  2WNJ A;  4IDO A;  3TKL B;  2HN1 A;  4NZB A;  3U8J A;  5JRC B;  4TN7 B;  3RX6 A;  1ZP0 A;  4MFR A;  2WDR A;  3KV6 A;  1LVF A;  5E0O A;  2WN9 A;  4B3T T;  3GWH A;  4CXW A;  2JMK A;  2LRL A;  3AE7 A;  2JIW A;  3QUJ A;  2CBJ A;  5FY0 A;  2E9X A;  5KE4 A;  1W0A A;  5DQV A;  3CX7 B;  5DJQ C;  2XZE A;  4ILC A;  2DWK A;  5AQT B;  5C2T A;  3K3N A;  3ONJ A;  3AVS A;  3NKZ A;  5LGU B;  3U78 A;  1HX8 A;  5IWA T;  3KVA A;  3UUB A;  3A5X A;  4IST A;  3ZEF B;  4KMC A;  5AQV B;  2YOE A;  3J7Y q;  2Y58 A;  2XQ6 A;  3OBV E;  4ANJ A;  5ABF B;  3MKD A;  3ETV A;  2G0U A;  3UU8 A;  4PK4 A;  4O4H E;  3PDY A;  5FXZ A;  2LOP A;  4X66 T;  4YTN A;  4H63 V;  5FL1 A;  5AFL A;  2VWA A;  4DV1 T;  2K3W A;  2IIU A;  2NOX A;  5HXC A;  3ZYL A;  2E9X C;  2D2S A;  3NWI A;  3ZJ2 A;  4DID B;  4DMV A;  4LF7 T;  3VU7 H;  4HN9 A;  5EK4 A;  5LHG B;  5LA6 E;  4IL4 A;  4D01 A;  2VKJ A;  4DR2 T;  3I0O A;  2W00 A;  4LFB T;  4GKJ T;  2IW5 B;  4UM3 S;  4HFH A;  5J0Z A;  2HPL A;  4EYU A;  1QLB A;  1MMA A;  3OPC A;  1UUR A;  2Q9Q B;  5LBM A;  1MMN A;  2XAF B;  3JAF A;  4NIQ A;  2FJE A;  3H37 A;  2CLY C;  1E1H B;  2N2N A;  1XWM A;  2FBW A;  5LBQ B;  5JDG A;  2EHO D;  3PJA J;  4PAG A;  2JQ9 A;  2YMD A;  5AQG B;  4PJN A;  3PUW F;  4AFT A;  3SQ6 A;  2J47 A;  2CEA A;  2YEV C;  4ZI2 D;  2VL0 A;  4TWD A;  2LJL A;  2X00 A;  2CM0 A;  4HFE A;  4GKK T;  2ZMA A;  3ZJ1 A;  2DL1 A;  3GN5 B;  5JDL A;  2ZM6 T;  4HE8 A;  2V1D B;  1MIW A;  4QHO A;  2WWU A;  4QXB B;  4F6R C;  2XY8 B;  2V26 A;  2Y56 A;  5LMN T;  2HPJ A;  3C4W A;  1MIV A;  3I1A A;  3PUA A;  4H9P C;  3PU3 A;  2V7J A;  4UXN B;  2ZM8 A;  1D1B A;  3AE9 A;  3HKE E;  3RRC A;  3TLT A;  4ZJS A;  1KNP A;  3P4P A;  4X5T A;  4HFD A;  1XDP A;  1KK7 A;  5FXV A;  4PJL A;  4YXD A;  2JRK A;  1VCT A;  2UUC T;  4ZK4 A;  3WTH A;  5FP3 A;  3T8O A;  4KX6 A;  4AIS A;  2KND A;  5L3F B;  2NR4 A;  1KEY A;  1VCS A;  5LHH B;  4HKA A;  2WSS V;  4DMW A;  3JC6 C;  3ZC1 A;  3Q5E A;  2XQA A;  2IC9 A;  4DVD A;  4IDZ A;  2VKD A;  1AJ3 A;  4KBM B;  3UU4 A;  3MK7 C;  2CPT A;  3AE5 A;  2YIN A;  4EEB A;  3AVR A;  1YKH B;  3AEG A;  4TNV A;  1BR0 A;  3UUX B;  5HWY A;  2BYS A;  2LSJ A;  2WDQ A;  5J1G A;  3SFE A;  4IGU A;  4ZK1 A;  2YKS A;  4DR5 T;  2D5U A;  1UGO A;  1W09 A;  3E22 E;  2W8F A;  3JAE A;  4LFA T;  1GQE A;  3Q5D A;  4L5G A;  1HNX T;  4EYY R;  1SUM B;  5CJ5 A;  5ABE A;  4DND A;  3AAA B;  3FZK B;  4B3S T;  3IGQ A;  3SQ9 A;  4DBQ A;  5FKY A;  1UW6 A;  4UR9 A;  5JRE A;  2VVN A;  1QUU A;  1I6Z A;  4GK5 E;  3QB5 A;  4JI5 T;  2E5V A;  3PUR A;  4NUU A;  3ZDH A;  3AA6 B;  3VKG A;  2WDV A;  3RKG A;  1JNR A;  4H9R C;  2X0Y A;  2Q9Q D;  4HFV A;  4E7S A;  2CHN A;  1HX1 B;  2JPF A;  5F3J A;  4WW0 A;  3P7I A;  4IT4 A;  3FZH B;  1Z0P A;  4NXM T;  4Z91 A;  3PE0 A;  5FMN A;  1N32 T;  3ZN0 B;  3QNU A;  4LMK A;  3CKD A;  2CWY A;  2YU2 A;  5EZY E;  3FZM B;  2WMN A;  3O1I A;  1T8B A;  4FI5 A;  3ZLI A;  1IBL T;  3TLS A;  3UTK A;  4JI7 T;  2VKH A;  4ZI7 E;  2X9H A;  2Y6X A;  3AAI A;  4JEU B;  3ZCI A;  4LFC T;  4QH1 A;  5J5I A;  1X9B A;  1YXR A;  5KX5 E;  2WU2 A;  3TLU A;  2BYP A;  2NTX A;  1SE7 A;  1BR2 A;  3CPZ A;  2IML A;  2ZJU A;  4JI1 T;  1SA0 E;  2MTQ A;  3HI2 A;  3BQL A;  2CWO A;  4B3M T;  3U8M A;  3U8K A;  2PH9 A;  3KFW X;  4TWF A;  3CX8 B;  3D0T A;  5AIN A;  3BQK A;  1D1C A;  4JI2 T;  2CXL A;  5AQL B;  5AQQ B;  2K9A A;  4ZS3 A;  5AFU L;  3EAB A;  4UF0 B;  4YJ3 E;  3K8P C;  2PBI A;  3KBU A;  4XK9 A;  3SIO A;  3Q9D A;  3O4X E;  3F2E A;  3NVO A;  2BG9 B;  4AFG A;  3LBX B;  3RKO A;  5J5G A;  2W63 A;  5L4E A;  2XQ5 A;  5SYO A;  4DV2 T;  4NXN T;  1W0B A;  4YJ2 E;  5HXS A;  4JYA T;  1KNR A;  4ERR A;  2IHR 1;  5KXJ A;  4WBN E;  5HCM A;  4O2B E;  2UXN B;  1HNW T;  3CK6 A;  4K0K T;  3VKH A;  2Z6E A;  2LLY A;  2CLY B;  2JQH A;  3ZMU B;  4G63 A;  4BA9 A;  5C3J A;  4LML A;  3LDQ B;  1Y64 B;  1OED E;  4PFP A;  2XUE A;  3AXJ A;  2QVA A;  1BR4 A;  5L3D B;  3TLV A;  4ALX A;  5TAO A;  5JR9 C;  2RA1 A;  4X20 E;  5DAB A;  3ZMS B;  3JCF A;  2C5J A;  4TNW A;  3FXE B;  4AQY T;  2WAU A;  5ABG A;  3E08 A;  3FB2 A;  4UM3 A;  2DHR A;  4AFH A;  5HXR A;  5JVD E;  3EAM A;  2DI4 A;  2VAS A;  2CXF A;  3N2O A;  2MPK A;  4I43 B;  4Z90 A;  2XQ3 A;  4ZR6 A;  4YLH A;  3C84 A;  2BKN A;  1WFD A;  5FVK A;  3AEA A;  3GUA A;  3DJB A;  4GK0 E;  2V6Y B;  3HR0 A;  2B76 A;  2JJ9 A;  1NAF A;  3VRA A;  1JNZ A;  3AB3 B;  3AA7 B;  4EIW A;  3ONL C;  3NBX X;  4OYJ A;  3UU6 A;  3UU5 A;  2WZY A;  4DV3 T;  2N9D A;  3VHL A;  1E2A A;  4OFZ A;  3P4Q A;  2XJ7 A;  2VL8 A;  5LG4 A;  4DO0 A;  5HWX A;  1FIO A;  4FRR A;  2XHE B;  4PW8 A;  4JI8 T;  4QWN B;  4PFO A;  2LM2 A;  4ZHQ E;  4G2A A;  2MYS A;  4H9Q C;  1D0Z A;  2H89 A;  5LCY A;  4EED A;  2W0G A;  2XQY A;  2X0L B;  4AQG A;  1EZ3 A;  2K5B B;  4AKI A;  2M67 A;  3RIU A;  2X51 A;  1D0X A;  2CBI A;  1E7P A;  2A9U A;  3LSV A;  3PUS A;  4QAC A;  2UXC T;  5HEH A;  1FJG T;  3RLF F;  2LRK A;  4WYV A;  5LP6 E;  3AED A;  4UF0 A;  3C64 A;  5BW2 A;  4LF9 T;  1T98 A;  3WI3 A;  1B7T A;  4IDN A;  4HWH A;  3FZF B;  3WAK A;  4U2Z A;  1HS7 A;  3C4Z A;  4Q25 A;  4TZ4 C;  4A56 A;  1UUS A;  4QH4 A;  2VQE T;  4O2A E;  3PUY F;  5A1L A;  1XMO T;  5HEO A;  3O1H A;  2BBH A;  4PNI A;  3P50 A;  5AFM A;  4UM1 A;  4OX9 T;  5J5H A;  3DTO A;  2BVL A;  2WWV A;  4BQT A;  2ES0 A;  1I94 T;  1WLX A;  3GA8 A;  5CB4 E;  2XQ9 A;  2XPK A;  4UVC B;  3ZYK A;  1T72 A;  3RIU C;  3FHN A;  3EHZ A;  2OA5 A;  4UXU A;  1VRB A;  4XHE A;  5FNV E;  2KWH A;  1NEK A;  2LE8 A;  4CI1 B;  4DUZ T;  4P0A A;  2WNC A;  5AFN A;  2L9Q A;  2NW8 A;  3PUZ F;  4ZXL A;  2LOS A;  2EHO A;  5IYZ E;  3UFE A;  3SH1 A;  5AFK A;  3AEE A;  4EZH A;  2X9W A;  2QC1 B;  1N34 T;  2N1G A;  2CCQ A;  5FY7 A;  5L47 A;  3ETU A;  4DR3 T;  1IJ5 A;  5LJM A;  3LJC A;  4TWH A;  3P4R A;  1FEW A;  1YQ3 A;  4M1P A;  4O4J E;  3EUH A;  4I0U A;  3W15 B;  1UX4 A;  4ZJT A;  5M4Y A;  1YW0 A;  2ODU A;  2WBL A;  5JRC A;  4BFQ A;  2E8I A;  4YTP A;  1ZEE A;  3PEO A;  5GON E;  5JDQ A;  4EB6 E;  4EOZ B;  4OHF A;  5EK3 A;  1LRZ A;  1YD8 G;  2PFV A;  4DV5 T;  2NP9 A;  2WMO A;  1FMW A;  3N2G E;  3M3Z B;  2XAH B;  4CI2 B;  4IE4 A;  4PIR A;  5CO5 A;  4GOU A;  3PUG A;  2EHO C;  2BYQ A;  4U72 A;  5LGN B;  5HEU A;  4X1I E;  2UU9 T;  1OED B;  3ANW B;  4B6X A;  2WQY A;  2UXB T;  4ZI2 C;  2AXD S;  3ZST A;  4AI6 A;  1IBM T;  5DQW A;  4LF4 T;  4C91 A;  5CFB A;  1G73 A;  3L3P A;  4QX7 B;  3PUQ A;  3KV5 A;  2X66 A;  4IIJ E;  2YME A;  3WTM A;  3KVB A;  3RYI E;  1XNQ T;  3M65 A;  4IE6 A;  3BK9 A;  5ABF A;  2QGS A;  5JQG E;  2L3L A;  2WY2 A;  5F5W A;  3A7M A;  3RQW A;  3L8R A;  2UXX B;  4IE7 A;  3N9M A;  5FXW A;  4H9O C;  3RPU A;  1T7S A;  2I6H A;  2YU1 A;  3AE3 A;  3ZT7 A;  2BS4 A;  4EZ1 A;  3DP7 A;  2X67 A;  5TVC A;  4IHJ E;  3ZSS A;  2WS3 A;  3L09 A;  2SPC A;  2OLT A;  3LG7 A;  2E2A A;  3ABV A;  2QA7 A;  4MAL A;  1YKE B;  4H63 H;  4L0R A;  2ACZ A;  2A2F X;  3J9X 1;  3WTN A;  3PJA A;  2MBG A;  2WNL A;  3I9Y A;  3RH3 A;  5LXB A;  2HHH T;  3IA3 A;  2QYW A;  2WZH A;  2XQ8 A;  3HA4 A;  4I50 E;  2X0H A;  3UUN A;  2XNV A;  2LSG A;  2Q9Q A;  1OWA A;  4QKN A;  4CZZ B;  4IDQ A;  1R8I A;  4TV8 E;  2XNT A;  1U5P A;  1XDO A;  5H6R B;  2J4G A;  3QC9 A;  4CN4 A;  4HTE A;  3VR9 A;  4HWF A;  4UIG A;  1US7 B;  4ZRU A;  3Q5X A;  1L0V A;  2C9T A;  4IE0 A;  2HN2 A;  4HFI A;  2ZM0 A;  4A98 A;  3QOF A;  4U33 A;  1KFY A;  2NW9 A;  4U74 A;  4ZI3 C;  4CN6 A;  3SRZ A;  3K1S A;  3KIN B;  4JI6 T;  2XNU A;  3GN5 A;  1H7C A;  3C4X A;  2WM9 A;  3ZMT B;  2BDE A;  3K3Q C;  4CN1 A;  4E7Z A;  4LF8 T;  5LG3 A;  3N5L A;  3R6N A;  5LB7 B;  2CXD A;  1NEN A;  3WTL A;  2A72 A;  1V9D A;  2CA5 A;  1BR1 A;  4YHH T;  3OVU A;  5H6Q B;  2Q9Q C;  4U31 A;  2KWI B;  3RGL A; 
#chains in the Genus database with same CATH homology
 3U8N A;  4QH4 A;  3WTH A;  3EI0 A;  4COF A;  2WN9 A;  3TLT A;  4XK9 A;  3SIO A;  3ZDH A;  2Y54 A;  4IL4 A;  3UU3 A;  4ZJS A;  4D01 A;  2PGZ A;  5L4H A;  3TLW A;  5HEO A;  5FJV A;  2W8G A;  4X5T A;  3RHW A;  3WTN A;  2WNL A;  3WTI A;  4HFD A;  5LXB A;  2BG9 B;  4AFG A;  4UM3 S;  2BG9 A;  1OED C;  4HFH A;  3P50 A;  3UU6 A;  3C79 A;  5J0Z A;  5AFM B;  5J5G A;  2Y7Y A;  5AFM A;  5L4E A;  2XQ8 A;  2XQ5 A;  3RIA A;  3UU5 A;  1I9B A;  4ILB A;  2WZY A;  2XZ5 A;  4ZZC A;  3PMZ A;  4UM1 A;  4ZK4 A;  3WTJ A;  5J5H A;  4F8H A;  5IUX A;  4PIR A;  4IL9 A;  5KE4 A;  5CO5 A;  2XNV A;  4BQT A;  2BR8 A;  3WTO A;  2BYQ A;  2YN6 A;  2XQ9 A;  3JAF A;  4ILC A;  5HCM A;  2XQ7 A;  4Z91 A;  3RQU A;  2XYS A;  2XNT A;  2LKG A;  2M6I A;  4FRR A;  4QAB A;  4LMK A;  2LLY A;  3EHZ A;  2XQA A;  2MAW A;  5HEU A;  5AFJ A;  1OED B;  4ZZB A;  1OED A;  2Y57 A;  4UXU A;  3RIF A;  2XYT A;  4WV9 A;  3UQ7 A;  2LM2 A;  3UUB A;  4XHE A;  3UU4 A;  4LML A;  5HCJ A;  2KSR A;  1OED E;  4NPP A;  3TLS A;  2WNC A;  5AFN A;  2BYN A;  4QAA A;  4HFB A;  5CFB A;  5HEJ A;  4UM3 P;  4ZRU A;  5KZU A;  2C9T A;  2YMD A;  2YOE A;  2BR7 A;  2XZ6 A;  4HFI A;  4TNV A;  2Y58 A;  2LKH A;  2XQ6 A;  3TLV A;  1UX2 A;  4ALX A;  2YME A;  4AFT A;  3SQ6 A;  2X00 D;  4A98 A;  2BYS A;  3SH1 A;  5AFK A;  5SYO A;  2ZJV A;  3WTM A;  4QH1 A;  5J5I A;  2M6B A;  2VL0 A;  3RI5 A;  3LSV A;  4ZK1 A;  2YKS A;  4TNW A;  4HQP A;  4QAC A;  2QC1 B;  4TWD A;  1UV6 A;  5HEH A;  3TLU A;  2BYP A;  2X00 A;  5BRX A;  5L47 A;  4HFE A;  2BYR A;  5J5F A;  4UM3 A;  3JAD A;  4LMJ A;  2W8F A;  3RQW A;  3P4W A;  3JAE A;  2XNU A;  4AFH A;  3UU8 A;  4A97 A;  4ILA A;  5HEG A;  5BW2 A;  4DBM A;  4IRE A;  2XQ4 A;  4TWH A;  2ZJU A;  3EAM A;  3IGQ A;  5AFL A;  2WNJ A;  3SQ9 A;  3ZDG A;  2BG9 C;  5LG3 A;  3U8M A;  4EZ1 A;  1UW6 A;  4ZJT A;  3U8K A;  4UY2 A;  3WTK A;  2BJ0 A;  2Y56 A;  2PH9 A;  5BP0 A;  3T4M A;  4Z90 A;  4NZB A;  2XQ3 A;  5TVC A;  4ZR6 A;  3U8J A;  4TWF A;  3C84 A;  3WTL A;  4BFQ A;  2BG9 E;  4QH5 A;  4HFC A;  5AIN A;  2UZ6 A;  4B5D A;  3PEO A;  3GUA A;  3UQ4 A;  5AFH A;  3U8L A;  5JME A;  3ZKR A;  3WIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...