2XQ8A

Pentameric ligand gated ion channel glic in complex with zinc ion (zn2+)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq8A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq8A01
2WNLA 4NPPA 4ZZBA 4ZRUA 3EI0A 4LMKA 2Y57A 3WTLA 3UUBA 2BG9B 5HEJA 2XQ3A 4ZJTA 4TWDA 5FJVA 5HCJA 5LG3A 2WNJA 5TVCA 3JAFA 2XYSA 4F8HA 5CFBA 5KE4A 4ZK1A 3TLSA 2W8FA 3WTKA 4ILBA 1I9BA 3WTIA 5L4HA 4X5TA 3JADA 2YN6A 5J0ZA 4FRRA 3WTJA 3ZKRA 5AFMA 4IL9A 5L47A 3UQ7A 1UW6A 3PEOA 4QH1A 5HEUA 4ZJSA 1OEDC 3SH1A 2UZ6A 2QC1B 1OEDA 4TNWA 2WZYA 4QH4A 3RIFA 4UM1A 2KSRA 4UY2A 4HFEA 5AFNA 2LKGA 2BR8A 5AFHA 2BR7A 2XNTA 3TLWA 2YMDA 5HEOA 3P50A 2ZJUA 2YKSA 4HFIA 4B5DA 3P4WA 3GUAA 4ALXA 3EHZA 4Z90A 2XQAA 3UU6A 4BFQA 5KZUA 2LM2A 3WTHA 5J5HA 4ILCA 2Y7YA 3RHWA 2XQ7A 4PIRA 3U8NA 3RQWA 3U8KA 3IGQA 2WNCA 2PH9A 2W8GA 3WTMA 1OEDB 2BJ0A 2YMEA 2XZ5A 3JAEA 4UM3P 4UM3S 2Y54A 5HCMA 2BYPA 5J5GA 2LKHA 4COFA 4QABA 5HEGA 3U8LA 5HEHA 2BG9E 4ILAA 3TLUA 2ZJVA 4AFTA 4QACA 5BRXA 3ZDGA 4XHEA 2X00D 2BG9C 2XZ6A 4LMJA 4XK9A 3WTNA 4ZZCA 3UU5A 4AFHA 4ZK4A 2M6BA 5BP0A 2XQ4A 2XQ9A 2C9TA 2XYTA 4UXUA 4BQTA 2BG9A 2XQ5A 4TWHA 3TLVA 4HQPA 4DBMA 5AFKA 5AFMB 4TNVA 2PGZA 2MAWA 3UU4A 4ZR6A 2XNVA 4A98A 2BYSA 2Y56A 4A97A 4UM3A 3RIAA 5J5FA 3RQUA 5IUXA 4QAAA 2BYQA 4HFDA 5J5IA 5AFLA 2WN9A 2X00A 4Z91A 3UQ4A 3UU8A 3SQ6A 4HFCA 2Y58A 1UV6A 2YOEA 4NZBA 3WIPA 1UX2A 4HFBA 5CO5A 4AFGA 2XQ6A 3TLTA 2LLYA 4WV9A 3SIOA 3U8JA 2XQ8A 3RI5A 5SYOA 2XNUA 2VL0A 4LMLA 4QH5A 3T4MA 3WTOA 4EZ1A 4IL4A 3C84A 4D01A 2BYNA 5JMEA 3LSVA 3C79A 5AFJA 3ZDHA 5LXBA 3U8MA 3PMZA 2BYRA 3UU3A 3EAMA 3SQ9A 2M6IA 4IREA 5AINA 5BW2A 4HFHA 4TWFA 5L4EA 1OEDE
chains in the Genus database with same CATH superfamily
3MK7C 2XYSA 4IDNA 3KDSE 5L4HA 2DWGA 4DUZT 1ZV4X 4IE0A 1T8BA 5F3JA 3UQ7A 2Q9QA 4X66T 2ODVA 1HFAA 1KK7A 4CXWA 3A7MA 4GK5E 3K1SA 4ZOLE 3PUSA 1OEDA 3AAEB 5AQGB 5LGNB 4UY2A 5AFHA 4ZEYA 5HEOA 3P50A 3CX7B 3NZQA 3VKHA 3AAAB 3ZMTB 4L9IA 1ZP0A 2Q9QC 3ZT5A 2XM1A 2BJ0A 4DV2T 2YMEA 2NOXA 4YJ2E 2LKHA 5HEGA 2FUPA 3OBVE 2PTFA 3HKDE 1QUUA 4UXUA 2BS2A 5LJNA 3PUXF 3C51A 2X9WA 4ERRA 2YDQA 2Q9QB 2V8SV 3FXEB 3N9PA 2BYQA 4HFDA 2WU2A 4EEDA 2ZMAA 3CWZB 4DV1T 5ADXL 3ANWA 3RI5A 3CX8B 1WFDA 3M65A 1VCSA 2GK9A 2YDRA 3RKOA 2WZIA 5LYJE 1W09A 2NWBA 4ZZBA 2WMOA 3UUBA 1CHUA 3NVOA 4PFOA 4TWDA 3D0TA 3CQCB 2W8FA 3PUAA 4YSYA 3WTJA 3FZMB 5AQPB 1BR1A 2Y8DA 2I59A 1BR0A 4ZI3D 2XPKA 2LSYA 2EHOA 5DABA 2OV9A 4KMCA 2MPKA 2LKGA 2X0LB 5AQHB 2JQKA 1FEWA 3PJAA 2RPAA 3WI3A 3ZCIA 4AQYT 4BFQA 4ILCA 4CQIA 3SFEA 2Y6XA 3CQGB 5ABGA 3ZCJA 4C91A 2V7MA 4WW0A 4HTEA 4COFA 4KI0F 2ZJVA 4DO0A 1JNRA 5FY0A 5FP3A 3WTNA 3U3IA 5AFKA 3MA9A 2AE9A 2C0SA 3UU4A 5AQLB 2UUAT 3QC9A 3R84B 2EHOB 4FI5A 4CN6A 3DP7A 5CGMA 4B3RT 2XQ6A 2X66A 5FYMA 2IHR1 5LHHB 1EZ3A 3T4MA 4LFAT 2BBJA 1MIWA 1IBKT 2C5KT 4IIJE 4YT0A 4HFHA 4NIQA 4J2CA 4IDOA 2VKOA 4PJMA 3JC6C 3H3MA 4ZJTA 1W0BA 4X5TA 3ZKRA 2ZM0A 3MXZA 3QB5A 3ONLC 4UVBB 1T98A 5FNVE 1SA0E 2LSIA 1L0VA 3TLWA 2IUBA 5BMVE 4ALXA 3EHZA 2VKDA 2Y7YA 1D1CA 3ZC1A 2HPLA 2XZ5A 3C64A 3AE4A 5LBMA 3I9WA 4UF0B 2VB6A 3K3NA 3JCFA 4XHEA 1YKEB 4AIUA 1J5WA 2L8KA 2LRKA 1UK5A 1I6ZA 1Y64B 2CXDA 4H9RC 5ABEA 1ZHCA 2BDEA 4AI6A 4I0UA 4JEUB 4K0UA 4NXMT 1YKHB 2XAJB 2W00A 4F6RC 5SYOA 2W63A 4OX9T 4EB6E 2A3DA 3N2GE 4YLHA 2WP9A 4IHJE 4EZHA 2LT3A 1XNQT 1KNPA 3EI0A 3ZYKA 5TVCA 3TLSA 2XQYA 3RYHE 4WNKA 3O1JA 3MKDA 5J0ZA 4QHOA 1M7KA 3PTRB 5M4YA 1UW6A 4IE6A 3AE5A 4OHFA 3EDUA 5JDLA 4JUYA 2LSGA 2LEHA 5LBQB 3RX6A 1N33T 4HFEA 1HF8A 4XZCA 2CCQA 4EYUA 3PUVF 1M62A 5AQNB 3DTOA 2CLYC 1DU2A 4Z90A 2BVLA 2JMKA 3RKGA 2IIUA 1S94A 2WZHA 2X9XA 4B3MT 4QABA 5A1LA 3AAIA 2XZ6A 3QB5K 4G2AA 4E7SA 4ZZCA 5BP0A 2M67A 4KUMB 2CLYB 4OFZA 4AXPA 2ZM8A 1IJ6A 2W61A 5AQTB 5J5FA 4Z91A 3LFMA 3UU8A 4UV8B 1MNDA 4EZ4A 1UX2A 5GONE 4WV9A 5JR9A 4QH5A 5FXZA 2BVMA 1D1BA 2WS3A 5JMEA 2KWIB 4DMVA 3ZC0A 2VKHA 3EAMA 3A5XA 2IDOB 3M3ZB 3NRYA 4H9QC 1BR4A 2EHOD 3OVUA 2MTQA 4ILBA 2YU1A 3E22E 3KV4A 2I6HA 4U2YA 2A2FX 2E5LT 3X1DA 1XDPA 5HAXA 3ZLIA 2QA7A 1KNZA 1U5PA 2UZ6A 2NW9A 1XZYA 3RLFF 2V7JA 4YJ3E 3AVRA 3PDYA 3P4WA 3KINB 4JV5T 4BJNA 4ZHQE 2CE7A 5C2TA 3P7IA 3I1AA 1IAPA 4AKRB 3AE3A 5HCMA 2Y54A 2P9BA 4UR9A 2JPFA 2BG9E 3TLUA 5BRXA 2BG9C 1ZKEA 4AFHA 4IE7A 2XQ4A 4DR3T 5FY7A 1FMWA 2QYWA 5LHIB 2LM9A 4ZR6A 2JQHA 2V6YA 2BYSA 3LDQB 4A97A 2DCFA 2H7OA 3ZEFB 3EVYA 2WN9A 3CKDA 5F8PA 1QLBA 1N32T 4PJJA 4ASKA 2X68A 1CUNA 3Q5EA 2X51A 3SS1A 3TLTA 3U78A 2E8IA 3AA0B 2LOSA 1WR0A 4ZS3A 4PK4A 2BYRA 4IDQA 5L3EB 4LF9T 5FL1A 4DIDB 2XAQB 4L0RA 4JBWF 3N5LA 2Y57A 2QGSA 4H9PC 1XNRT 3AB3B 3BQIA 3JAFA 4CN4A 2V6YB 3G06A 3OTOT 1G73A 5FXVA 3VU7H 4O4HE 3I0QA 1U4QA 1HX1B 3PU8A 3QNUA 3AA1B 3PV0F 5DQWA 5AFUL 4GKKT 5LCYA 5AQJB 4N78D 4XBFB 2ODUA 5AFNA 2YMDA 2CWOA 2WM9A 4JEHB 5LP6E 3GUAA 2YINA 4JI8T 4DR1T 2VQFT 4OYKA 4Q25A 3JAEA 5LB7B 4UM3S 4KBMB 5L3CB 4ZI7E 4IGUA 5HEHA 3SFDA 4YTPA 3L39A 4DMWA 4HQPA 4EEBA 4H9SE 5AQQB 3LK3B 1SE7A 4U72A 3CK6A 2KNDA 5JDFA 1UUSA 1R8IA 4QAAA 2OLTA 1MNEA 4DUYT 3PUWF 3VRBA 4EXTA 3FZKB 2JQQA 2OA5A 2N1GA 5CA1E 4UIGA 1NEKA 4HWIB 2DNXA 3AEBA 1W9RA 3ZDHA 1XMOT 5HXHA 3RGLA 3AVSA 3EDVA 3UFGA 1OEDE 5JTGA 1WR6A 2LHRA 5AQOB 3WTLA 1BR2A 2D9DA 5TAOA 5LXTE 3RC8A 2IMLA 1HG2A 4HWDA 4YTNA 2VVSA 4X65T 5AQMB 1Z8UA 4CN1A 3CPZA 3JADA 4CXXA 4I43B 1ZEEA 3UULA 3AECA 5J2TE 2WMNA 3B5MA 3CMLA 2BKPA 3BQKA 1SUMB 2KSRA 1S35A 2H7VC 5JDHA 2V5CA 2BR7A 2LHNA 2JQ9A 5FVKA 3IGQA 2WNCA 3AEDA 3T1YT 2SPCA 3R6NA 4TN7B 3ZDGA 4ZS2A 4XK9A 1LKXA 3QK6A 3VR9A 4TUYE 3ZMUB 4WYVA 5AQUB 5LOVE 2WCAA 1MMDA 5IUXA 2X00A 1J5ET 4DV4T 3AE8A 4PK6A 4U3CA 3SIOA 3U8JA 4PNIA 2XNUA 5JH7E 3Q9DA 4TX5A 3WAKA 3ZMZB 3CX6B 3UT5E 2MOZA 5J1GA 2DL1A 3UU3A 1WRDA 3LJCA 1GQEA 2DI4A 3LG7A 3LBXA 4TZ4C 4DV3T 3ETUA 3PURA 5ABHA 5L3DB 2YN6A 3S4UA 5HYAA 3AEAA 3PUZF 2W62A 2V5DA 2YDSA 1LVFA 1HR0T 3ZN0B 2ACXA 4UF0A 3UTKA 4JLEA 4YHHT 2LE8A 1NWMX 1JNZA 3FZFB 4CI3B 4UEMA 4EIWA 4NUVA 4HWFA 4BJMA 4IT4A 1YQ3A 3LBXB 4UM3P 1QSDA 1T72A 4ILAA 4QACA 5JRCA 2LJLA 2XQ9A 4DV7T 4BQTA 3H3AA 5LGUB 3RYIE 4KP3C 4X1YE 4AKGA 4A98A 5LMUT 2Y56A 4UM3A 2E2AA 1D0ZA 4GK0E 4UXNB 3T8OA 4U31A 3RIUA 4AKIA 2HN1A 3ZPOA 3PU3A 4HWHA 5HXRA 1US7B 3SQ9A 4B3ST 3KV6A 3ZT6A 4DR2T 4NPPA 4QKNA 2LRLA 4U74A 4ZRUA 3MZKB 5JRCB 5LHGB 4G63A 2ACZA 5FXWA 2DLRA 1HS7A 3RIUC 5LG3A 2WNJA 2JJ9A 4X1KE 5FMNA 3N9OA 5IHYA 2PBIA 1X79A 3HKBE 3FZHB 4CI1B 4HEAA 2XAHB 4IDZA 5JDGA 3K3QC 4AISA 2VASA 3LK42 4YXDA 2Q9QD 3P4RA 4MHCA 5J2UE 5KMGP 2ZJUA 2C5IT 4B5DA 1ZOYA 3UU6A 2LM2A 3ZN1B 3K3OA 4H63H 3ZT7A 5C3JA 5BR8T 1AJ3A 3CQXC 3QUJA 3HKCE 4U7IA 4B3TT 3OJAA 4X64T 2M6BA 2XQ5A 3HI2A 3KVAA 3I0OA 4UVAB 3O1IA 3KBUA 4JI6T 2MBGA 3C4WA 2J62A 2HN2A 2NTYA 1KNRA 2UXNB 4GYSA 3ZSSA 3LSVA 1WCRA 3C79A 4LFCT 2V6XA 2PFVA 2WU5A 3KVBA 2YU2A 3IEEA 4FJOA 4CXYA 3Q2MA 3AA7B 4CZZB 5L2LA 1YQ4A 3N9LA 4TV8E 1I9BA 2XM2A 2K5BB 3SWHA 1OWAA 5AQIB 4KX6A 2R6GF 4HE8A 3B13A 3RIFA 1VOMA 3OPCA 4ZI3C 4DR6T 4PJNA 5H6RB 2WSSV 4ADZA 2NR4A 1FJGT 3MACA 5J5HA 2KZ7B 2IC6A 4JI4T 4I4TE 5JREA 3P8CD 5FL0A 4UV9B 3OYZA 2W67A 5AQSB 2X00D 2VWAA 4K0KT 2BG9A 4AKHA 4DR7T 2PGZA 5L3FB 2KINB 3GWHA 5HXEA 1I94T 2CM0A 3RQUA 4UELA 1Y01A 1XDOA 1VRBA 4GYRA 2UUCT 2HH7A 2JIWA 3RH3A 4HFCA 4ISTA 2X0YA 3ZSTA 1HNWT 5AQVB 2VL0A 4BA9A 4YY3T 3ONJA 3AEEA 3JC6D 3HL6A 4KHZF 2JRKA 3J9X1 5LXBA 4DV6T 1YXRA 1HNXT 4ANJA 2F4VT 2WBLA 1YD8G 4DV0T 3AE6A 3O4XE 2BBHA 3QOFA 2BG9B 3N2OA 5FJVA 3ZYMA 3ABVA 3J7Yq 4GKJT 2YK0A 2MYSA 5HWXA 3WTIA 1G8XA 2W2UA 4XAXB 2L9QA 3RF1A 2G0UA 3KV9A 4ZXLA 2WWUA 2JMHA 3EUHA 2XZEA 3A8YC 5EK4A 2WB5A 2H89A 3VKGA 3K8PC 1MIYA 4AKLA 2XQ7A 4OK0A 4JI1T 3DJBA 2RP4A 2K48A 3U8KA 1N34T 4DVDA 4EAHA 5J5GA 2W4XA 3T1HT 2QRXA 3Q5XA 4LMJA 5AQKB 4DBMA 1E1HB 4V1Av 2XUEA 3RIAA 3I9YA 4O4IE 1NENA 5CB4E 1E2AA 5ETWA 2X9HA 4AFGA 2PJQA 2LLYA 3E0ZA 3BQLA 3RYCE 3AE2A 1N36T 4EZ1A 3C84A 4DR4T 2BYNA 3C98B 4LF6T 2XJ7A 2IAKA 2AXDS 4X62T 4IREA 3OYXA 3C4ZA 1VCTA 4ZI2C 4JYAT 2NW8A 3P4PA 3SOLA 2HHHT 4BAYB 2WDRA 3F2EA 3HKEE 3W15B 4FRRA 4U7YA 3NZPA 3Q5DA 1KF6A 5AQFB 3ZJ2A 4HN9A 4H9NC 4MBQA 4QH1A 3PEOA 1OEDC 2V7IA 4PFPA 2FJAA 3SH1A 2QC1B 5HXCA 3P4QA 3ZJ1A 5LNKA 4HFVA 2VL8A 2I0MA 3LK2B 5FY1A 2V7KA 4JI0T 2VVNA 3RHWA 2A9UA 3U8NA 2PH9A 3WTMA 1OEDB 3AXJA 2ZM2A 4PK5A 5DQVA 2BYPA 3KBTA 3N2KE 3N9NA 5JDMA 2ES0A 2XNVA 2CHOA 4A56A 2LOPA 2C5JA 3VR8A 2YEVC 4AQFA 2NP9A 4LF8T 3WIPA 4O4LE 4I55E 2CEAA 4EGWA 4I50E 3L3PA 1H7CA 3RYFE 3UUNA 2CXLA 3RRCA 2VURA 3KFWX 3ZMVB 4WBOA 5AFJA 3U8MA 1D0YA 3AXJB 2CPTA 5AINA 2X67A 2CA5A 4AQFC 3ANWB 2WNLA 3O9XA 3IBPA 5FKYA 4LMKA 4OYJA 2K9AA 5HCJA 3UFEA 3V5SA 4U2ZA 2Z6EA 2X0HA 4JI5T 3RRWA 4P09A 2KXPB 5E0OA 2B1EA 3RC3A 3VHLA 2NTXA 2EHOC 3IHRA 2BS3A 5CA0E 5EK3A 2BS4A 2D2SA 3FHNA 2D0UA 5IWAT 2N2NA 4EYYR 2WDVA 4TNWA 4UM1A 5F5WA 5L3BB 1IZNB 2XNTA 4GOUA 4NXNT 1HX8A 1XWMA 4HKAA 4QX8B 5KX5E 3PUQA 1T7SA 2E9XA 3GMIA 3PE0A 3AA6B 3RQWA 4EOZB 2H88A 3FXDB 2WY2A 4P1NA 4M1PA 4AFTA 4MALA 4PW8A 2UXDT 2KLQA 2C9TA 2XHEB 4PAGA 1XMQT 5HXSA 4HWCA 1J1JA 2E9XC 5ABFA 1HNZT 4Z8XA 3SQ6A 3CVRA 4H63V 1WLXA 1UV6A 4NZBA 3PUGA 3UUXB 2CBJA 2FJBA 4A5XA 2BKOA 2KT9A 3WTOA 3ONXA 2DHRA 3WAJA 3KV5A 3FBLA 5L3GB 2E9XB 3AE9A 1FIOA 3EABA 3O1HA 5AQRB 3UUMA 3TKLB 3VRAA 4JI3T 4HGAA 5HWYA 4LF4T 2UXBT 1YW0A 2D5UA 1IJ5A 4YHJA 3F31A 4QXCB 2RA1A 1IBMT 4DBQA 4F8HA 5CFBA 4ZK1A 4YTMA 5ABFB 3C4XA 2PG8A 3ZMSB 4P0AA 3B57A 1MMAA 4QXHB 3ETVA 5AFMA 4IL9A 5KXJA 5L47A 3Q5WA 3GA8A 5HEUA 4MFRA 3GN5A 4DNDA 4U33A 2WWVA 5C8YE 2XQAA 5KZUA 4LF7T 2W8GA 2V26A 2UU9T 2W66A 2ZLYA 1LVKA 2W0GA 5EK2A 3CIRA 2XYTA 2XASB 4DBRA 3AE7A 4TWHA 1D0XA 2E5VA 4ZI2D 5AFMB 2MAWA 1O3XA 3HR0A 5LA6E 2DWKA 3GN5B 3C50A 2J47A 1V9DA 5LG4A 2CBIA 1X9BA 3UQ4A 4E7ZA 2YOEA 2NW7A 1MIVA 2XQ8A 4O8SA 5LJMA 1SHZC 1UURA 4D01A 2XTLA 2BKNA 4CI2B 5JQGE 3MJXA 4IE5A 2A72A 4ILUA 3PMZA 4UVCB 4O4JE 4DV5T 3IF8B 3L09A 1KEYA 2K3WA 2V1DB 4B6XA 4IDPA 1MMNA 3PJAJ 2UXXB 2K24A 2XQ3A 1HTJF 2CRBA 3N9QA 3AEFA 3FB2A 2XY8B 3ESLA 1UGOA 4X20E 4O2BE 5FXXA 2B76A 1Z0PA 2QVAA 4JI7T 3BK9A 1LRZA 2LSKA 1UX5A 4O2AE 2V7LA 4TV9E 4P0BA 4MLKA 3F57A 3NBXX 3E08A 2FJDA 4C90A 3WTHA 2CMRA 5JDQA 4AQGA 3ZYLA 3U8LA 4WZXA 5CJ5A 5LGTB 2WDQA 2LSJA 4YSZA 3UU5A 2XSAA 3TLVA 2VQET 4TNVA 1WYCA 2Y48B 4YFSA 5AFLA 4YSXA 5EZYE 3SRZA 5JR9C 5CO5A 2WAUA 1IBLT 1UCUA 2FJEA 1E7PA 5H6QB 4LMLA 3AE1A 4L5GA 2XAFB 4IL4A 5FVLA 1UX4A 3H37A 3RPUA 4X1IE 2N9DA 5LMNT 2X9YA 2M6IA 2CHNA 4TWFA 2J1DG 2UUBT 4ISSA 3NRXA 5JR9B 2HPJA 2CWYA 4JI2T 5JVDE 2IC9A 2XSBA 5HEJA 2KWHA 2VKJA 5KE4A 3L8RA 5IYZE 3WTKA 4GIWA 1NAFA 3P4SA 4NUUA 1FMVA 5KDMC 2VK9A 3OKQA 4EV6A 4KHPT 2L3LA 1B7TA 4ZJSA 2E9XD 4WBNE 2WZYA 4QH4A 2J4GA 3PUYF 2BR8A 3AEGA 4LFBT 3FZLB 4LF5T 1W0AA 5JDNA 2YKSA 4HFIA 3NKZA 1WYBA 2BZBA 2KMFA 4PIRA 4PJLA 2UXCT 3V5UA 4ZK4A 4QWNB 1HG5A 5DJQC 2D0TA 2CXFA 4QX7B 5J5IA 3N9MA 4QXBB 2Y58A 1MMGA 4HFBA 1D1AA 2FBWA 1KFYA 2H3RA 4IE4A 2WQYA 2ZM6T 3FBZA 4H9OC 2IW5B 1OXZA 3NWIA 2XAGB 3IA3A 5BW2A 4DR5T 5L4EA 3HA4A 1HCIA
chains in the Genus database with same CATH topology
2WNLA 4NPPA 4ZZBA 4ZRUA 3EI0A 4LMKA 2Y57A 3WTLA 3UUBA 2BG9B 5HEJA 2XQ3A 4ZJTA 4TWDA 5FJVA 5HCJA 5LG3A 2WNJA 5TVCA 3JAFA 2XYSA 4F8HA 5CFBA 5KE4A 4ZK1A 3TLSA 2W8FA 3WTKA 4ILBA 1I9BA 3WTIA 5L4HA 4X5TA 3JADA 2YN6A 5J0ZA 4FRRA 3WTJA 3ZKRA 5AFMA 4IL9A 5L47A 3UQ7A 1UW6A 3PEOA 4QH1A 5HEUA 4ZJSA 1OEDC 3SH1A 2UZ6A 2QC1B 1OEDA 4TNWA 2WZYA 4QH4A 3RIFA 4UM1A 2KSRA 4UY2A 4HFEA 5AFNA 2LKGA 2BR8A 5AFHA 2BR7A 2XNTA 3TLWA 2YMDA 5HEOA 3P50A 2ZJUA 2YKSA 4HFIA 4B5DA 3P4WA 3GUAA 4ALXA 3EHZA 4Z90A 2XQAA 3UU6A 4BFQA 5KZUA 2LM2A 3WTHA 5J5HA 4ILCA 2Y7YA 3RHWA 2XQ7A 4PIRA 3U8NA 3RQWA 3U8KA 3IGQA 2WNCA 2PH9A 2W8GA 3WTMA 1OEDB 2BJ0A 2YMEA 2XZ5A 3JAEA 4UM3P 4UM3S 2Y54A 5HCMA 2BYPA 5J5GA 2LKHA 4COFA 4QABA 5HEGA 3U8LA 5HEHA 2BG9E 4ILAA 3TLUA 2ZJVA 4AFTA 4QACA 5BRXA 3ZDGA 4XHEA 2X00D 2BG9C 2XZ6A 4LMJA 4XK9A 3WTNA 4ZZCA 3UU5A 4AFHA 4ZK4A 2M6BA 5BP0A 2XQ4A 2XQ9A 2C9TA 2XYTA 4UXUA 4BQTA 2BG9A 2XQ5A 4TWHA 3TLVA 4HQPA 4DBMA 5AFKA 5AFMB 4TNVA 2PGZA 2MAWA 3UU4A 4ZR6A 2XNVA 4A98A 2BYSA 2Y56A 4A97A 4UM3A 3RIAA 5J5FA 3RQUA 5IUXA 4QAAA 2BYQA 4HFDA 5J5IA 5AFLA 2WN9A 2X00A 4Z91A 3UQ4A 3UU8A 3SQ6A 4HFCA 2Y58A 1UV6A 2YOEA 4NZBA 3WIPA 1UX2A 4HFBA 5CO5A 4AFGA 2XQ6A 3TLTA 2LLYA 4WV9A 3SIOA 3U8JA 2XQ8A 3RI5A 5SYOA 2XNUA 2VL0A 4LMLA 4QH5A 3T4MA 3WTOA 4EZ1A 4IL4A 3C84A 4D01A 2BYNA 5JMEA 3LSVA 3C79A 5AFJA 3ZDHA 5LXBA 3U8MA 3PMZA 2BYRA 3UU3A 3EAMA 3SQ9A 2M6IA 4IREA 5AINA 5BW2A 4HFHA 4TWFA 5L4EA 1OEDE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNL A;  4NPP A;  4ZZB A;  4ZRU A;  3EI0 A;  4LMK A;  2Y57 A;  3WTL A;  3UUB A;  2BG9 B;  5HEJ A;  2XQ3 A;  4ZJT A;  4TWD A;  5FJV A;  5HCJ A;  5LG3 A;  2WNJ A;  5TVC A;  3JAF A;  2XYS A;  4F8H A;  5CFB A;  5KE4 A;  4ZK1 A;  3TLS A;  2W8F A;  3WTK A;  4ILB A;  1I9B A;  3WTI A;  5L4H A;  4X5T A;  3JAD A;  2YN6 A;  5J0Z A;  4FRR A;  3WTJ A;  3ZKR A;  5AFM A;  4IL9 A;  5L47 A;  3UQ7 A;  1UW6 A;  3PEO A;  4QH1 A;  5HEU A;  4ZJS A;  1OED C;  3SH1 A;  2UZ6 A;  2QC1 B;  1OED A;  4TNW A;  2WZY A;  4QH4 A;  3RIF A;  4UM1 A;  2KSR A;  4UY2 A;  4HFE A;  5AFN A;  2LKG A;  2BR8 A;  5AFH A;  2BR7 A;  2XNT A;  3TLW A;  2YMD A;  5HEO A;  3P50 A;  2ZJU A;  2YKS A;  4HFI A;  4B5D A;  3P4W A;  3GUA A;  4ALX A;  3EHZ A;  4Z90 A;  2XQA A;  3UU6 A;  4BFQ A;  5KZU A;  2LM2 A;  3WTH A;  5J5H A;  4ILC A;  2Y7Y A;  3RHW A;  2XQ7 A;  4PIR A;  3U8N A;  3RQW A;  3U8K A;  3IGQ A;  2WNC A;  2PH9 A;  2W8G A;  3WTM A;  1OED B;  2BJ0 A;  2YME A;  2XZ5 A;  3JAE A;  4UM3 P;  4UM3 S;  2Y54 A;  5HCM A;  2BYP A;  5J5G A;  2LKH A;  4COF A;  4QAB A;  5HEG A;  3U8L A;  5HEH A;  2BG9 E;  4ILA A;  3TLU A;  2ZJV A;  4AFT A;  4QAC A;  5BRX A;  3ZDG A;  4XHE A;  2X00 D;  2BG9 C;  2XZ6 A;  4LMJ A;  4XK9 A;  3WTN A;  4ZZC A;  3UU5 A;  4AFH A;  4ZK4 A;  2M6B A;  5BP0 A;  2XQ4 A;  2XQ9 A;  2C9T A;  2XYT A;  4UXU A;  4BQT A;  2BG9 A;  2XQ5 A;  4TWH A;  3TLV A;  4HQP A;  4DBM A;  5AFK A;  5AFM B;  4TNV A;  2PGZ A;  2MAW A;  3UU4 A;  4ZR6 A;  2XNV A;  4A98 A;  2BYS A;  2Y56 A;  4A97 A;  4UM3 A;  3RIA A;  5J5F A;  3RQU A;  5IUX A;  4QAA A;  2BYQ A;  4HFD A;  5J5I A;  5AFL A;  2WN9 A;  2X00 A;  4Z91 A;  3UQ4 A;  3UU8 A;  3SQ6 A;  4HFC A;  2Y58 A;  1UV6 A;  2YOE A;  4NZB A;  3WIP A;  1UX2 A;  4HFB A;  5CO5 A;  4AFG A;  2XQ6 A;  3TLT A;  2LLY A;  4WV9 A;  3SIO A;  3U8J A;  2XQ8 A;  3RI5 A;  5SYO A;  2XNU A;  2VL0 A;  4LML A;  4QH5 A;  3T4M A;  3WTO A;  4EZ1 A;  4IL4 A;  3C84 A;  4D01 A;  2BYN A;  5JME A;  3LSV A;  3C79 A;  5AFJ A;  3ZDH A;  5LXB A;  3U8M A;  3PMZ A;  2BYR A;  3UU3 A;  3EAM A;  3SQ9 A;  2M6I A;  4IRE A;  5AIN A;  5BW2 A;  4HFH A;  4TWF A;  5L4E A;  1OED E; 
#chains in the Genus database with same CATH topology
 3MK7 C;  2XYS A;  4IDN A;  3KDS E;  5L4H A;  2DWG A;  4DUZ T;  1ZV4 X;  4IE0 A;  1T8B A;  5F3J A;  3UQ7 A;  2Q9Q A;  4X66 T;  2ODV A;  1HFA A;  1KK7 A;  4CXW A;  3A7M A;  4GK5 E;  3K1S A;  4ZOL E;  3PUS A;  1OED A;  3AAE B;  5AQG B;  5LGN B;  4UY2 A;  5AFH A;  4ZEY A;  5HEO A;  3P50 A;  3CX7 B;  3NZQ A;  3VKH A;  3AAA B;  3ZMT B;  4L9I A;  1ZP0 A;  2Q9Q C;  3ZT5 A;  2XM1 A;  2BJ0 A;  4DV2 T;  2YME A;  2NOX A;  4YJ2 E;  2LKH A;  5HEG A;  2FUP A;  3OBV E;  2PTF A;  3HKD E;  1QUU A;  4UXU A;  2BS2 A;  5LJN A;  3PUX F;  3C51 A;  2X9W A;  4ERR A;  2YDQ A;  2Q9Q B;  2V8S V;  3FXE B;  3N9P A;  2BYQ A;  4HFD A;  2WU2 A;  4EED A;  2ZMA A;  3CWZ B;  4DV1 T;  5ADX L;  3ANW A;  3RI5 A;  3CX8 B;  1WFD A;  3M65 A;  1VCS A;  2GK9 A;  2YDR A;  3RKO A;  2WZI A;  5LYJ E;  1W09 A;  2NWB A;  4ZZB A;  2WMO A;  3UUB A;  1CHU A;  3NVO A;  4PFO A;  4TWD A;  3D0T A;  3CQC B;  2W8F A;  3PUA A;  4YSY A;  3WTJ A;  3FZM B;  5AQP B;  1BR1 A;  2Y8D A;  2I59 A;  1BR0 A;  4ZI3 D;  2XPK A;  2LSY A;  2EHO A;  5DAB A;  2OV9 A;  4KMC A;  2MPK A;  2LKG A;  2X0L B;  5AQH B;  2JQK A;  1FEW A;  3PJA A;  2RPA A;  3WI3 A;  3ZCI A;  4AQY T;  4BFQ A;  4ILC A;  4CQI A;  3SFE A;  2Y6X A;  3CQG B;  5ABG A;  3ZCJ A;  4C91 A;  2V7M A;  4WW0 A;  4HTE A;  4COF A;  4KI0 F;  2ZJV A;  4DO0 A;  1JNR A;  5FY0 A;  5FP3 A;  3WTN A;  3U3I A;  5AFK A;  3MA9 A;  2AE9 A;  2C0S A;  3UU4 A;  5AQL B;  2UUA T;  3QC9 A;  3R84 B;  2EHO B;  4FI5 A;  4CN6 A;  3DP7 A;  5CGM A;  4B3R T;  2XQ6 A;  2X66 A;  5FYM A;  2IHR 1;  5LHH B;  1EZ3 A;  3T4M A;  4LFA T;  2BBJ A;  1MIW A;  1IBK T;  2C5K T;  4IIJ E;  4YT0 A;  4HFH A;  4NIQ A;  4J2C A;  4IDO A;  2VKO A;  4PJM A;  3JC6 C;  3H3M A;  4ZJT A;  1W0B A;  4X5T A;  3ZKR A;  2ZM0 A;  3MXZ A;  3QB5 A;  3ONL C;  4UVB B;  1T98 A;  5FNV E;  1SA0 E;  2LSI A;  1L0V A;  3TLW A;  2IUB A;  5BMV E;  4ALX A;  3EHZ A;  2VKD A;  2Y7Y A;  1D1C A;  3ZC1 A;  2HPL A;  2XZ5 A;  3C64 A;  3AE4 A;  5LBM A;  3I9W A;  4UF0 B;  2VB6 A;  3K3N A;  3JCF A;  4XHE A;  1YKE B;  4AIU A;  1J5W A;  2L8K A;  2LRK A;  1UK5 A;  1I6Z A;  1Y64 B;  2CXD A;  4H9R C;  5ABE A;  1ZHC A;  2BDE A;  4AI6 A;  4I0U A;  4JEU B;  4K0U A;  4NXM T;  1YKH B;  2XAJ B;  2W00 A;  4F6R C;  5SYO A;  2W63 A;  4OX9 T;  4EB6 E;  2A3D A;  3N2G E;  4YLH A;  2WP9 A;  4IHJ E;  4EZH A;  2LT3 A;  1XNQ T;  1KNP A;  3EI0 A;  3ZYK A;  5TVC A;  3TLS A;  2XQY A;  3RYH E;  4WNK A;  3O1J A;  3MKD A;  5J0Z A;  4QHO A;  1M7K A;  3PTR B;  5M4Y A;  1UW6 A;  4IE6 A;  3AE5 A;  4OHF A;  3EDU A;  5JDL A;  4JUY A;  2LSG A;  2LEH A;  5LBQ B;  3RX6 A;  1N33 T;  4HFE A;  1HF8 A;  4XZC A;  2CCQ A;  4EYU A;  3PUV F;  1M62 A;  5AQN B;  3DTO A;  2CLY C;  1DU2 A;  4Z90 A;  2BVL A;  2JMK A;  3RKG A;  2IIU A;  1S94 A;  2WZH A;  2X9X A;  4B3M T;  4QAB A;  5A1L A;  3AAI A;  2XZ6 A;  3QB5 K;  4G2A A;  4E7S A;  4ZZC A;  5BP0 A;  2M67 A;  4KUM B;  2CLY B;  4OFZ A;  4AXP A;  2ZM8 A;  1IJ6 A;  2W61 A;  5AQT B;  5J5F A;  4Z91 A;  3LFM A;  3UU8 A;  4UV8 B;  1MND A;  4EZ4 A;  1UX2 A;  5GON E;  4WV9 A;  5JR9 A;  4QH5 A;  5FXZ A;  2BVM A;  1D1B A;  2WS3 A;  5JME A;  2KWI B;  4DMV A;  3ZC0 A;  2VKH A;  3EAM A;  3A5X A;  2IDO B;  3M3Z B;  3NRY A;  4H9Q C;  1BR4 A;  2EHO D;  3OVU A;  2MTQ A;  4ILB A;  2YU1 A;  3E22 E;  3KV4 A;  2I6H A;  4U2Y A;  2A2F X;  2E5L T;  3X1D A;  1XDP A;  5HAX A;  3ZLI A;  2QA7 A;  1KNZ A;  1U5P A;  2UZ6 A;  2NW9 A;  1XZY A;  3RLF F;  2V7J A;  4YJ3 E;  3AVR A;  3PDY A;  3P4W A;  3KIN B;  4JV5 T;  4BJN A;  4ZHQ E;  2CE7 A;  5C2T A;  3P7I A;  3I1A A;  1IAP A;  4AKR B;  3AE3 A;  5HCM A;  2Y54 A;  2P9B A;  4UR9 A;  2JPF A;  2BG9 E;  3TLU A;  5BRX A;  2BG9 C;  1ZKE A;  4AFH A;  4IE7 A;  2XQ4 A;  4DR3 T;  5FY7 A;  1FMW A;  2QYW A;  5LHI B;  2LM9 A;  4ZR6 A;  2JQH A;  2V6Y A;  2BYS A;  3LDQ B;  4A97 A;  2DCF A;  2H7O A;  3ZEF B;  3EVY A;  2WN9 A;  3CKD A;  5F8P A;  1QLB A;  1N32 T;  4PJJ A;  4ASK A;  2X68 A;  1CUN A;  3Q5E A;  2X51 A;  3SS1 A;  3TLT A;  3U78 A;  2E8I A;  3AA0 B;  2LOS A;  1WR0 A;  4ZS3 A;  4PK4 A;  2BYR A;  4IDQ A;  5L3E B;  4LF9 T;  5FL1 A;  4DID B;  2XAQ B;  4L0R A;  4JBW F;  3N5L A;  2Y57 A;  2QGS A;  4H9P C;  1XNR T;  3AB3 B;  3BQI A;  3JAF A;  4CN4 A;  2V6Y B;  3G06 A;  3OTO T;  1G73 A;  5FXV A;  3VU7 H;  4O4H E;  3I0Q A;  1U4Q A;  1HX1 B;  3PU8 A;  3QNU A;  3AA1 B;  3PV0 F;  5DQW A;  5AFU L;  4GKK T;  5LCY A;  5AQJ B;  4N78 D;  4XBF B;  2ODU A;  5AFN A;  2YMD A;  2CWO A;  2WM9 A;  4JEH B;  5LP6 E;  3GUA A;  2YIN A;  4JI8 T;  4DR1 T;  2VQF T;  4OYK A;  4Q25 A;  3JAE A;  5LB7 B;  4UM3 S;  4KBM B;  5L3C B;  4ZI7 E;  4IGU A;  5HEH A;  3SFD A;  4YTP A;  3L39 A;  4DMW A;  4HQP A;  4EEB A;  4H9S E;  5AQQ B;  3LK3 B;  1SE7 A;  4U72 A;  3CK6 A;  2KND A;  5JDF A;  1UUS A;  1R8I A;  4QAA A;  2OLT A;  1MNE A;  4DUY T;  3PUW F;  3VRB A;  4EXT A;  3FZK B;  2JQQ A;  2OA5 A;  2N1G A;  5CA1 E;  4UIG A;  1NEK A;  4HWI B;  2DNX A;  3AEB A;  1W9R A;  3ZDH A;  1XMO T;  5HXH A;  3RGL A;  3AVS A;  3EDV A;  3UFG A;  1OED E;  5JTG A;  1WR6 A;  2LHR A;  5AQO B;  3WTL A;  1BR2 A;  2D9D A;  5TAO A;  5LXT E;  3RC8 A;  2IML A;  1HG2 A;  4HWD A;  4YTN A;  2VVS A;  4X65 T;  5AQM B;  1Z8U A;  4CN1 A;  3CPZ A;  3JAD A;  4CXX A;  4I43 B;  1ZEE A;  3UUL A;  3AEC A;  5J2T E;  2WMN A;  3B5M A;  3CML A;  2BKP A;  3BQK A;  1SUM B;  2KSR A;  1S35 A;  2H7V C;  5JDH A;  2V5C A;  2BR7 A;  2LHN A;  2JQ9 A;  5FVK A;  3IGQ A;  2WNC A;  3AED A;  3T1Y T;  2SPC A;  3R6N A;  4TN7 B;  3ZDG A;  4ZS2 A;  4XK9 A;  1LKX A;  3QK6 A;  3VR9 A;  4TUY E;  3ZMU B;  4WYV A;  5AQU B;  5LOV E;  2WCA A;  1MMD A;  5IUX A;  2X00 A;  1J5E T;  4DV4 T;  3AE8 A;  4PK6 A;  4U3C A;  3SIO A;  3U8J A;  4PNI A;  2XNU A;  5JH7 E;  3Q9D A;  4TX5 A;  3WAK A;  3ZMZ B;  3CX6 B;  3UT5 E;  2MOZ A;  5J1G A;  2DL1 A;  3UU3 A;  1WRD A;  3LJC A;  1GQE A;  2DI4 A;  3LG7 A;  3LBX A;  4TZ4 C;  4DV3 T;  3ETU A;  3PUR A;  5ABH A;  5L3D B;  2YN6 A;  3S4U A;  5HYA A;  3AEA A;  3PUZ F;  2W62 A;  2V5D A;  2YDS A;  1LVF A;  1HR0 T;  3ZN0 B;  2ACX A;  4UF0 A;  3UTK A;  4JLE A;  4YHH T;  2LE8 A;  1NWM X;  1JNZ A;  3FZF B;  4CI3 B;  4UEM A;  4EIW A;  4NUV A;  4HWF A;  4BJM A;  4IT4 A;  1YQ3 A;  3LBX B;  4UM3 P;  1QSD A;  1T72 A;  4ILA A;  4QAC A;  5JRC A;  2LJL A;  2XQ9 A;  4DV7 T;  4BQT A;  3H3A A;  5LGU B;  3RYI E;  4KP3 C;  4X1Y E;  4AKG A;  4A98 A;  5LMU T;  2Y56 A;  4UM3 A;  2E2A A;  1D0Z A;  4GK0 E;  4UXN B;  3T8O A;  4U31 A;  3RIU A;  4AKI A;  2HN1 A;  3ZPO A;  3PU3 A;  4HWH A;  5HXR A;  1US7 B;  3SQ9 A;  4B3S T;  3KV6 A;  3ZT6 A;  4DR2 T;  4NPP A;  4QKN A;  2LRL A;  4U74 A;  4ZRU A;  3MZK B;  5JRC B;  5LHG B;  4G63 A;  2ACZ A;  5FXW A;  2DLR A;  1HS7 A;  3RIU C;  5LG3 A;  2WNJ A;  2JJ9 A;  4X1K E;  5FMN A;  3N9O A;  5IHY A;  2PBI A;  1X79 A;  3HKB E;  3FZH B;  4CI1 B;  4HEA A;  2XAH B;  4IDZ A;  5JDG A;  3K3Q C;  4AIS A;  2VAS A;  3LK4 2;  4YXD A;  2Q9Q D;  3P4R A;  4MHC A;  5J2U E;  5KMG P;  2ZJU A;  2C5I T;  4B5D A;  1ZOY A;  3UU6 A;  2LM2 A;  3ZN1 B;  3K3O A;  4H63 H;  3ZT7 A;  5C3J A;  5BR8 T;  1AJ3 A;  3CQX C;  3QUJ A;  3HKC E;  4U7I A;  4B3T T;  3OJA A;  4X64 T;  2M6B A;  2XQ5 A;  3HI2 A;  3KVA A;  3I0O A;  4UVA B;  3O1I A;  3KBU A;  4JI6 T;  2MBG A;  3C4W A;  2J62 A;  2HN2 A;  2NTY A;  1KNR A;  2UXN B;  4GYS A;  3ZSS A;  3LSV A;  1WCR A;  3C79 A;  4LFC T;  2V6X A;  2PFV A;  2WU5 A;  3KVB A;  2YU2 A;  3IEE A;  4FJO A;  4CXY A;  3Q2M A;  3AA7 B;  4CZZ B;  5L2L A;  1YQ4 A;  3N9L A;  4TV8 E;  1I9B A;  2XM2 A;  2K5B B;  3SWH A;  1OWA A;  5AQI B;  4KX6 A;  2R6G F;  4HE8 A;  3B13 A;  3RIF A;  1VOM A;  3OPC A;  4ZI3 C;  4DR6 T;  4PJN A;  5H6R B;  2WSS V;  4ADZ A;  2NR4 A;  1FJG T;  3MAC A;  5J5H A;  2KZ7 B;  2IC6 A;  4JI4 T;  4I4T E;  5JRE A;  3P8C D;  5FL0 A;  4UV9 B;  3OYZ A;  2W67 A;  5AQS B;  2X00 D;  2VWA A;  4K0K T;  2BG9 A;  4AKH A;  4DR7 T;  2PGZ A;  5L3F B;  2KIN B;  3GWH A;  5HXE A;  1I94 T;  2CM0 A;  3RQU A;  4UEL A;  1Y01 A;  1XDO A;  1VRB A;  4GYR A;  2UUC T;  2HH7 A;  2JIW A;  3RH3 A;  4HFC A;  4IST A;  2X0Y A;  3ZST A;  1HNW T;  5AQV B;  2VL0 A;  4BA9 A;  4YY3 T;  3ONJ A;  3AEE A;  3JC6 D;  3HL6 A;  4KHZ F;  2JRK A;  3J9X 1;  5LXB A;  4DV6 T;  1YXR A;  1HNX T;  4ANJ A;  2F4V T;  2WBL A;  1YD8 G;  4DV0 T;  3AE6 A;  3O4X E;  2BBH A;  3QOF A;  2BG9 B;  3N2O A;  5FJV A;  3ZYM A;  3ABV A;  3J7Y q;  4GKJ T;  2YK0 A;  2MYS A;  5HWX A;  3WTI A;  1G8X A;  2W2U A;  4XAX B;  2L9Q A;  3RF1 A;  2G0U A;  3KV9 A;  4ZXL A;  2WWU A;  2JMH A;  3EUH A;  2XZE A;  3A8Y C;  5EK4 A;  2WB5 A;  2H89 A;  3VKG A;  3K8P C;  1MIY A;  4AKL A;  2XQ7 A;  4OK0 A;  4JI1 T;  3DJB A;  2RP4 A;  2K48 A;  3U8K A;  1N34 T;  4DVD A;  4EAH A;  5J5G A;  2W4X A;  3T1H T;  2QRX A;  3Q5X A;  4LMJ A;  5AQK B;  4DBM A;  1E1H B;  4V1A v;  2XUE A;  3RIA A;  3I9Y A;  4O4I E;  1NEN A;  5CB4 E;  1E2A A;  5ETW A;  2X9H A;  4AFG A;  2PJQ A;  2LLY A;  3E0Z A;  3BQL A;  3RYC E;  3AE2 A;  1N36 T;  4EZ1 A;  3C84 A;  4DR4 T;  2BYN A;  3C98 B;  4LF6 T;  2XJ7 A;  2IAK A;  2AXD S;  4X62 T;  4IRE A;  3OYX A;  3C4Z A;  1VCT A;  4ZI2 C;  4JYA T;  2NW8 A;  3P4P A;  3SOL A;  2HHH T;  4BAY B;  2WDR A;  3F2E A;  3HKE E;  3W15 B;  4FRR A;  4U7Y A;  3NZP A;  3Q5D A;  1KF6 A;  5AQF B;  3ZJ2 A;  4HN9 A;  4H9N C;  4MBQ A;  4QH1 A;  3PEO A;  1OED C;  2V7I A;  4PFP A;  2FJA A;  3SH1 A;  2QC1 B;  5HXC A;  3P4Q A;  3ZJ1 A;  5LNK A;  4HFV A;  2VL8 A;  2I0M A;  3LK2 B;  5FY1 A;  2V7K A;  4JI0 T;  2VVN A;  3RHW A;  2A9U A;  3U8N A;  2PH9 A;  3WTM A;  1OED B;  3AXJ A;  2ZM2 A;  4PK5 A;  5DQV A;  2BYP A;  3KBT A;  3N2K E;  3N9N A;  5JDM A;  2ES0 A;  2XNV A;  2CHO A;  4A56 A;  2LOP A;  2C5J A;  3VR8 A;  2YEV C;  4AQF A;  2NP9 A;  4LF8 T;  3WIP A;  4O4L E;  4I55 E;  2CEA A;  4EGW A;  4I50 E;  3L3P A;  1H7C A;  3RYF E;  3UUN A;  2CXL A;  3RRC A;  2VUR A;  3KFW X;  3ZMV B;  4WBO A;  5AFJ A;  3U8M A;  1D0Y A;  3AXJ B;  2CPT A;  5AIN A;  2X67 A;  2CA5 A;  4AQF C;  3ANW B;  2WNL A;  3O9X A;  3IBP A;  5FKY A;  4LMK A;  4OYJ A;  2K9A A;  5HCJ A;  3UFE A;  3V5S A;  4U2Z A;  2Z6E A;  2X0H A;  4JI5 T;  3RRW A;  4P09 A;  2KXP B;  5E0O A;  2B1E A;  3RC3 A;  3VHL A;  2NTX A;  2EHO C;  3IHR A;  2BS3 A;  5CA0 E;  5EK3 A;  2BS4 A;  2D2S A;  3FHN A;  2D0U A;  5IWA T;  2N2N A;  4EYY R;  2WDV A;  4TNW A;  4UM1 A;  5F5W A;  5L3B B;  1IZN B;  2XNT A;  4GOU A;  4NXN T;  1HX8 A;  1XWM A;  4HKA A;  4QX8 B;  5KX5 E;  3PUQ A;  1T7S A;  2E9X A;  3GMI A;  3PE0 A;  3AA6 B;  3RQW A;  4EOZ B;  2H88 A;  3FXD B;  2WY2 A;  4P1N A;  4M1P A;  4AFT A;  4MAL A;  4PW8 A;  2UXD T;  2KLQ A;  2C9T A;  2XHE B;  4PAG A;  1XMQ T;  5HXS A;  4HWC A;  1J1J A;  2E9X C;  5ABF A;  1HNZ T;  4Z8X A;  3SQ6 A;  3CVR A;  4H63 V;  1WLX A;  1UV6 A;  4NZB A;  3PUG A;  3UUX B;  2CBJ A;  2FJB A;  4A5X A;  2BKO A;  2KT9 A;  3WTO A;  3ONX A;  2DHR A;  3WAJ A;  3KV5 A;  3FBL A;  5L3G B;  2E9X B;  3AE9 A;  1FIO A;  3EAB A;  3O1H A;  5AQR B;  3UUM A;  3TKL B;  3VRA A;  4JI3 T;  4HGA A;  5HWY A;  4LF4 T;  2UXB T;  1YW0 A;  2D5U A;  1IJ5 A;  4YHJ A;  3F31 A;  4QXC B;  2RA1 A;  1IBM T;  4DBQ A;  4F8H A;  5CFB A;  4ZK1 A;  4YTM A;  5ABF B;  3C4X A;  2PG8 A;  3ZMS B;  4P0A A;  3B57 A;  1MMA A;  4QXH B;  3ETV A;  5AFM A;  4IL9 A;  5KXJ A;  5L47 A;  3Q5W A;  3GA8 A;  5HEU A;  4MFR A;  3GN5 A;  4DND A;  4U33 A;  2WWV A;  5C8Y E;  2XQA A;  5KZU A;  4LF7 T;  2W8G A;  2V26 A;  2UU9 T;  2W66 A;  2ZLY A;  1LVK A;  2W0G A;  5EK2 A;  3CIR A;  2XYT A;  2XAS B;  4DBR A;  3AE7 A;  4TWH A;  1D0X A;  2E5V A;  4ZI2 D;  5AFM B;  2MAW A;  1O3X A;  3HR0 A;  5LA6 E;  2DWK A;  3GN5 B;  3C50 A;  2J47 A;  1V9D A;  5LG4 A;  2CBI A;  1X9B A;  3UQ4 A;  4E7Z A;  2YOE A;  2NW7 A;  1MIV A;  2XQ8 A;  4O8S A;  5LJM A;  1SHZ C;  1UUR A;  4D01 A;  2XTL A;  2BKN A;  4CI2 B;  5JQG E;  3MJX A;  4IE5 A;  2A72 A;  4ILU A;  3PMZ A;  4UVC B;  4O4J E;  4DV5 T;  3IF8 B;  3L09 A;  1KEY A;  2K3W A;  2V1D B;  4B6X A;  4IDP A;  1MMN A;  3PJA J;  2UXX B;  2K24 A;  2XQ3 A;  1HTJ F;  2CRB A;  3N9Q A;  3AEF A;  3FB2 A;  2XY8 B;  3ESL A;  1UGO A;  4X20 E;  4O2B E;  5FXX A;  2B76 A;  1Z0P A;  2QVA A;  4JI7 T;  3BK9 A;  1LRZ A;  2LSK A;  1UX5 A;  4O2A E;  2V7L A;  4TV9 E;  4P0B A;  4MLK A;  3F57 A;  3NBX X;  3E08 A;  2FJD A;  4C90 A;  3WTH A;  2CMR A;  5JDQ A;  4AQG A;  3ZYL A;  3U8L A;  4WZX A;  5CJ5 A;  5LGT B;  2WDQ A;  2LSJ A;  4YSZ A;  3UU5 A;  2XSA A;  3TLV A;  2VQE T;  4TNV A;  1WYC A;  2Y48 B;  4YFS A;  5AFL A;  4YSX A;  5EZY E;  3SRZ A;  5JR9 C;  5CO5 A;  2WAU A;  1IBL T;  1UCU A;  2FJE A;  1E7P A;  5H6Q B;  4LML A;  3AE1 A;  4L5G A;  2XAF B;  4IL4 A;  5FVL A;  1UX4 A;  3H37 A;  3RPU A;  4X1I E;  2N9D A;  5LMN T;  2X9Y A;  2M6I A;  2CHN A;  4TWF A;  2J1D G;  2UUB T;  4ISS A;  3NRX A;  5JR9 B;  2HPJ A;  2CWY A;  4JI2 T;  5JVD E;  2IC9 A;  2XSB A;  5HEJ A;  2KWH A;  2VKJ A;  5KE4 A;  3L8R A;  5IYZ E;  3WTK A;  4GIW A;  1NAF A;  3P4S A;  4NUU A;  1FMV A;  5KDM C;  2VK9 A;  3OKQ A;  4EV6 A;  4KHP T;  2L3L A;  1B7T A;  4ZJS A;  2E9X D;  4WBN E;  2WZY A;  4QH4 A;  2J4G A;  3PUY F;  2BR8 A;  3AEG A;  4LFB T;  3FZL B;  4LF5 T;  1W0A A;  5JDN A;  2YKS A;  4HFI A;  3NKZ A;  1WYB A;  2BZB A;  2KMF A;  4PIR A;  4PJL A;  2UXC T;  3V5U A;  4ZK4 A;  4QWN B;  1HG5 A;  5DJQ C;  2D0T A;  2CXF A;  4QX7 B;  5J5I A;  3N9M A;  4QXB B;  2Y58 A;  1MMG A;  4HFB A;  1D1A A;  2FBW A;  1KFY A;  2H3R A;  4IE4 A;  2WQY A;  2ZM6 T;  3FBZ A;  4H9O C;  2IW5 B;  1OXZ A;  3NWI A;  2XAG B;  3IA3 A;  5BW2 A;  4DR5 T;  5L4E A;  3HA4 A;  1HCI A; 
#chains in the Genus database with same CATH homology
 2WNL A;  4NPP A;  4ZZB A;  4ZRU A;  3EI0 A;  4LMK A;  2Y57 A;  3WTL A;  3UUB A;  2BG9 B;  5HEJ A;  2XQ3 A;  4ZJT A;  4TWD A;  5FJV A;  5HCJ A;  5LG3 A;  2WNJ A;  5TVC A;  3JAF A;  2XYS A;  4F8H A;  5CFB A;  5KE4 A;  4ZK1 A;  3TLS A;  2W8F A;  3WTK A;  4ILB A;  1I9B A;  3WTI A;  5L4H A;  4X5T A;  3JAD A;  2YN6 A;  5J0Z A;  4FRR A;  3WTJ A;  3ZKR A;  5AFM A;  4IL9 A;  5L47 A;  3UQ7 A;  1UW6 A;  3PEO A;  4QH1 A;  5HEU A;  4ZJS A;  1OED C;  3SH1 A;  2UZ6 A;  2QC1 B;  1OED A;  4TNW A;  2WZY A;  4QH4 A;  3RIF A;  4UM1 A;  2KSR A;  4UY2 A;  4HFE A;  5AFN A;  2LKG A;  2BR8 A;  5AFH A;  2BR7 A;  2XNT A;  3TLW A;  2YMD A;  5HEO A;  3P50 A;  2ZJU A;  2YKS A;  4HFI A;  4B5D A;  3P4W A;  3GUA A;  4ALX A;  3EHZ A;  4Z90 A;  2XQA A;  3UU6 A;  4BFQ A;  5KZU A;  2LM2 A;  3WTH A;  5J5H A;  4ILC A;  2Y7Y A;  3RHW A;  2XQ7 A;  4PIR A;  3U8N A;  3RQW A;  3U8K A;  3IGQ A;  2WNC A;  2PH9 A;  2W8G A;  3WTM A;  1OED B;  2BJ0 A;  2YME A;  2XZ5 A;  3JAE A;  4UM3 P;  4UM3 S;  2Y54 A;  5HCM A;  2BYP A;  5J5G A;  2LKH A;  4COF A;  4QAB A;  5HEG A;  3U8L A;  5HEH A;  2BG9 E;  4ILA A;  3TLU A;  2ZJV A;  4AFT A;  4QAC A;  5BRX A;  3ZDG A;  4XHE A;  2X00 D;  2BG9 C;  2XZ6 A;  4LMJ A;  4XK9 A;  3WTN A;  4ZZC A;  3UU5 A;  4AFH A;  4ZK4 A;  2M6B A;  5BP0 A;  2XQ4 A;  2XQ9 A;  2C9T A;  2XYT A;  4UXU A;  4BQT A;  2BG9 A;  2XQ5 A;  4TWH A;  3TLV A;  4HQP A;  4DBM A;  5AFK A;  5AFM B;  4TNV A;  2PGZ A;  2MAW A;  3UU4 A;  4ZR6 A;  2XNV A;  4A98 A;  2BYS A;  2Y56 A;  4A97 A;  4UM3 A;  3RIA A;  5J5F A;  3RQU A;  5IUX A;  4QAA A;  2BYQ A;  4HFD A;  5J5I A;  5AFL A;  2WN9 A;  2X00 A;  4Z91 A;  3UQ4 A;  3UU8 A;  3SQ6 A;  4HFC A;  2Y58 A;  1UV6 A;  2YOE A;  4NZB A;  3WIP A;  1UX2 A;  4HFB A;  5CO5 A;  4AFG A;  2XQ6 A;  3TLT A;  2LLY A;  4WV9 A;  3SIO A;  3U8J A;  2XQ8 A;  3RI5 A;  5SYO A;  2XNU A;  2VL0 A;  4LML A;  4QH5 A;  3T4M A;  3WTO A;  4EZ1 A;  4IL4 A;  3C84 A;  4D01 A;  2BYN A;  5JME A;  3LSV A;  3C79 A;  5AFJ A;  3ZDH A;  5LXB A;  3U8M A;  3PMZ A;  2BYR A;  3UU3 A;  3EAM A;  3SQ9 A;  2M6I A;  4IRE A;  5AIN A;  5BW2 A;  4HFH A;  4TWF A;  5L4E A;  1OED E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...