2XQ8A

Pentameric ligand gated ion channel glic in complex with zinc ion (zn2+)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq8A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq8A01
4HQPA 5HEHA 2X00D 4QAAA 5AINA 4HFHA 3RQUA 3WTOA 2WZYA 4HFIA 2BG9C 3PMZA 5TVCA 2LLYA 4ZJTA 5AFHA 4ZR6A 3RQWA 4ILBA 2Y56A 2W8GA 4UM1A 2VL0A 4IL4A 4LMLA 3EAMA 2Y54A 3C84A 4AFTA 3U8MA 3EI0A 2BR7A 4LMJA 5CFBA 2LKHA 5AFLA 2XNVA 4TNVA 4Z91A 2WNLA 2M6IA 4QACA 5BW2A 3UU4A 3UU6A 5HEUA 2BYNA 2YMEA 4XK9A 4AFHA 4HFDA 4TWDA 2Y7YA 4PIRA 2MAWA 2XQ8A 4BQTA 5AFJA 2BJ0A 4A97A 2BYRA 3TLSA 3UU3A 5HCJA 4ALXA 1UW6A 4ZRUA 2PGZA 3WTKA 2LKGA 4UM3P 2XQ4A 5LG3A 2BR8A 3WTHA 3TLUA 3RIFA 3EHZA 4ZZBA 3U8NA 3U8KA 2PH9A 2YKSA 3WIPA 1UV6A 5HCMA 4XHEA 3WTNA 4IREA 4HFBA 4ILCA 2WNJA 3C79A 5AFKA 2XQ3A 4ZZCA 3WTIA 2LM2A 2YMDA 2XQAA 2C9TA 2XZ6A 3ZDGA 2Y58A 4UM3S 3SQ9A 4UM3A 4ZK1A 2BYQA 4BFQA 5BRXA 5L4HA 3UU5A 4NPPA 5J0ZA 5L4EA 5J5GA 3ZKRA 5AFMB 4NZBA 4B5DA 5KZUA 3RHWA 5LXBA 3JAEA 5AFNA 4A98A 2KSRA 5AFMA 1OEDE 5CO5A 5J5IA 3JAFA 2X00A 4QH1A 1I9BA 3PEOA 4QH4A 2Y57A 4TWFA 3UQ7A 2ZJVA 3SIOA 3TLTA 4X5TA 3RIAA 3P50A 4UY2A 4WV9A 4EZ1A 3IGQA 1OEDB 3UQ4A 2XQ5A 4QABA 2UZ6A 2BYSA 4AFGA 2W8FA 3P4WA 4ILAA 3GUAA 3TLVA 2WNCA 1OEDA 3WTMA 5J5FA 5IUXA 4HFCA 2XYSA 4LMKA 4FRRA 3JADA 3WTJA 3U8LA 4D01A 4TNWA 2XZ5A 2BYPA 2M6BA 5HEOA 3UUBA 4F8HA 2BG9B 5L47A 5HEJA 5BP0A 5HEGA 5JMEA 2XNTA 4HFEA 4UXUA 4DBMA 2BG9A 4ZK4A 3SH1A 2XQ6A 2XQ9A 1UX2A 4IL9A 4Z90A 3RI5A 3WTLA 2QC1B 2YOEA 2XNUA 2XQ7A 2YN6A 3ZDHA 1OEDC 3UU8A 2XYTA 5SYOA 5FJVA 3T4MA 2ZJUA 5J5HA 3SQ6A 5KE4A 4COFA 3LSVA 2WN9A 4QH5A 4TWHA 3U8JA 4ZJSA 3TLWA 2BG9E
chains in the Genus database with same CATH superfamily
4LF6T 4HFHA 4A56A 3ZSTA 4EB6E 4DR7T 2KWHA 1ZP0A 2OA5A 2Y54A 1ZKEA 2QA7A 2LKHA 4HTEA 2V1DB 4LF5T 1I6ZA 4JI4T 5AFJA 4HWHA 3UU3A 1LVFA 3FZHB 2KZ7B 2WB5A 5JDMA 3EHZA 2CEAA 1US7B 1J5WA 3NZPA 3CVRA 2WDVA 5FP3A 3ZDGA 1ZHCA 3OJAA 4ZK1A 3GN5B 3OTOT 3ZC1A 5AFMB 4B5DA 1T7SA 3PU8A 3H3AA 3KVBA 3RHWA 5J5IA 4DV3T 4YLHA 5C3JA 3RIAA 2DWGA 3I9WA 4MHCA 2UZ6A 3MKDA 3UFEA 4Z8XA 3Q5XA 3PUYF 3A7MA 3I9YA 3H3MA 4DMWA 2Y8DA 2K24A 2XNTA 2LRLA 1JNRA 3ZMUB 1ZV4X 3CKDA 3J9X1 3IA3A 4Z90A 1FEWA 5LG4A 4PK5A 4YT0A 4M1PA 1N32T 2JQKA 2WM9A 2W66A 4IDZA 1AJ3A 2C5IT 1VCSA 3RRCA 2PJQA 3ABVA 3PTRB 2W61A 2V7KA 2L9QA 2QRXA 4DBRA 3ZMZB 5JR9B 4LMLA 3RKGA 4CZZB 5JH7E 3IF8B 1CUNA 1U5PA 4UV8B 2V7MA 1D1BA 2XAFB 4DV4T 3AE3A 4CN4A 4X1IE 4C90A 4BJNA 2JMHA 4MFRA 2LM9A 3PUZF 4JV5T 2J47A 2XQYA 2VURA 4ZZCA 2LSGA 4P0AA 3WTIA 3Q5EA 1XWMA 2XTLA 2XAGB 2X9HA 2Q9QA 2QVAA 1QSDA 5LXBA 1MMGA 2LSKA 2X9WA 3UFGA 3ONXA 4KUMB 1E7PA 2ZJVA 2CWOA 5JDFA 5FY7A 3SIOA 5ABFA 4O4IE 5EK2A 5LHGB 3C64A 4EV6A 5HXCA 3NBXX 4DUZT 1T72A 3RKOA 4DBMA 2X66A 3P4QA 1FIOA 3SRZA 1UURA 3N9NA 1G73A 4J2CA 4HKAA 3PUAA 5LJNA 3O1JA 3AVSA 3BQLA 4DNDA 2PTFA 1BR4A 3CX6B 5JTGA 3V5UA 2V26A 4YJ3E 5AFUL 4LMJA 2BKOA 3ZT7A 3OYZA 4PFOA 4MBQA 2BYRA 1MIWA 4P0BA 5C8YE 5LCYA 2VASA 3WTKA 2IC9A 4UM3P 4O2BE 2CXLA 1WFDA 2DLRA 3WIPA 4CQIA 4OFZA 4IREA 4PK6A 4YY3T 2X51A 3QNUA 2ZMAA 1YD8G 3X1DA 4UM3A 3GWHA 4NPPA 1KF6A 2NTXA 4O8SA 2MPKA 3FZKB 4H9PC 4ASKA 2X00A 4EOZB 3UQ7A 3TLTA 4WV9A 5HWYA 5FL0A 4KI0F 4YFSA 2X0LB 2BS2A 3KVAA 5J2TE 3ZC0A 2M6BA 4HWDA 4DV6T 5HEGA 2EHOA 4XAXB 3GN5A 2XQ9A 5AQMB 2HN2A 5JDHA 5FMNA 3AE5A 2FBWA 2ZJUA 4JLEA 4COFA 3LSVA 4YTNA 2XASB 3CWZB 2BG9E 3UULA 5CJ5A 2Q9QC 3PURA 3PMZA 3EDUA 1IBLT 5LOVE 4DBQA 3M3ZB 2V5CA 2WAUA 5FKYA 3U8MA 5CFBA 1XNQT 1YW0A 2YU2A 4AFHA 4TWDA 4AQFC 2MAWA 1MMDA 4A97A 2V7LA 2W63A 2BBJA 1YKHB 2ZM6T 4TX5A 1Y01A 2UXCT 4YXDA 5IHYA 5HXRA 4DR2T 4AQGA 2XUEA 2A2FX 2LSIA 3I1AA 4UEMA 4B3RT 3ETVA 2ODVA 4UM3S 4JBWF 2XM2A 4BFQA 4WBOA 4KHZF 4AKGA 4GOUA 5KZUA 4AKLA 4DV5T 4JI2T 4KX6A 2MBGA 1I9BA 3ZSSA 3P50A 3VR8A 3UQ4A 2DL1A 2PG8A 2PFVA 4Q25A 3AAEB 3P4WA 1YQ4A 2CBJA 2YDRA 4HFCA 3U8LA 2E5VA 2XZ5A 3RX6A 4CN6A 4UVAB 5ETWA 4UXUA 4A5XA 2E9XC 5TAOA 5L3CB 1UX2A 4TN7B 4QX7B 5KX5E 2YN6A 3ONLC 3M65A 5KE4A 2Q9QD 2W62A 2D9DA 2OLTA 3ZMVB 2CBIA 2WZYA 1HR0T 3K3OA 2H7OA 3ZMTB 4LF7T 2LLYA 2YK0A 3LK3B 5CA0E 3DJBA 4ADZA 4K0KT 1YQ3A 4EAHA 4H63V 5DQVA 2BYNA 2YMEA 4IHJE 3RYIE 2D2SA 3UUXB 3AAAB 3C4ZA 3ZJ1A 2Y48B 3ZT5A 4ZZBA 3U8NA 3B13A 2JJ9A 4KP3C 5AQUB 1UV6A 5L3EB 4FI5A 1UX4A 2K3WA 3B57A 3KINB 2VKHA 2Q9QB 1W0BA 5J0ZA 4OHFA 5LGTB 3HL6A 5A1LA 2F4VT 5AFNA 1WCRA 5ABFB 2WDQA 3AB3B 5AQHB 4IT4A 5L2LA 2R6GF 4ZS2A 3L8RA 3VU7H 1W09A 2E9XD 2W4XA 5CGMA 2H3RA 1XZYA 5JRCA 5AQFB 4E7ZA 1VOMA 1O3XA 2JQ9A 3ZDHA 3AEAA 2XYTA 5J5HA 3VKHA 2K9AA 1HS7A 2WU5A 3ZN0B 3RRWA 2X00D 5EZYE 3OVUA 4OYJA 3I0QA 1KEYA 2YDSA 3CX8B 3EABA 1WYCA 5LA6E 5LXTE 3R84B 2JRKA 3AE9A 4EXTA 3KBUA 4IIJE 2VL0A 3LK42 2FJDA 2WY2A 3N5LA 1E1HB 4JYAT 3AA0B 3ONJA 1D1CA 3TLSA 1XMQT 2CM0A 4HWCA 3WAJA 3RYCE 4HN9A 2WWUA 2X0HA 3WTNA 4DR5T 2XQ3A 3A5XA 1HFAA 2CLYC 5L3FB 4UVCB 2L3LA 3AEGA 2PBIA 1MMNA 4F6RC 1HF8A 5DABA 3N2GE 5AQTB 5CO5A 2I6HA 1T8BA 3UTKA 3UT5E 3AE4A 5AQLB 5FVKA 5J2UE 4QHOA 2XM1A 1MMAA 2EHOB 3WTJA 1Y64B 1GQEA 4TNWA 3P4SA 4HFEA 4P1NA 1HG2A 5AQVB 3V5SA 3NVOA 4CI1B 2XNUA 1D0ZA 2DCFA 1HNWT 1D0XA 1NAFA 3QB5K 2ZM8A 4TWHA 3AXJB 2LSYA 4GYSA 4HQPA 1UX5A 1WYBA 3OBVE 2CHNA 3RQUA 2AE9A 5LYJE 4JEUB 4QXBB 4PJNA 1ZEEA 3LBXA 2Y56A 4HGAA 4XK9A 5JDQA 3PJAA 4ALXA 4DIDB 5JDLA 3WTHA 2VKDA 3TLUA 1N33T 1KK7A 4QXHB 3EDVA 2LSJA 4HFBA 2YEVC 4HFVA 4EEDA 5BR8T 2J4GA 3C98B 1QUUA 2YU1A 3IBPA 4FJOA 3JAEA 3WAKA 2KSRA 1L0VA 4WBNE 5F5WA 4QH4A 4TWFA 4LFCT 5LHIB 2XSBA 3DTOA 3SWHA 2CCQA 1X79A 5L47A 2V7IA 4YTPA 2ACXA 1NENA 2H89A 2UUAT 2YOEA 3Q5WA 1T98A 2VQET 4B3ST 4K0UA 2WU2A 2W2UA 4U31A 3SFEA 4CI3B 4DO0A 4AQFA 1NWMX 5KDMC 3CQXC 5L3DB 2KT9A 3EAMA 3C84A 2A9UA 2XNVA 2NR4A 5HEUA 4BQTA 3VR9A 5HCJA 2VL8A 2LKGA 2WMOA 2BR8A 3U8KA 2YKSA 1XNRT 3PUGA 3MZKB 3FXDB 2V6YA 4PJMA 1IZNB 2HN1A 1HNZT 4AQYT 3AA6B 2MTQA 3AA7B 3C50A 4U7IA 1VCTA 2JMKA 1KNPA 4IE7A 3O1IA 3NRYA 3PEOA 2E9XA 3LJCA 2Y57A 3W15B 3GMIA 3IGQA 4YSZA 4HWFA 3P4PA 3VRBA 3L09A 1D1AA 3DP7A 3WTMA 5JRCB 3AEBA 3SOLA 4LMKA 2A3DA 2LJLA 3HR0A 4X62T 2H7VC 4IL9A 3CQGB 5JDGA 2VVSA 4O4LE 4UF0A 4QAAA 5AINA 1SE7A 1HG5A 2B1EA 1M62A 1HNXT 3F31A 3QB5A 4DR4T 5HAXA 4UM1A 2FJBA 4DVDA 4HWIB 2NW7A 4I0UA 4QACA 4QXCB 1WR6A 2CPTA 4HFDA 4PIRA 4H9SE 4HE8A 3AXJA 1UW6A 4WW0A 2ZM0A 2K5BB 2XQ4A 4AIUA 2LHNA 5FNVE 3VKGA 4U72A 4CXWA 4YSXA 2UXXB 5LNKA 4CN1A 3E0ZA 3UUNA 3PUXF 4TZ4C 3D0TA 3ZKRA 3AVRA 2WQYA 4A98A 3GA8A 4H9QC 2N1GA 4QABA 2BYSA 2E5LT 2W8FA 3AA1B 1WRDA 3PUSA 2BVMA 3KBTA 5LBMA 3B5MA 4IDQA 5BP0A 2XHEB 2X68A 2B76A 2J62A 3WTLA 3FBLA 4G63A 4P09A 1OEDC 5FXZA 2DWKA 2LT3A 3SQ6A 1U4QA 1SUMB 4X1KE 2C5KT 2BG9C 4I43B 3LBXB 4NIQA 2ES0A 4AISA 5AFHA 2BZBA 3KV5A 3CX7B 1N36T 1OWAA 2CA5A 3R6NA 5AFLA 5CB4E 1HCIA 2XY8B 4NUUA 1E2AA 4QKNA 2V7JA 3CMLA 4UV9B 4X66T 3IHRA 4YHJA 3ZYKA 3RIFA 2NTYA 4XHEA 5EK4A 2VKOA 3KV6A 3QC9A 3ZMSB 2I0MA 5H6QB 2V5DA 2UUCT 3BQKA 3HI2A 2Y58A 4IDNA 4GIWA 4ZI7E 4XZCA 2D0UA 1M7KA 4EEBA 1BR0A 4ZEYA 3ZPOA 5EK3A 1FMVA 4O4JE 4IDPA 5AQNB 4ISTA 2XQ5A 3FZFB 4KMCA 2WNCA 2X9YA 4JUYA 3AE6A 2LE8A 3JADA 3RF1A 2BYPA 4X64T 3ZCJA 3AE7A 4MALA 2JPFA 4UR9A 3MK7C 4DR1T 5FXWA 3E22E 3I0OA 3RGLA 1UUSA 2IAKA 4IGUA 3CIRA 3T4MA 5FJVA 5DQWA 3ZEFB 4DV7T 3ZYLA 1IAPA 4H63H 4ZJSA 5HEHA 1I94T 2E8IA 1B7TA 1DU2A 4LFBT 3KDSE 3NWIA 2DHRA 4PNIA 5FVLA 1XMOT 4AKHA 3O4XE 5JVDE 2W00A 2BR7A 5LBQB 4CXXA 3FHNA 5ABHA 2IIUA 3UU4A 1SHZC 1UK5A 2AXDS 2CWYA 3CPZA 1BR1A 2KMFA 2XJ7A 3N2KE 5LGUB 3F57A 4WZXA 4EZHA 5E0OA 3RC8A 5AQSB 3RYHE 2V6YB 1XDOA 3C79A 2LEHA 5JR9C 3WI3A 2YMDA 2E2AA 3NRXA 4ZI2C 3T8OA 3SQ9A 2BYQA 3UU5A 4QX8B 4LF4T 1OXZA 5AQGB 2E9XB 4B3MT 2X9XA 3ANWA 4UY2A 4EYUA 4GKKT 3P7IA 1UCUA 3NZQA 5GONE 5HWXA 5IUXA 4PFPA 3K3NA 2VWAA 4IE5A 2VVNA 1H7CA 4PJLA 2XSAA 2RP4A 1KNRA 1ZOYA 1N34T 1J5ET 4ZK4A 3SH1A 2XAHB 4JI1T 3UU8A 4UF0B 2W67A 2A72A 3L39A 3WTOA 1S94A 2VK9A 2KNDA 3T1HT 5FL1A 4BA9A 2X67A 3MACA 2YDQA 4U33A 5J1GA 1UGOA 2UXBT 5CA1E 2IC6A 2KWIB 4AFTA 3EI0A 4Z91A 4LF8T 1IJ5A 3PU3A 1HTJF 2CMRA 4UELA 1Z0PA 2BJ0A 1HX1B 4DMVA 3FZLB 2WSSV 4ZRUA 1EZ3A 1HX8A 3HKBE 5ADXL 2W0GA 3C4XA 4AXPA 4I4TE 4IE0A 3OYXA 4L9IA 4ZI2D 5AQRB 2PH9A 2CRBA 3G06A 1JNZA 2FUPA 4OK0A 2CXDA 4I55E 5LMUT 3RC3A 5BRXA 2WZHA 5BMVE 4PJJA 3K3QC 2IW5B 4AFGA 2YINA 3P4RA 4E7SA 2LHRA 5ABGA 3SFDA 1J1JA 5HEJA 4ZS3A 2IMLA 2GK9A 4V1Av 3NKZA 3RI5A 1MIVA 3RIUC 2XZEA 4YSYA 2IUBA 5SYOA 4X1YE 2BBHA 1CHUA 2DNXA 2IDOB 2WDRA 4HFIA 5KXJA 1SA0E 4U2ZA 4EIWA 3Q9DA 2D5UA 1MIYA 4IE6A 4HEAA 2CLYB 2N2NA 2WNLA 2M6IA 3UU6A 4H9NC 5JDNA 2QYWA 5H6RB 1LVKA 4CI2B 5HYAA 2WBLA 4WNKA 4WYVA 1VRBA 4JEHB 4LF9T 5F8PA 4XBFB 4JI7T 2G0UA 2OV9A 5L4HA 3TKLB 3ETUA 2LOPA 1FMWA 4JI6T 1G8XA 3MA9A 4ISSA 2LOSA 5M4YA 3PJAJ 3ZYMA 4NXNT 1X9BA 4QH1A 2CE7A 3EUHA 4EZ4A 5FXVA 3Q5DA 2WZIA 4GK5E 3K1SA 1OEDA 2WWVA 2RPAA 1LKXA 2KXPB 3U78A 4F8HA 4JI5T 2XAJB 2BG9A 1YXRA 2HPJA 2C5JA 4G2AA 4PAGA 2ODUA 2XQ7A 4H9RC 3LK2B 3KFWX 2D0TA 1Z8UA 1V9DA 5AQOB 3S4UA 4YJ2E 2SPCA 1D0YA 2BVLA 3TLWA 3AE2A 2UXNB 3AAIA 2WCAA 3O1HA 2WMNA 2CHOA 5LMNT 3VRAA 4ZJTA 2V6XA 2NP9A 5KMGP 1MNDA 4MLKA 5F3JA 2HH7A 2UU9T 3OKQA 5AQQB 1MNEA 4TNVA 4PK4A 5BW2A 3RH3A 4BJMA 3L3PA 3BK9A 3AEFA 4NUVA 4DR3T 3LDQB 3MJXA 5LG3A 3QK6A 3BQIA 2UXDT 2ZLYA 4TV9E 4KBMB 3PUVF 5HCMA 4YHHT 2XQAA 2C9TA 2C0SA 3JCFA 4B3TT 4GKJT 5J5GA 3ANWB 2ACZA 2X0YA 2BKPA 3LG7A 1OEDE 5AFMA 3JAFA 2WP9A 2Y6XA 5AQPB 3MXZA 2M67A 4IE4A 3N2OA 3J7Yq 5LB7B 3TLVA 4DV0T 3CQCB 2JIWA 5AQIB 5J5FA 3ZN1B 4FRRA 3HA4A 4D01A 5HEOA 4U74A 4L5GA 3UUBA 2CXFA 5JMEA 4X65T 2ZM2A 3P8CD 3O9XA 2K48A 4DV1T 3RPUA 2LRKA 4U2YA 5JQGE 4AI6A 5L3GB 2WN9A 3N9MA 3U8JA 3E08A 1R8IA 2HHHT 3AE8A 4IDOA 2JQHA 3FB2A 3CK6A 5FYMA 4DUYT 3RLFF 5TVCA 4BAYB 2V8SV 2JQQA 4ZR6A 4B6XA 4EGWA 2J1DG 2UUBT 5FY1A 2KINB 3U3IA 2BKNA 3FZMB 5JR9A 3AEEA 5IWAT 3FBZA 2Y7YA 1IBKT 4UVBB 3N9LA 2XAQB 3KV9A 2BDEA 1LRZA 1W9RA 1W0AA 4ZI3C 2NW8A 4ILCA 4O2AE 5LHHB 4JI3T 5ABEA 4OYKA 3AEDA 4GK0E 5JREA 5AQJB 5L4EA 5HXSA 4C91A 3C51A 5HXEA 1KFYA 3K8PC 1YKEB 4ZHQE 3PUQA 4UIGA 4YTMA 3AECA 2QGSA 1WLXA 2MYSA 2NW9A 4EZ1A 4X5TA 4KHPT 4L0RA 4DR6T 4ZXLA 3GUAA 2XYSA 4AKRB 5C2TA 3QOFA 3PUWF 4ANJA 3SS1A 1NEKA 4UXNB 3JC6C 2NOXA 4QWNB 3PV0F 2VQFT 2QC1B 4AKIA 1WR0A 3PDYA 2IHR1 4U3CA 2KLQA 3ESLA 4N78D 1FJGT 3ZT6A 4I50E 3C4WA 1XDPA 2EHOC 3OPCA 2RA1A 4CXYA 3T1YT 2FJAA 3FXEB 5FY0A 3A8YC 3HKDE 4O4HE 3N9QA 2HPLA 3RQWA 4ILBA 2W8GA 4IL4A 3PE0A 3RYFE 4U7YA 3H37A 3ZJ2A 4JI8T 2XPKA 4OX9T 2NWBA 4PW8A 3F2EA 1S35A 2XQ8A 3VHLA 4H9OC 4X20E 3IEEA 3HKEE 3LFMA 4JI0T 4ZI3D 2Z6EA 2DI4A 3KV4A 2BS3A 2PGZA 5LJMA 2VB6A 2I59A 4DV2T 4TUYE 1KNZA 1BR2A 5AFKA 2WNJA 4TV8E 2LM2A 2XZ6A 2BS4A 2H88A 3N9PA 5HXHA 1IBMT 4ILUA 2MOZA 4NZBA 3Q2MA 5IYZE 3N9OA 4LFAT 1OEDB 3RIUA 4ILAA 3QUJA 5LGNB 4GYRA 3HKCE 5LP6E 3JC6D 5L3BB 3UUMA 2BG9B 2P9BA 4NXMT 5DJQC 1IJ6A 3ZCIA 4ERRA 3ZLIA 4ZOLE 2N9DA 4EYYR 2VKJA 3AE1A 5AQKB 2WS3A 2XQ6A 2EHOD 3EVYA 5FXXA 2FJEA 1QLBA 4QH5A 2L8KA
chains in the Genus database with same CATH topology
4HQPA 5HEHA 2X00D 4QAAA 5AINA 4HFHA 3RQUA 3WTOA 2WZYA 4HFIA 2BG9C 3PMZA 5TVCA 2LLYA 4ZJTA 5AFHA 4ZR6A 3RQWA 4ILBA 2Y56A 2W8GA 4UM1A 2VL0A 4IL4A 4LMLA 3EAMA 2Y54A 3C84A 4AFTA 3U8MA 3EI0A 2BR7A 4LMJA 5CFBA 2LKHA 5AFLA 2XNVA 4TNVA 4Z91A 2WNLA 2M6IA 4QACA 5BW2A 3UU4A 3UU6A 5HEUA 2BYNA 2YMEA 4XK9A 4AFHA 4HFDA 4TWDA 2Y7YA 4PIRA 2MAWA 2XQ8A 4BQTA 5AFJA 2BJ0A 4A97A 2BYRA 3TLSA 3UU3A 5HCJA 4ALXA 1UW6A 4ZRUA 2PGZA 3WTKA 2LKGA 4UM3P 2XQ4A 5LG3A 2BR8A 3WTHA 3TLUA 3RIFA 3EHZA 4ZZBA 3U8NA 3U8KA 2PH9A 2YKSA 3WIPA 1UV6A 5HCMA 4XHEA 3WTNA 4IREA 4HFBA 4ILCA 2WNJA 3C79A 5AFKA 2XQ3A 4ZZCA 3WTIA 2LM2A 2YMDA 2XQAA 2C9TA 2XZ6A 3ZDGA 2Y58A 4UM3S 3SQ9A 4UM3A 4ZK1A 2BYQA 4BFQA 5BRXA 5L4HA 3UU5A 4NPPA 5J0ZA 5L4EA 5J5GA 3ZKRA 5AFMB 4NZBA 4B5DA 5KZUA 3RHWA 5LXBA 3JAEA 5AFNA 4A98A 2KSRA 5AFMA 1OEDE 5CO5A 5J5IA 3JAFA 2X00A 4QH1A 1I9BA 3PEOA 4QH4A 2Y57A 4TWFA 3UQ7A 2ZJVA 3SIOA 3TLTA 4X5TA 3RIAA 3P50A 4UY2A 4WV9A 4EZ1A 3IGQA 1OEDB 3UQ4A 2XQ5A 4QABA 2UZ6A 2BYSA 4AFGA 2W8FA 3P4WA 4ILAA 3GUAA 3TLVA 2WNCA 1OEDA 3WTMA 5J5FA 5IUXA 4HFCA 2XYSA 4LMKA 4FRRA 3JADA 3WTJA 3U8LA 4D01A 4TNWA 2XZ5A 2BYPA 2M6BA 5HEOA 3UUBA 4F8HA 2BG9B 5L47A 5HEJA 5BP0A 5HEGA 5JMEA 2XNTA 4HFEA 4UXUA 4DBMA 2BG9A 4ZK4A 3SH1A 2XQ6A 2XQ9A 1UX2A 4IL9A 4Z90A 3RI5A 3WTLA 2QC1B 2YOEA 2XNUA 2XQ7A 2YN6A 3ZDHA 1OEDC 3UU8A 2XYTA 5SYOA 5FJVA 3T4MA 2ZJUA 5J5HA 3SQ6A 5KE4A 4COFA 3LSVA 2WN9A 4QH5A 4TWHA 3U8JA 4ZJSA 3TLWA 2BG9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HQP A;  5HEH A;  2X00 D;  4QAA A;  5AIN A;  4HFH A;  3RQU A;  3WTO A;  2WZY A;  4HFI A;  2BG9 C;  3PMZ A;  5TVC A;  2LLY A;  4ZJT A;  5AFH A;  4ZR6 A;  3RQW A;  4ILB A;  2Y56 A;  2W8G A;  4UM1 A;  2VL0 A;  4IL4 A;  4LML A;  3EAM A;  2Y54 A;  3C84 A;  4AFT A;  3U8M A;  3EI0 A;  2BR7 A;  4LMJ A;  5CFB A;  2LKH A;  5AFL A;  2XNV A;  4TNV A;  4Z91 A;  2WNL A;  2M6I A;  4QAC A;  5BW2 A;  3UU4 A;  3UU6 A;  5HEU A;  2BYN A;  2YME A;  4XK9 A;  4AFH A;  4HFD A;  4TWD A;  2Y7Y A;  4PIR A;  2MAW A;  2XQ8 A;  4BQT A;  5AFJ A;  2BJ0 A;  4A97 A;  2BYR A;  3TLS A;  3UU3 A;  5HCJ A;  4ALX A;  1UW6 A;  4ZRU A;  2PGZ A;  3WTK A;  2LKG A;  4UM3 P;  2XQ4 A;  5LG3 A;  2BR8 A;  3WTH A;  3TLU A;  3RIF A;  3EHZ A;  4ZZB A;  3U8N A;  3U8K A;  2PH9 A;  2YKS A;  3WIP A;  1UV6 A;  5HCM A;  4XHE A;  3WTN A;  4IRE A;  4HFB A;  4ILC A;  2WNJ A;  3C79 A;  5AFK A;  2XQ3 A;  4ZZC A;  3WTI A;  2LM2 A;  2YMD A;  2XQA A;  2C9T A;  2XZ6 A;  3ZDG A;  2Y58 A;  4UM3 S;  3SQ9 A;  4UM3 A;  4ZK1 A;  2BYQ A;  4BFQ A;  5BRX A;  5L4H A;  3UU5 A;  4NPP A;  5J0Z A;  5L4E A;  5J5G A;  3ZKR A;  5AFM B;  4NZB A;  4B5D A;  5KZU A;  3RHW A;  5LXB A;  3JAE A;  5AFN A;  4A98 A;  2KSR A;  5AFM A;  1OED E;  5CO5 A;  5J5I A;  3JAF A;  2X00 A;  4QH1 A;  1I9B A;  3PEO A;  4QH4 A;  2Y57 A;  4TWF A;  3UQ7 A;  2ZJV A;  3SIO A;  3TLT A;  4X5T A;  3RIA A;  3P50 A;  4UY2 A;  4WV9 A;  4EZ1 A;  3IGQ A;  1OED B;  3UQ4 A;  2XQ5 A;  4QAB A;  2UZ6 A;  2BYS A;  4AFG A;  2W8F A;  3P4W A;  4ILA A;  3GUA A;  3TLV A;  2WNC A;  1OED A;  3WTM A;  5J5F A;  5IUX A;  4HFC A;  2XYS A;  4LMK A;  4FRR A;  3JAD A;  3WTJ A;  3U8L A;  4D01 A;  4TNW A;  2XZ5 A;  2BYP A;  2M6B A;  5HEO A;  3UUB A;  4F8H A;  2BG9 B;  5L47 A;  5HEJ A;  5BP0 A;  5HEG A;  5JME A;  2XNT A;  4HFE A;  4UXU A;  4DBM A;  2BG9 A;  4ZK4 A;  3SH1 A;  2XQ6 A;  2XQ9 A;  1UX2 A;  4IL9 A;  4Z90 A;  3RI5 A;  3WTL A;  2QC1 B;  2YOE A;  2XNU A;  2XQ7 A;  2YN6 A;  3ZDH A;  1OED C;  3UU8 A;  2XYT A;  5SYO A;  5FJV A;  3T4M A;  2ZJU A;  5J5H A;  3SQ6 A;  5KE4 A;  4COF A;  3LSV A;  2WN9 A;  4QH5 A;  4TWH A;  3U8J A;  4ZJS A;  3TLW A;  2BG9 E; 
#chains in the Genus database with same CATH topology
 4LF6 T;  4HFH A;  4A56 A;  3ZST A;  4EB6 E;  4DR7 T;  2KWH A;  1ZP0 A;  2OA5 A;  2Y54 A;  1ZKE A;  2QA7 A;  2LKH A;  4HTE A;  2V1D B;  4LF5 T;  1I6Z A;  4JI4 T;  5AFJ A;  4HWH A;  3UU3 A;  1LVF A;  3FZH B;  2KZ7 B;  2WB5 A;  5JDM A;  3EHZ A;  2CEA A;  1US7 B;  1J5W A;  3NZP A;  3CVR A;  2WDV A;  5FP3 A;  3ZDG A;  1ZHC A;  3OJA A;  4ZK1 A;  3GN5 B;  3OTO T;  3ZC1 A;  5AFM B;  4B5D A;  1T7S A;  3PU8 A;  3H3A A;  3KVB A;  3RHW A;  5J5I A;  4DV3 T;  4YLH A;  5C3J A;  3RIA A;  2DWG A;  3I9W A;  4MHC A;  2UZ6 A;  3MKD A;  3UFE A;  4Z8X A;  3Q5X A;  3PUY F;  3A7M A;  3I9Y A;  3H3M A;  4DMW A;  2Y8D A;  2K24 A;  2XNT A;  2LRL A;  1JNR A;  3ZMU B;  1ZV4 X;  3CKD A;  3J9X 1;  3IA3 A;  4Z90 A;  1FEW A;  5LG4 A;  4PK5 A;  4YT0 A;  4M1P A;  1N32 T;  2JQK A;  2WM9 A;  2W66 A;  4IDZ A;  1AJ3 A;  2C5I T;  1VCS A;  3RRC A;  2PJQ A;  3ABV A;  3PTR B;  2W61 A;  2V7K A;  2L9Q A;  2QRX A;  4DBR A;  3ZMZ B;  5JR9 B;  4LML A;  3RKG A;  4CZZ B;  5JH7 E;  3IF8 B;  1CUN A;  1U5P A;  4UV8 B;  2V7M A;  1D1B A;  2XAF B;  4DV4 T;  3AE3 A;  4CN4 A;  4X1I E;  4C90 A;  4BJN A;  2JMH A;  4MFR A;  2LM9 A;  3PUZ F;  4JV5 T;  2J47 A;  2XQY A;  2VUR A;  4ZZC A;  2LSG A;  4P0A A;  3WTI A;  3Q5E A;  1XWM A;  2XTL A;  2XAG B;  2X9H A;  2Q9Q A;  2QVA A;  1QSD A;  5LXB A;  1MMG A;  2LSK A;  2X9W A;  3UFG A;  3ONX A;  4KUM B;  1E7P A;  2ZJV A;  2CWO A;  5JDF A;  5FY7 A;  3SIO A;  5ABF A;  4O4I E;  5EK2 A;  5LHG B;  3C64 A;  4EV6 A;  5HXC A;  3NBX X;  4DUZ T;  1T72 A;  3RKO A;  4DBM A;  2X66 A;  3P4Q A;  1FIO A;  3SRZ A;  1UUR A;  3N9N A;  1G73 A;  4J2C A;  4HKA A;  3PUA A;  5LJN A;  3O1J A;  3AVS A;  3BQL A;  4DND A;  2PTF A;  1BR4 A;  3CX6 B;  5JTG A;  3V5U A;  2V26 A;  4YJ3 E;  5AFU L;  4LMJ A;  2BKO A;  3ZT7 A;  3OYZ A;  4PFO A;  4MBQ A;  2BYR A;  1MIW A;  4P0B A;  5C8Y E;  5LCY A;  2VAS A;  3WTK A;  2IC9 A;  4UM3 P;  4O2B E;  2CXL A;  1WFD A;  2DLR A;  3WIP A;  4CQI A;  4OFZ A;  4IRE A;  4PK6 A;  4YY3 T;  2X51 A;  3QNU A;  2ZMA A;  1YD8 G;  3X1D A;  4UM3 A;  3GWH A;  4NPP A;  1KF6 A;  2NTX A;  4O8S A;  2MPK A;  3FZK B;  4H9P C;  4ASK A;  2X00 A;  4EOZ B;  3UQ7 A;  3TLT A;  4WV9 A;  5HWY A;  5FL0 A;  4KI0 F;  4YFS A;  2X0L B;  2BS2 A;  3KVA A;  5J2T E;  3ZC0 A;  2M6B A;  4HWD A;  4DV6 T;  5HEG A;  2EHO A;  4XAX B;  3GN5 A;  2XQ9 A;  5AQM B;  2HN2 A;  5JDH A;  5FMN A;  3AE5 A;  2FBW A;  2ZJU A;  4JLE A;  4COF A;  3LSV A;  4YTN A;  2XAS B;  3CWZ B;  2BG9 E;  3UUL A;  5CJ5 A;  2Q9Q C;  3PUR A;  3PMZ A;  3EDU A;  1IBL T;  5LOV E;  4DBQ A;  3M3Z B;  2V5C A;  2WAU A;  5FKY A;  3U8M A;  5CFB A;  1XNQ T;  1YW0 A;  2YU2 A;  4AFH A;  4TWD A;  4AQF C;  2MAW A;  1MMD A;  4A97 A;  2V7L A;  2W63 A;  2BBJ A;  1YKH B;  2ZM6 T;  4TX5 A;  1Y01 A;  2UXC T;  4YXD A;  5IHY A;  5HXR A;  4DR2 T;  4AQG A;  2XUE A;  2A2F X;  2LSI A;  3I1A A;  4UEM A;  4B3R T;  3ETV A;  2ODV A;  4UM3 S;  4JBW F;  2XM2 A;  4BFQ A;  4WBO A;  4KHZ F;  4AKG A;  4GOU A;  5KZU A;  4AKL A;  4DV5 T;  4JI2 T;  4KX6 A;  2MBG A;  1I9B A;  3ZSS A;  3P50 A;  3VR8 A;  3UQ4 A;  2DL1 A;  2PG8 A;  2PFV A;  4Q25 A;  3AAE B;  3P4W A;  1YQ4 A;  2CBJ A;  2YDR A;  4HFC A;  3U8L A;  2E5V A;  2XZ5 A;  3RX6 A;  4CN6 A;  4UVA B;  5ETW A;  4UXU A;  4A5X A;  2E9X C;  5TAO A;  5L3C B;  1UX2 A;  4TN7 B;  4QX7 B;  5KX5 E;  2YN6 A;  3ONL C;  3M65 A;  5KE4 A;  2Q9Q D;  2W62 A;  2D9D A;  2OLT A;  3ZMV B;  2CBI A;  2WZY A;  1HR0 T;  3K3O A;  2H7O A;  3ZMT B;  4LF7 T;  2LLY A;  2YK0 A;  3LK3 B;  5CA0 E;  3DJB A;  4ADZ A;  4K0K T;  1YQ3 A;  4EAH A;  4H63 V;  5DQV A;  2BYN A;  2YME A;  4IHJ E;  3RYI E;  2D2S A;  3UUX B;  3AAA B;  3C4Z A;  3ZJ1 A;  2Y48 B;  3ZT5 A;  4ZZB A;  3U8N A;  3B13 A;  2JJ9 A;  4KP3 C;  5AQU B;  1UV6 A;  5L3E B;  4FI5 A;  1UX4 A;  2K3W A;  3B57 A;  3KIN B;  2VKH A;  2Q9Q B;  1W0B A;  5J0Z A;  4OHF A;  5LGT B;  3HL6 A;  5A1L A;  2F4V T;  5AFN A;  1WCR A;  5ABF B;  2WDQ A;  3AB3 B;  5AQH B;  4IT4 A;  5L2L A;  2R6G F;  4ZS2 A;  3L8R A;  3VU7 H;  1W09 A;  2E9X D;  2W4X A;  5CGM A;  2H3R A;  1XZY A;  5JRC A;  5AQF B;  4E7Z A;  1VOM A;  1O3X A;  2JQ9 A;  3ZDH A;  3AEA A;  2XYT A;  5J5H A;  3VKH A;  2K9A A;  1HS7 A;  2WU5 A;  3ZN0 B;  3RRW A;  2X00 D;  5EZY E;  3OVU A;  4OYJ A;  3I0Q A;  1KEY A;  2YDS A;  3CX8 B;  3EAB A;  1WYC A;  5LA6 E;  5LXT E;  3R84 B;  2JRK A;  3AE9 A;  4EXT A;  3KBU A;  4IIJ E;  2VL0 A;  3LK4 2;  2FJD A;  2WY2 A;  3N5L A;  1E1H B;  4JYA T;  3AA0 B;  3ONJ A;  1D1C A;  3TLS A;  1XMQ T;  2CM0 A;  4HWC A;  3WAJ A;  3RYC E;  4HN9 A;  2WWU A;  2X0H A;  3WTN A;  4DR5 T;  2XQ3 A;  3A5X A;  1HFA A;  2CLY C;  5L3F B;  4UVC B;  2L3L A;  3AEG A;  2PBI A;  1MMN A;  4F6R C;  1HF8 A;  5DAB A;  3N2G E;  5AQT B;  5CO5 A;  2I6H A;  1T8B A;  3UTK A;  3UT5 E;  3AE4 A;  5AQL B;  5FVK A;  5J2U E;  4QHO A;  2XM1 A;  1MMA A;  2EHO B;  3WTJ A;  1Y64 B;  1GQE A;  4TNW A;  3P4S A;  4HFE A;  4P1N A;  1HG2 A;  5AQV B;  3V5S A;  3NVO A;  4CI1 B;  2XNU A;  1D0Z A;  2DCF A;  1HNW T;  1D0X A;  1NAF A;  3QB5 K;  2ZM8 A;  4TWH A;  3AXJ B;  2LSY A;  4GYS A;  4HQP A;  1UX5 A;  1WYB A;  3OBV E;  2CHN A;  3RQU A;  2AE9 A;  5LYJ E;  4JEU B;  4QXB B;  4PJN A;  1ZEE A;  3LBX A;  2Y56 A;  4HGA A;  4XK9 A;  5JDQ A;  3PJA A;  4ALX A;  4DID B;  5JDL A;  3WTH A;  2VKD A;  3TLU A;  1N33 T;  1KK7 A;  4QXH B;  3EDV A;  2LSJ A;  4HFB A;  2YEV C;  4HFV A;  4EED A;  5BR8 T;  2J4G A;  3C98 B;  1QUU A;  2YU1 A;  3IBP A;  4FJO A;  3JAE A;  3WAK A;  2KSR A;  1L0V A;  4WBN E;  5F5W A;  4QH4 A;  4TWF A;  4LFC T;  5LHI B;  2XSB A;  3DTO A;  3SWH A;  2CCQ A;  1X79 A;  5L47 A;  2V7I A;  4YTP A;  2ACX A;  1NEN A;  2H89 A;  2UUA T;  2YOE A;  3Q5W A;  1T98 A;  2VQE T;  4B3S T;  4K0U A;  2WU2 A;  2W2U A;  4U31 A;  3SFE A;  4CI3 B;  4DO0 A;  4AQF A;  1NWM X;  5KDM C;  3CQX C;  5L3D B;  2KT9 A;  3EAM A;  3C84 A;  2A9U A;  2XNV A;  2NR4 A;  5HEU A;  4BQT A;  3VR9 A;  5HCJ A;  2VL8 A;  2LKG A;  2WMO A;  2BR8 A;  3U8K A;  2YKS A;  1XNR T;  3PUG A;  3MZK B;  3FXD B;  2V6Y A;  4PJM A;  1IZN B;  2HN1 A;  1HNZ T;  4AQY T;  3AA6 B;  2MTQ A;  3AA7 B;  3C50 A;  4U7I A;  1VCT A;  2JMK A;  1KNP A;  4IE7 A;  3O1I A;  3NRY A;  3PEO A;  2E9X A;  3LJC A;  2Y57 A;  3W15 B;  3GMI A;  3IGQ A;  4YSZ A;  4HWF A;  3P4P A;  3VRB A;  3L09 A;  1D1A A;  3DP7 A;  3WTM A;  5JRC B;  3AEB A;  3SOL A;  4LMK A;  2A3D A;  2LJL A;  3HR0 A;  4X62 T;  2H7V C;  4IL9 A;  3CQG B;  5JDG A;  2VVS A;  4O4L E;  4UF0 A;  4QAA A;  5AIN A;  1SE7 A;  1HG5 A;  2B1E A;  1M62 A;  1HNX T;  3F31 A;  3QB5 A;  4DR4 T;  5HAX A;  4UM1 A;  2FJB A;  4DVD A;  4HWI B;  2NW7 A;  4I0U A;  4QAC A;  4QXC B;  1WR6 A;  2CPT A;  4HFD A;  4PIR A;  4H9S E;  4HE8 A;  3AXJ A;  1UW6 A;  4WW0 A;  2ZM0 A;  2K5B B;  2XQ4 A;  4AIU A;  2LHN A;  5FNV E;  3VKG A;  4U72 A;  4CXW A;  4YSX A;  2UXX B;  5LNK A;  4CN1 A;  3E0Z A;  3UUN A;  3PUX F;  4TZ4 C;  3D0T A;  3ZKR A;  3AVR A;  2WQY A;  4A98 A;  3GA8 A;  4H9Q C;  2N1G A;  4QAB A;  2BYS A;  2E5L T;  2W8F A;  3AA1 B;  1WRD A;  3PUS A;  2BVM A;  3KBT A;  5LBM A;  3B5M A;  4IDQ A;  5BP0 A;  2XHE B;  2X68 A;  2B76 A;  2J62 A;  3WTL A;  3FBL A;  4G63 A;  4P09 A;  1OED C;  5FXZ A;  2DWK A;  2LT3 A;  3SQ6 A;  1U4Q A;  1SUM B;  4X1K E;  2C5K T;  2BG9 C;  4I43 B;  3LBX B;  4NIQ A;  2ES0 A;  4AIS A;  5AFH A;  2BZB A;  3KV5 A;  3CX7 B;  1N36 T;  1OWA A;  2CA5 A;  3R6N A;  5AFL A;  5CB4 E;  1HCI A;  2XY8 B;  4NUU A;  1E2A A;  4QKN A;  2V7J A;  3CML A;  4UV9 B;  4X66 T;  3IHR A;  4YHJ A;  3ZYK A;  3RIF A;  2NTY A;  4XHE A;  5EK4 A;  2VKO A;  3KV6 A;  3QC9 A;  3ZMS B;  2I0M A;  5H6Q B;  2V5D A;  2UUC T;  3BQK A;  3HI2 A;  2Y58 A;  4IDN A;  4GIW A;  4ZI7 E;  4XZC A;  2D0U A;  1M7K A;  4EEB A;  1BR0 A;  4ZEY A;  3ZPO A;  5EK3 A;  1FMV A;  4O4J E;  4IDP A;  5AQN B;  4IST A;  2XQ5 A;  3FZF B;  4KMC A;  2WNC A;  2X9Y A;  4JUY A;  3AE6 A;  2LE8 A;  3JAD A;  3RF1 A;  2BYP A;  4X64 T;  3ZCJ A;  3AE7 A;  4MAL A;  2JPF A;  4UR9 A;  3MK7 C;  4DR1 T;  5FXW A;  3E22 E;  3I0O A;  3RGL A;  1UUS A;  2IAK A;  4IGU A;  3CIR A;  3T4M A;  5FJV A;  5DQW A;  3ZEF B;  4DV7 T;  3ZYL A;  1IAP A;  4H63 H;  4ZJS A;  5HEH A;  1I94 T;  2E8I A;  1B7T A;  1DU2 A;  4LFB T;  3KDS E;  3NWI A;  2DHR A;  4PNI A;  5FVL A;  1XMO T;  4AKH A;  3O4X E;  5JVD E;  2W00 A;  2BR7 A;  5LBQ B;  4CXX A;  3FHN A;  5ABH A;  2IIU A;  3UU4 A;  1SHZ C;  1UK5 A;  2AXD S;  2CWY A;  3CPZ A;  1BR1 A;  2KMF A;  2XJ7 A;  3N2K E;  5LGU B;  3F57 A;  4WZX A;  4EZH A;  5E0O A;  3RC8 A;  5AQS B;  3RYH E;  2V6Y B;  1XDO A;  3C79 A;  2LEH A;  5JR9 C;  3WI3 A;  2YMD A;  2E2A A;  3NRX A;  4ZI2 C;  3T8O A;  3SQ9 A;  2BYQ A;  3UU5 A;  4QX8 B;  4LF4 T;  1OXZ A;  5AQG B;  2E9X B;  4B3M T;  2X9X A;  3ANW A;  4UY2 A;  4EYU A;  4GKK T;  3P7I A;  1UCU A;  3NZQ A;  5GON E;  5HWX A;  5IUX A;  4PFP A;  3K3N A;  2VWA A;  4IE5 A;  2VVN A;  1H7C A;  4PJL A;  2XSA A;  2RP4 A;  1KNR A;  1ZOY A;  1N34 T;  1J5E T;  4ZK4 A;  3SH1 A;  2XAH B;  4JI1 T;  3UU8 A;  4UF0 B;  2W67 A;  2A72 A;  3L39 A;  3WTO A;  1S94 A;  2VK9 A;  2KND A;  3T1H T;  5FL1 A;  4BA9 A;  2X67 A;  3MAC A;  2YDQ A;  4U33 A;  5J1G A;  1UGO A;  2UXB T;  5CA1 E;  2IC6 A;  2KWI B;  4AFT A;  3EI0 A;  4Z91 A;  4LF8 T;  1IJ5 A;  3PU3 A;  1HTJ F;  2CMR A;  4UEL A;  1Z0P A;  2BJ0 A;  1HX1 B;  4DMV A;  3FZL B;  2WSS V;  4ZRU A;  1EZ3 A;  1HX8 A;  3HKB E;  5ADX L;  2W0G A;  3C4X A;  4AXP A;  4I4T E;  4IE0 A;  3OYX A;  4L9I A;  4ZI2 D;  5AQR B;  2PH9 A;  2CRB A;  3G06 A;  1JNZ A;  2FUP A;  4OK0 A;  2CXD A;  4I55 E;  5LMU T;  3RC3 A;  5BRX A;  2WZH A;  5BMV E;  4PJJ A;  3K3Q C;  2IW5 B;  4AFG A;  2YIN A;  3P4R A;  4E7S A;  2LHR A;  5ABG A;  3SFD A;  1J1J A;  5HEJ A;  4ZS3 A;  2IML A;  2GK9 A;  4V1A v;  3NKZ A;  3RI5 A;  1MIV A;  3RIU C;  2XZE A;  4YSY A;  2IUB A;  5SYO A;  4X1Y E;  2BBH A;  1CHU A;  2DNX A;  2IDO B;  2WDR A;  4HFI A;  5KXJ A;  1SA0 E;  4U2Z A;  4EIW A;  3Q9D A;  2D5U A;  1MIY A;  4IE6 A;  4HEA A;  2CLY B;  2N2N A;  2WNL A;  2M6I A;  3UU6 A;  4H9N C;  5JDN A;  2QYW A;  5H6R B;  1LVK A;  4CI2 B;  5HYA A;  2WBL A;  4WNK A;  4WYV A;  1VRB A;  4JEH B;  4LF9 T;  5F8P A;  4XBF B;  4JI7 T;  2G0U A;  2OV9 A;  5L4H A;  3TKL B;  3ETU A;  2LOP A;  1FMW A;  4JI6 T;  1G8X A;  3MA9 A;  4ISS A;  2LOS A;  5M4Y A;  3PJA J;  3ZYM A;  4NXN T;  1X9B A;  4QH1 A;  2CE7 A;  3EUH A;  4EZ4 A;  5FXV A;  3Q5D A;  2WZI A;  4GK5 E;  3K1S A;  1OED A;  2WWV A;  2RPA A;  1LKX A;  2KXP B;  3U78 A;  4F8H A;  4JI5 T;  2XAJ B;  2BG9 A;  1YXR A;  2HPJ A;  2C5J A;  4G2A A;  4PAG A;  2ODU A;  2XQ7 A;  4H9R C;  3LK2 B;  3KFW X;  2D0T A;  1Z8U A;  1V9D A;  5AQO B;  3S4U A;  4YJ2 E;  2SPC A;  1D0Y A;  2BVL A;  3TLW A;  3AE2 A;  2UXN B;  3AAI A;  2WCA A;  3O1H A;  2WMN A;  2CHO A;  5LMN T;  3VRA A;  4ZJT A;  2V6X A;  2NP9 A;  5KMG P;  1MND A;  4MLK A;  5F3J A;  2HH7 A;  2UU9 T;  3OKQ A;  5AQQ B;  1MNE A;  4TNV A;  4PK4 A;  5BW2 A;  3RH3 A;  4BJM A;  3L3P A;  3BK9 A;  3AEF A;  4NUV A;  4DR3 T;  3LDQ B;  3MJX A;  5LG3 A;  3QK6 A;  3BQI A;  2UXD T;  2ZLY A;  4TV9 E;  4KBM B;  3PUV F;  5HCM A;  4YHH T;  2XQA A;  2C9T A;  2C0S A;  3JCF A;  4B3T T;  4GKJ T;  5J5G A;  3ANW B;  2ACZ A;  2X0Y A;  2BKP A;  3LG7 A;  1OED E;  5AFM A;  3JAF A;  2WP9 A;  2Y6X A;  5AQP B;  3MXZ A;  2M67 A;  4IE4 A;  3N2O A;  3J7Y q;  5LB7 B;  3TLV A;  4DV0 T;  3CQC B;  2JIW A;  5AQI B;  5J5F A;  3ZN1 B;  4FRR A;  3HA4 A;  4D01 A;  5HEO A;  4U74 A;  4L5G A;  3UUB A;  2CXF A;  5JME A;  4X65 T;  2ZM2 A;  3P8C D;  3O9X A;  2K48 A;  4DV1 T;  3RPU A;  2LRK A;  4U2Y A;  5JQG E;  4AI6 A;  5L3G B;  2WN9 A;  3N9M A;  3U8J A;  3E08 A;  1R8I A;  2HHH T;  3AE8 A;  4IDO A;  2JQH A;  3FB2 A;  3CK6 A;  5FYM A;  4DUY T;  3RLF F;  5TVC A;  4BAY B;  2V8S V;  2JQQ A;  4ZR6 A;  4B6X A;  4EGW A;  2J1D G;  2UUB T;  5FY1 A;  2KIN B;  3U3I A;  2BKN A;  3FZM B;  5JR9 A;  3AEE A;  5IWA T;  3FBZ A;  2Y7Y A;  1IBK T;  4UVB B;  3N9L A;  2XAQ B;  3KV9 A;  2BDE A;  1LRZ A;  1W9R A;  1W0A A;  4ZI3 C;  2NW8 A;  4ILC A;  4O2A E;  5LHH B;  4JI3 T;  5ABE A;  4OYK A;  3AED A;  4GK0 E;  5JRE A;  5AQJ B;  5L4E A;  5HXS A;  4C91 A;  3C51 A;  5HXE A;  1KFY A;  3K8P C;  1YKE B;  4ZHQ E;  3PUQ A;  4UIG A;  4YTM A;  3AEC A;  2QGS A;  1WLX A;  2MYS A;  2NW9 A;  4EZ1 A;  4X5T A;  4KHP T;  4L0R A;  4DR6 T;  4ZXL A;  3GUA A;  2XYS A;  4AKR B;  5C2T A;  3QOF A;  3PUW F;  4ANJ A;  3SS1 A;  1NEK A;  4UXN B;  3JC6 C;  2NOX A;  4QWN B;  3PV0 F;  2VQF T;  2QC1 B;  4AKI A;  1WR0 A;  3PDY A;  2IHR 1;  4U3C A;  2KLQ A;  3ESL A;  4N78 D;  1FJG T;  3ZT6 A;  4I50 E;  3C4W A;  1XDP A;  2EHO C;  3OPC A;  2RA1 A;  4CXY A;  3T1Y T;  2FJA A;  3FXE B;  5FY0 A;  3A8Y C;  3HKD E;  4O4H E;  3N9Q A;  2HPL A;  3RQW A;  4ILB A;  2W8G A;  4IL4 A;  3PE0 A;  3RYF E;  4U7Y A;  3H37 A;  3ZJ2 A;  4JI8 T;  2XPK A;  4OX9 T;  2NWB A;  4PW8 A;  3F2E A;  1S35 A;  2XQ8 A;  3VHL A;  4H9O C;  4X20 E;  3IEE A;  3HKE E;  3LFM A;  4JI0 T;  4ZI3 D;  2Z6E A;  2DI4 A;  3KV4 A;  2BS3 A;  2PGZ A;  5LJM A;  2VB6 A;  2I59 A;  4DV2 T;  4TUY E;  1KNZ A;  1BR2 A;  5AFK A;  2WNJ A;  4TV8 E;  2LM2 A;  2XZ6 A;  2BS4 A;  2H88 A;  3N9P A;  5HXH A;  1IBM T;  4ILU A;  2MOZ A;  4NZB A;  3Q2M A;  5IYZ E;  3N9O A;  4LFA T;  1OED B;  3RIU A;  4ILA A;  3QUJ A;  5LGN B;  4GYR A;  3HKC E;  5LP6 E;  3JC6 D;  5L3B B;  3UUM A;  2BG9 B;  2P9B A;  4NXM T;  5DJQ C;  1IJ6 A;  3ZCI A;  4ERR A;  3ZLI A;  4ZOL E;  2N9D A;  4EYY R;  2VKJ A;  3AE1 A;  5AQK B;  2WS3 A;  2XQ6 A;  2EHO D;  3EVY A;  5FXX A;  2FJE A;  1QLB A;  4QH5 A;  2L8K A; 
#chains in the Genus database with same CATH homology
 4HQP A;  5HEH A;  2X00 D;  4QAA A;  5AIN A;  4HFH A;  3RQU A;  3WTO A;  2WZY A;  4HFI A;  2BG9 C;  3PMZ A;  5TVC A;  2LLY A;  4ZJT A;  5AFH A;  4ZR6 A;  3RQW A;  4ILB A;  2Y56 A;  2W8G A;  4UM1 A;  2VL0 A;  4IL4 A;  4LML A;  3EAM A;  2Y54 A;  3C84 A;  4AFT A;  3U8M A;  3EI0 A;  2BR7 A;  4LMJ A;  5CFB A;  2LKH A;  5AFL A;  2XNV A;  4TNV A;  4Z91 A;  2WNL A;  2M6I A;  4QAC A;  5BW2 A;  3UU4 A;  3UU6 A;  5HEU A;  2BYN A;  2YME A;  4XK9 A;  4AFH A;  4HFD A;  4TWD A;  2Y7Y A;  4PIR A;  2MAW A;  2XQ8 A;  4BQT A;  5AFJ A;  2BJ0 A;  4A97 A;  2BYR A;  3TLS A;  3UU3 A;  5HCJ A;  4ALX A;  1UW6 A;  4ZRU A;  2PGZ A;  3WTK A;  2LKG A;  4UM3 P;  2XQ4 A;  5LG3 A;  2BR8 A;  3WTH A;  3TLU A;  3RIF A;  3EHZ A;  4ZZB A;  3U8N A;  3U8K A;  2PH9 A;  2YKS A;  3WIP A;  1UV6 A;  5HCM A;  4XHE A;  3WTN A;  4IRE A;  4HFB A;  4ILC A;  2WNJ A;  3C79 A;  5AFK A;  2XQ3 A;  4ZZC A;  3WTI A;  2LM2 A;  2YMD A;  2XQA A;  2C9T A;  2XZ6 A;  3ZDG A;  2Y58 A;  4UM3 S;  3SQ9 A;  4UM3 A;  4ZK1 A;  2BYQ A;  4BFQ A;  5BRX A;  5L4H A;  3UU5 A;  4NPP A;  5J0Z A;  5L4E A;  5J5G A;  3ZKR A;  5AFM B;  4NZB A;  4B5D A;  5KZU A;  3RHW A;  5LXB A;  3JAE A;  5AFN A;  4A98 A;  2KSR A;  5AFM A;  1OED E;  5CO5 A;  5J5I A;  3JAF A;  2X00 A;  4QH1 A;  1I9B A;  3PEO A;  4QH4 A;  2Y57 A;  4TWF A;  3UQ7 A;  2ZJV A;  3SIO A;  3TLT A;  4X5T A;  3RIA A;  3P50 A;  4UY2 A;  4WV9 A;  4EZ1 A;  3IGQ A;  1OED B;  3UQ4 A;  2XQ5 A;  4QAB A;  2UZ6 A;  2BYS A;  4AFG A;  2W8F A;  3P4W A;  4ILA A;  3GUA A;  3TLV A;  2WNC A;  1OED A;  3WTM A;  5J5F A;  5IUX A;  4HFC A;  2XYS A;  4LMK A;  4FRR A;  3JAD A;  3WTJ A;  3U8L A;  4D01 A;  4TNW A;  2XZ5 A;  2BYP A;  2M6B A;  5HEO A;  3UUB A;  4F8H A;  2BG9 B;  5L47 A;  5HEJ A;  5BP0 A;  5HEG A;  5JME A;  2XNT A;  4HFE A;  4UXU A;  4DBM A;  2BG9 A;  4ZK4 A;  3SH1 A;  2XQ6 A;  2XQ9 A;  1UX2 A;  4IL9 A;  4Z90 A;  3RI5 A;  3WTL A;  2QC1 B;  2YOE A;  2XNU A;  2XQ7 A;  2YN6 A;  3ZDH A;  1OED C;  3UU8 A;  2XYT A;  5SYO A;  5FJV A;  3T4M A;  2ZJU A;  5J5H A;  3SQ6 A;  5KE4 A;  4COF A;  3LSV A;  2WN9 A;  4QH5 A;  4TWH A;  3U8J A;  4ZJS A;  3TLW A;  2BG9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...