2XQ8A

Pentameric ligand gated ion channel glic in complex with zinc ion (zn2+)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq8A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq8A01
3P4WA 5HEHA 4AFGA 4IREA 4ILCA 4IL4A 4LMKA 5L4EA 4F8HA 1OEDB 2BJ0A 2C9TA 2BYSA 4A97A 2X00A 5HCMA 3ZDHA 5J5IA 5J5GA 3T4MA 4UY2A 2WN9A 1OEDA 4HFCA 4ZZCA 2Y57A 2BYNA 5LG3A 2XQ8A 4ZR6A 1OEDE 2UZ6A 3EHZA 2BR8A 2Y56A 3WTLA 5CFBA 3WTKA 2W8FA 5J5FA 2W8GA 4QABA 2XQ3A 4Z91A 5L4HA 3UQ4A 4QACA 3P50A 4QH1A 4ZJTA 3IGQA 5AFHA 2XNVA 3U8NA 3WTIA 4A98A 1UV6A 3WTHA 1UX2A 4HFBA 4FRRA 2BYPA 2BG9B 5AFJA 5BP0A 4TWFA 3U8JA 4ZK1A 4UXUA 5HEGA 3JAFA 4PIRA 4TNVA 2XNUA 5AFKA 4ILBA 2BYQA 3C79A 3TLTA 2WNJA 2LM2A 3TLSA 3TLUA 5FJVA 3U8KA 3UU6A 5AFMA 3U8LA 4QH4A 2M6IA 2BYRA 4QAAA 5AFNA 5L47A 2Y7YA 3SH1A 4TWDA 3SIOA 4BQTA 2PH9A 5KE4A 4NZBA 2ZJVA 3WTOA 4B5DA 4HFDA 5LXBA 3JADA 3RIFA 1I9BA 5SYOA 5HEOA 3ZDGA 4D01A 4ILAA 2YKSA 5IUXA 3RI5A 3EAMA 3UQ7A 5HCJA 5AFMB 3PEOA 3GUAA 2YMDA 2LLYA 2Y54A 2ZJUA 3RQWA 4UM3P 2VL0A 2PGZA 4UM1A 3RIAA 2XQ9A 2KSRA 4NPPA 4ALXA 4BFQA 4DBMA 4HFEA 4EZ1A 2XZ6A 2YMEA 3EI0A 2M6BA 3LSVA 3ZKRA 4ZK4A 1UW6A 5CO5A 4XK9A 3UU5A 4COFA 4ZRUA 5AINA 2BG9C 2YN6A 3WIPA 3TLVA 5JMEA 3WTMA 4HFHA 3TLWA 3UU3A 2XQAA 3JAEA 4LMLA 4UM3S 3RHWA 3C84A 2QC1B 2XQ6A 2XNTA 2XQ4A 2XQ7A 5AFLA 4TNWA 5J0ZA 4AFTA 5HEUA 2WNCA 5BW2A 5TVCA 3WTNA 2MAWA 2WNLA 2LKGA 5HEJA 2X00D 4XHEA 3UUBA 5BRXA 2Y58A 4LMJA 3U8MA 4Z90A 3RQUA 5J5HA 2BR7A 4HQPA 4AFHA 2BG9A 4UM3A 1OEDC 4ZZBA 4IL9A 4X5TA 5KZUA 2XQ5A 4WV9A 2XZ5A 3UU8A 2BG9E 3SQ9A 2XYTA 4QH5A 3SQ6A 2WZYA 3PMZA 2LKHA 4TWHA 4HFIA 4ZJSA 2XYSA 2YOEA 3WTJA 3UU4A
chains in the Genus database with same CATH superfamily
4AFGA 3L8RA 4ZOLE 2IDOB 1UK5A 5LCYA 5LGNB 3NRYA 4A97A 4P0AA 2Q9QC 2J4GA 5AQQB 4LF6T 3AE2A 2JJ9A 4O8SA 4QWNB 2LT3A 4QH1A 2D0TA 4HFBA 3VR9A 1OXZA 1WYBA 3AA6B 2VKDA 1W9RA 3AXJA 2BYQA 1XDPA 2LM2A 3TLSA 2X9XA 4EYYR 4N78D 5AFNA 2YU2A 2VKJA 4G2AA 4BQTA 5KE4A 2DHRA 3AE7A 3DP7A 2JMHA 3FZLB 2X66A 5AFMB 2X9YA 2XZ6A 3LSVA 2W62A 4IE4A 3N9MA 4DNDA 3E08A 4ZRUA 2BG9C 4CZZB 1N36T 4HFHA 5FXWA 2NW8A 2XHEB 4ZI2C 4OK0A 2XQ4A 2ODUA 1R8IA 2WNCA 5BRXA 4KUMB 3ETUA 4QXHB 4Z90A 4HWCA 4WV9A 4L9IA 4DV2T 2BG9E 1XMQT 2BS2A 3SQ6A 2WZYA 3N9NA 4CN4A 2IIUA 2WCAA 1XWMA 1VCSA 3ZC1A 5LB7B 2XZEA 2JMKA 2VKOA 3QB5A 5AQSB 2CXLA 5IYZE 3SWHA 4QHOA 2CWOA 2XM1A 2SPCA 3HKBE 4TV9E 1I94T 2D0UA 3ZEFB 4B3MT 2W4XA 1QUUA 2V7LA 3AE9A 5J5FA 5FXXA 4QACA 5AQHB 3UQ4A 2H7VC 1IAPA 4DV6T 1UX4A 4DUYT 4HEAA 4KP3C 4U33A 4FRRA 3CVRA 1WR0A 1AJ3A 1HNZT 4NUVA 5FKYA 2XNUA 5ADXL 3T1YT 1BR1A 2WNJA 5HXRA 5FL0A 3EUHA 3JC6D 2WP9A 5FVLA 1IBKT 2Z6EA 1MIYA 2W0GA 3WTOA 1O3XA 3G06A 1UUSA 3BQKA 4D01A 1G73A 3RQWA 2PGZA 2X51A 2KSRA 5JR9C 4EZ1A 3GN5B 4I0UA 2D2SA 5FVKA 4DVDA 2BBJA 3IEEA 5HXEA 3ZMUB 5CO5A 3AE3A 2YN6A 3ZYMA 2XSBA 3P7IA 5LGTB 2ZM8A 3LDQB 3D0TA 4LF9T 2QA7A 2LHNA 3I1AA 2LEHA 4XAXB 2X00D 4KHPT 1UURA 3UFGA 3ZMTB 2VWAA 2XAHB 2UXDT 5KZUA 2XQ5A 3Q5EA 1ZHCA 1ZP0A 3FBLA 2DL1A 4PNIA 5JTGA 4LFAT 4H63V 1U5PA 3N9LA 4OFZA 4DR6T 3CK6A 3FXEB 4M1PA 3EHZA 4IE6A 1KNPA 2UUCT 4OYJA 2D9DA 4EEBA 2UXCT 5L4HA 3KVAA 5JVDE 3U8NA 5EK4A 4Q25A 2V1DB 2LSYA 4BJMA 4HWIB 3RC3A 2V7KA 4EZ4A 2BVLA 3L09A 3PUZF 5FJVA 4IE5A 3RPUA 4TWDA 2PH9A 4DUZT 2VVSA 3NWIA 3U78A 5AQNB 5LP6E 4PK5A 3GUAA 4MFRA 2ZJUA 4UM3P 2VURA 3RIAA 4NPPA 3LBXA 4P09A 1M7KA 4PFOA 3KBUA 4DBMA 4ZK4A 4DV1T 3NKZA 4ADZA 2H89A 2C0SA 4AQGA 5FYMA 4JV5T 2XQ7A 4JI3T 3ZT6A 2I0MA 4AQFA 2WAUA 4DMWA 4B3ST 2AXDS 2WBLA 3ZMZB 3U8MA 2ES0A 2KWHA 3E0ZA 3RQUA 5EK2A 4AFHA 4EAHA 4V1Av 2Q9QA 3GMIA 3C4ZA 4WZXA 4HFIA 1W09A 4OX9T 3ZPOA 2LSKA 2LSIA 3CX8B 3KINB 4UV8B 3R84B 3ZT7A 5F8PA 5HCMA 2BKNA 1XNRT 3KVBA 4E7SA 2NWBA 4UIGA 4U31A 3WTLA 3HI2A 4H9QC 2VK9A 2LSGA 4UR9A 4YHHT 2CM0A 3P50A 2Q9QB 3DJBA 5LJNA 4JI8T 3T1HT 3LK2B 1HNXT 3JAFA 4PIRA 4TNVA 4AISA 3H3AA 4U2ZA 3AEFA 2DWKA 1NENA 4AKRB 3C98B 2ZJVA 2ZLYA 5SYOA 3P4PA 2LRKA 3LFMA 2IC6A 2E5LT 2LLYA 2Y54A 2DCFA 3FXDB 4DBRA 2YMEA 2N1GA 5AINA 3RH3A 4AKHA 3Q5DA 2WB5A 1QLBA 3C84A 2Y6XA 4HWFA 3CX7B 4XHEA 4LMJA 4IL9A 4HGAA 2XZ5A 2FJBA 3VU7H 2Q9QD 4IREA 1SA0E 1N32T 2KLQA 3T8OA 3P4QA 2BVMA 5DQWA 3RKOA 2XQYA 2W67A 5ETWA 4HE8A 4DR5T 2BR8A 4ZS2A 2IMLA 2WS3A 4J2CA 4QABA 4QX7B 5FP3A 2WZIA 5L3CB 1LVFA 1HX1B 2WZHA 3RF1A 1IBMT 3AE4A 3AA0B 2N2NA 3N2GE 4X62T 5JDFA 2NW9A 2M6IA 2BYRA 2UUBT 1CHUA 4OHFA 3RKGA 4IHJE 2VL0A 1HG5A 3PTRB 4GK0E 1HX8A 1MMGA 5KX5E 3AE8A 1MNEA 5JDHA 2X0LB 3J7Yq 5JMEA 2KXPB 2XQAA 3CQCB 3IBPA 3FBZA 4KX6A 3EDVA 3V5SA 4EEDA 2MAWA 2LKGA 2NTXA 2Y58A 4H9RC 2CE7A 2BR7A 4ZZBA 4DR1T 4H9SE 3SQ9A 4DR7T 3WI3A 5HWXA 2IAKA 5AQRB 2KINB 2IUBA 5BMVE 4GK5E 4C90A 3ZJ2A 3L39A 5JQGE 2NR4A 4UV9B 3Q5WA 4UY2A 2L8KA 4ILUA 3KBTA 4EOZB 1T72A 2CLYB 4EGWA 3UTKA 5KMGP 4P0BA 4LFBT 5AFJA 5BP0A 3U3IA 1VRBA 3SFEA 3VKGA 2WDRA 5AQUB 5LHHB 1NAFA 3U8LA 3Q9DA 1J1JA 4DV5T 5L47A 4L0RA 2QGSA 1US7B 4XBFB 4CI2B 1XNQT 3B5MA 1WFDA 3UQ7A 2CA5A 2HN1A 4K0KT 3PU3A 3PURA 2LRLA 3SRZA 2H88A 2K5BB 4ASKA 2JQ9A 4IE7A 4YFSA 4O4JE 4YT0A 1MMAA 2E8IA 1J5ET 4AI6A 3JAEA 4LMLA 1UCUA 4A56A 5L3BB 4TNWA 2HPLA 1WLXA 4EXTA 5TVCA 3LBXB 2XAFB 2CPTA 2WNLA 3PUWF 3CQGB 4ERRA 1E2AA 3J9X1 3K3NA 1BR2A 3S4UA 2N9DA 4JI0T 3QK6A 4QH5A 2LKHA 4YSZA 1NWMX 2VVNA 2BDEA 5AQGB 4UVAB 3R6NA 5LG3A 3PUQA 4GYRA 1U4QA 2XAQB 3C64A 5DJQC 2EHOB 4ZJTA 1FIOA 2XNVA 3WTIA 1CUNA 4A98A 3WTHA 1UX2A 2BG9B 4UVBB 3ZJ1A 4I55E 3N5LA 4H63H 4U7YA 4PK6A 4DR3T 2J1DG 5AQKB 1X79A 2PFVA 4X64T 1I6ZA 3SH1A 5J2TE 1W0BA 5LMUT 1MIVA 2V26A 5C3JA 5HWYA 4YLHA 2YKSA 5IUXA 1YW0A 2V5CA 2NTYA 2M67A 3ZLIA 4DV7T 3RIUA 3FHNA 2MYSA 5IHYA 3ZCIA 4AXPA 2XM2A 5LHGB 3RYIE 1HG2A 3MKDA 4CXYA 3MK7C 2E5VA 2FBWA 1T98A 4H9OC 3AE1A 2QYWA 3KV4A 1G8XA 2EHOA 3C51A 2V5DA 2WMNA 2NOXA 3JCFA 2BS4A 3N2KE 3FZFB 1ZV4X 4ZI3D 2XYTA 2C5KT 1FEWA 2X0YA 2YOEA 3WAKA 3I9YA 5FXVA 2VL8A 5HYAA 1JNRA 4AQYT 3H37A 1MNDA 4C91A 5GONE 2V7JA 1KFYA 2E2AA 2VQET 4IDOA 3B13A 5JR9B 5CFBA 3WTKA 3LK42 2XQ3A 4NIQA 1M62A 2WDQA 2K9AA 3NBXX 4IT4A 4ZK1A 3BQLA 4GIWA 1D1BA 2V6YB 5DABA 4CXXA 2E9XA 4MHCA 5EK3A 3RYCE 2QRXA 4TV8E 2FJDA 3RX6A 2DWGA 3PU8A 4HFDA 3CKDA 3JADA 3K8PC 4I50E 2MOZA 4ILAA 4CN1A 1D1AA 2K3WA 4UF0A 2E9XB 4OYKA 5JDLA 5IWAT 5J1GA 2IW5B 4UXNB 1XMOT 3A8YC 2EHOD 1VCTA 5LA6E 4YY3T 1D0XA 3TLVA 3ZN0B 3TLWA 2C5JA 5A1LA 2DNXA 4UM3S 4U74A 2LOSA 2VKHA 3O9XA 2VB6A 5BW2A 3WTNA 2KT9A 5HEJA 2ZM0A 1LVKA 5CB4E 1OEDC 2UUAT 3LK3B 2YU1A 4TWHA 4NXNT 3UU4A 3NRXA 2WSSV 2GK9A 4WW0A 2V7MA 4IGUA 4YHJA 2UXNB 2FJEA 5CA0E 4PJNA 4JI1T 3WAJA 4DR4T 4GYSA 2D5UA 2X68A 4U2YA 5HEGA 3C50A 5AFKA 4CI3B 2W2UA 3C79A 4MBQA 4U72A 3TLUA 2KWIB 3CPZA 4FI5A 3AA1B 3K3QC 1V9DA 4WBNE 1JNZA 2J47A 3AECA 3EAMA 5HCJA 2CMRA 4QX8B 3V5UA 4ALXA 5EZYE 1XZYA 2WDVA 2XUEA 5AQMB 1ZOYA 4L5GA 4PW8A 3QC9A 4QXBB 4DV4T 3P4RA 1HNWT 3M3ZB 4HWDA 1MMDA 5L3GB 2JIWA 2OA5A 5JDGA 2ODVA 3EABA 3UUBA 3DTOA 3HR0A 1VOMA 1KF6A 1QSDA 5LOVE 2WU2A 2PBIA 2B1EA 3WTJA 5AQVB 5ABFB 1MMNA 4X20E 4HKAA 3GWHA 4PFPA 4F8HA 1WCRA 5J5IA 4WBOA 2IC9A 4BA9A 3RC8A 2WN9A 5HAXA 2B76A 2Y57A 2XQ8A 2UXXB 2Y56A 3QNUA 3PJAJ 3PUYF 2E9XC 2CRBA 5AFHA 5LMNT 3AEBA 3AAIA 5H6RB 1W0AA 3U8JA 3PUSA 1FMVA 3ZMVB 2K48A 2DI4A 5HXCA 4PJJA 2QVAA 4UVCB 3KV5A 4HFVA 4QAAA 1HTJF 2RP4A 1S35A 4NZBA 3HKEE 1I9BA 4NUUA 1N34T 2JQKA 3IA3A 2LM9A 2CXFA 3FB2A 3RYFE 4TX5A 2RA1A 3EI0A 3PUXF 2J62A 5TAOA 2K24A 4COFA 4A5XA 3LG7A 3WTMA 3O1HA 3MJXA 1D0YA 1B7TA 4UF0B 3CIRA 2CXDA 3QUJA 3AB3B 1MIWA 4AIUA 3OYXA 3OJAA 3AVRA 4X65T 1HF8A 1LRZA 3RGLA 4P1NA 3SOLA 5LYJE 1WR6A 4GKJT 2R6GF 3K1SA 4ZXLA 4ISTA 2WM9A 2HHHT 3BK9A 3N2OA 1UX5A 2XAJB 1GQEA 2CWYA 3CMLA 1ZEEA 3UT5E 2CCQA 1KEYA 4G63A 4LMKA 3UUMA 4JI7T 4BAYB 2BYSA 4JI6T 4B6XA 3PDYA 4HFCA 4H9PC 2JQHA 1KNRA 3IGQA 3QB5K 4EB6E 1UV6A 2ACXA 3OVUA 1S94A 2JQQA 2PG8A 3ZN1B 3UU6A 2X67A 5JH7E 4ZI7E 3P8CD 2W63A 2AE9A 2LE8A 1SE7A 3PEOA 1D1CA 2CHNA 2A9UA 3LJCA 2V6XA 1HS7A 5AQPB 5L2LA 1XDOA 4LF4T 2NP9A 1UW6A 2X9WA 4HTEA 2I59A 3O4XE 2QC1B 3UULA 2W61A 5AFLA 2V8SV 3AAAB 4WNKA 4AFTA 2ZMAA 3SFDA 2H3RA 3ZMSB 1T8BA 4E7ZA 3N9QA 4H9NC 1YQ4A 3MZKB 4K0UA 3HA4A 5HXHA 3CQXC 3UU8A 3C4WA 2LJLA 3K3OA 2PJQA 3EVYA 4IL4A 4U3CA 4EIWA 5L4EA 4X66T 1OEDB 5JRCB 2VASA 3P4SA 2X00A 4YSYA 4X1KE 5JDMA 2OV9A 1OEDA 5L3FB 4ZI3C 4TUYE 4JI4T 5CA1E 3ZYLA 2L3LA 2XASB 2MTQA 4MALA 2YK0A 3PJAA 1FMWA 2V7IA 5LHIB 4CN6A 1L0VA 2PTFA 3N9PA 4UXUA 4UEMA 3RLFF 3UUXB 3GN5A 4LFCT 3TLTA 5FL1A 3PE0A 3U8KA 3OKQA 4O4LE 3ZYKA 2BBHA 4CXWA 5F5WA 3M65A 2IHR1 3RIFA 5FY7A 5AFUL 4GOUA 2LSJA 3UFEA 4PAGA 2HN2A 2YMDA 4DBQA 4YJ2E 4QKNA 3ESLA 4O2BE 3E22E 3AEEA 3UU3A 2WQYA 3RHWA 2BZBA 3PUVF 4ISSA 1Z8UA 5AQJB 3RYHE 1OWAA 2FUPA 3BQIA 2EHOC 5ABEA 2KMFA 2XPKA 3Q5XA 2G0UA 4JEUB 2W00A 3OTOT 3PUAA 1BR4A 2A2FX 3QOFA 5JREA 2BKPA 5C2TA 3N9OA 4MLKA 4ZJSA 2ZM6T 4PJLA 3P4WA 3ONXA 3ZSTA 3HKCE 3KDSE 2WY2A 4Z8XA 5FY0A 2BJ0A 2A3DA 4DO0A 3T4MA 3ANWA 3ONJA 1OEDE 2WWVA 2H7OA 3KV9A 3IF8B 2W8FA 3OYZA 4Z91A 5J2UE 2CEAA 3ANWB 1SUMB 2BYPA 3GA8A 3MACA 4YTMA 3MA9A 1Y01A 4QXCB 5AQTB 4JBWF 4FJOA 3AE6A 2WWUA 4HN9A 3PUGA 4B3TT 2Y7YA 3C4XA 2XSAA 4B5DA 2KNDA 5LBMA 2XAGB 3ZDGA 1IJ6A 1KK7A 3PV0F 1E7PA 2LHRA 4LF5T 4UM1A 4UELA 4AKGA 5CGMA 4XK9A 2MBGA 4O2AE 2MPKA 3VRAA 5CJ5A 3NVOA 3WIPA 3B57A 2HH7A 2CBJA 4I4TE 1IBLT 4DR2T 4KBMB 5HEUA 4LF8T 3AEAA 4UM3A 5F3JA 4CQIA 5JDQA 3PMZA 3F31A 1H7CA 5L3DB 3AE5A 1WRDA 5HEHA 4ANJA 4ILCA 5JDNA 4GKKT 4IDNA 4JI5T 4CI1B 4B3RT 2Y48B 3O1IA 5LNKA 3ZDHA 3HKDE 4WYVA 4TN7B 5LBQB 2Y8DA 4YXDA 1UGOA 2X9HA 5HXSA 3I0OA 4TWFA 5H6QB 5AQFB 4IDPA 4JLEA 4TZ4C 2LOPA 4JEHB 3ZSSA 5BR8T 1N33T 1EZ3A 1YKHB 3ZCJA 3NZPA 4F6RC 3IHRA 3CWZB 4HFEA 3ZC0A 3H3MA 2C5IT 5JRCA 5DQVA 4X1YE 1D0ZA 5FMNA 5L3EB 3NZQA 5J0ZA 2JRKA 3CX6B 4XZCA 1T7SA 4YTNA 4IE0A 3RIUC 3SS1A 2BKOA 4PK4A 4ZEYA 4ZI2D 1Y64B 5J5HA 3OBVE 4KMCA 4O4IE 2X0HA 3RRWA 4DIDB 2DLRA 2VQFT 5FXZA 2W66A 3RRCA 2OLTA 4X1IE 2C9TA 3FZMB 2CLYC 3AAEB 4IIJE 2YINA 4I43B 1ZKEA 3I9WA 2BYNA 4ZR6A 2UZ6A 4DMVA 3ONLC 4EYUA 1WYCA 1IZNB 3W15B 1YKEB 3L3PA 3ABVA 3MXZA 4AKLA 2WU5A 4EV6A 3UUNA 4ILBA 5LGUB 2YDSA 5AFMA 2CHOA 3SIOA 4BJNA 5AQIB 1E1HB 5LXBA 2UXBT 2CBIA 4JYAT 3VKHA 4ZS3A 3TKLB 3AXJB 2XQ9A 4DV3T 3ZKRA 3FZHB 3OPCA 4IDZA 3ETVA 2ZM2A 2XQ6A 2XNTA 1IJ5A 5ABHA 2XTLA 5M4YA 1LKXA 3JC6C 2HPJA 2FJAA 3A5XA 3HL6A 4HWHA 1HR0T 4KI0F 3O1JA 4X5TA 3F57A 2F4VT 5KDMC 4YTPA 3FZKB 2NW7A 2I6HA 5JR9A 5ABGA 2YEVC 3KV6A 4KHZF 1YXRA 4JI2T 5C8YE 3I0QA 2V6YA 1YQ3A 2UU9T 5LG4A 5J5GA 4ZHQE 4ZZCA 3AVSA 2W8GA 3AEDA 4NXMT 4O4HE 3X1DA 2KZ7B 3Q2MA 5AQOB 3VHLA 4JUYA 3VR8A 5ABFA 3VRBA 4QH4A 1SHZC 2ACZA 1HFAA 1HCIA 4PJMA 2XY8B 5AQLB 5HEOA 5E0OA 3RI5A 2RPAA 2L9QA 3A7MA 1KNZA 1J5WA 2E9XD 1Z0PA 4YSXA 3F2EA 4BFQA 1FJGT 2P9BA 2M6BA 4IDQA 4U7IA 5LXTE 3UU5A 1DU2A 1X9BA 2WMOA 4AKIA 4DV0T 1NEKA 2YDQA 4EZHA 3AEGA 1BR0A 2YDRA 3KFWX 4AQFC 1YD8G 5FNVE 4HQPA 2BG9A 5FY1A 3EDUA 5LJMA 5KXJA 4YJ3E 3AA7B 2XJ7A 3ZT5A 2BS3A 2XYSA 2JPFA 4LF7T 2A72A
chains in the Genus database with same CATH topology
3P4WA 5HEHA 4AFGA 4IREA 4ILCA 4IL4A 4LMKA 5L4EA 4F8HA 1OEDB 2BJ0A 2C9TA 2BYSA 4A97A 2X00A 5HCMA 3ZDHA 5J5IA 5J5GA 3T4MA 4UY2A 2WN9A 1OEDA 4HFCA 4ZZCA 2Y57A 2BYNA 5LG3A 2XQ8A 4ZR6A 1OEDE 2UZ6A 3EHZA 2BR8A 2Y56A 3WTLA 5CFBA 3WTKA 2W8FA 5J5FA 2W8GA 4QABA 2XQ3A 4Z91A 5L4HA 3UQ4A 4QACA 3P50A 4QH1A 4ZJTA 3IGQA 5AFHA 2XNVA 3U8NA 3WTIA 4A98A 1UV6A 3WTHA 1UX2A 4HFBA 4FRRA 2BYPA 2BG9B 5AFJA 5BP0A 4TWFA 3U8JA 4ZK1A 4UXUA 5HEGA 3JAFA 4PIRA 4TNVA 2XNUA 5AFKA 4ILBA 2BYQA 3C79A 3TLTA 2WNJA 2LM2A 3TLSA 3TLUA 5FJVA 3U8KA 3UU6A 5AFMA 3U8LA 4QH4A 2M6IA 2BYRA 4QAAA 5AFNA 5L47A 2Y7YA 3SH1A 4TWDA 3SIOA 4BQTA 2PH9A 5KE4A 4NZBA 2ZJVA 3WTOA 4B5DA 4HFDA 5LXBA 3JADA 3RIFA 1I9BA 5SYOA 5HEOA 3ZDGA 4D01A 4ILAA 2YKSA 5IUXA 3RI5A 3EAMA 3UQ7A 5HCJA 5AFMB 3PEOA 3GUAA 2YMDA 2LLYA 2Y54A 2ZJUA 3RQWA 4UM3P 2VL0A 2PGZA 4UM1A 3RIAA 2XQ9A 2KSRA 4NPPA 4ALXA 4BFQA 4DBMA 4HFEA 4EZ1A 2XZ6A 2YMEA 3EI0A 2M6BA 3LSVA 3ZKRA 4ZK4A 1UW6A 5CO5A 4XK9A 3UU5A 4COFA 4ZRUA 5AINA 2BG9C 2YN6A 3WIPA 3TLVA 5JMEA 3WTMA 4HFHA 3TLWA 3UU3A 2XQAA 3JAEA 4LMLA 4UM3S 3RHWA 3C84A 2QC1B 2XQ6A 2XNTA 2XQ4A 2XQ7A 5AFLA 4TNWA 5J0ZA 4AFTA 5HEUA 2WNCA 5BW2A 5TVCA 3WTNA 2MAWA 2WNLA 2LKGA 5HEJA 2X00D 4XHEA 3UUBA 5BRXA 2Y58A 4LMJA 3U8MA 4Z90A 3RQUA 5J5HA 2BR7A 4HQPA 4AFHA 2BG9A 4UM3A 1OEDC 4ZZBA 4IL9A 4X5TA 5KZUA 2XQ5A 4WV9A 2XZ5A 3UU8A 2BG9E 3SQ9A 2XYTA 4QH5A 3SQ6A 2WZYA 3PMZA 2LKHA 4TWHA 4HFIA 4ZJSA 2XYSA 2YOEA 3WTJA 3UU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4W A;  5HEH A;  4AFG A;  4IRE A;  4ILC A;  4IL4 A;  4LMK A;  5L4E A;  4F8H A;  1OED B;  2BJ0 A;  2C9T A;  2BYS A;  4A97 A;  2X00 A;  5HCM A;  3ZDH A;  5J5I A;  5J5G A;  3T4M A;  4UY2 A;  2WN9 A;  1OED A;  4HFC A;  4ZZC A;  2Y57 A;  2BYN A;  5LG3 A;  2XQ8 A;  4ZR6 A;  1OED E;  2UZ6 A;  3EHZ A;  2BR8 A;  2Y56 A;  3WTL A;  5CFB A;  3WTK A;  2W8F A;  5J5F A;  2W8G A;  4QAB A;  2XQ3 A;  4Z91 A;  5L4H A;  3UQ4 A;  4QAC A;  3P50 A;  4QH1 A;  4ZJT A;  3IGQ A;  5AFH A;  2XNV A;  3U8N A;  3WTI A;  4A98 A;  1UV6 A;  3WTH A;  1UX2 A;  4HFB A;  4FRR A;  2BYP A;  2BG9 B;  5AFJ A;  5BP0 A;  4TWF A;  3U8J A;  4ZK1 A;  4UXU A;  5HEG A;  3JAF A;  4PIR A;  4TNV A;  2XNU A;  5AFK A;  4ILB A;  2BYQ A;  3C79 A;  3TLT A;  2WNJ A;  2LM2 A;  3TLS A;  3TLU A;  5FJV A;  3U8K A;  3UU6 A;  5AFM A;  3U8L A;  4QH4 A;  2M6I A;  2BYR A;  4QAA A;  5AFN A;  5L47 A;  2Y7Y A;  3SH1 A;  4TWD A;  3SIO A;  4BQT A;  2PH9 A;  5KE4 A;  4NZB A;  2ZJV A;  3WTO A;  4B5D A;  4HFD A;  5LXB A;  3JAD A;  3RIF A;  1I9B A;  5SYO A;  5HEO A;  3ZDG A;  4D01 A;  4ILA A;  2YKS A;  5IUX A;  3RI5 A;  3EAM A;  3UQ7 A;  5HCJ A;  5AFM B;  3PEO A;  3GUA A;  2YMD A;  2LLY A;  2Y54 A;  2ZJU A;  3RQW A;  4UM3 P;  2VL0 A;  2PGZ A;  4UM1 A;  3RIA A;  2XQ9 A;  2KSR A;  4NPP A;  4ALX A;  4BFQ A;  4DBM A;  4HFE A;  4EZ1 A;  2XZ6 A;  2YME A;  3EI0 A;  2M6B A;  3LSV A;  3ZKR A;  4ZK4 A;  1UW6 A;  5CO5 A;  4XK9 A;  3UU5 A;  4COF A;  4ZRU A;  5AIN A;  2BG9 C;  2YN6 A;  3WIP A;  3TLV A;  5JME A;  3WTM A;  4HFH A;  3TLW A;  3UU3 A;  2XQA A;  3JAE A;  4LML A;  4UM3 S;  3RHW A;  3C84 A;  2QC1 B;  2XQ6 A;  2XNT A;  2XQ4 A;  2XQ7 A;  5AFL A;  4TNW A;  5J0Z A;  4AFT A;  5HEU A;  2WNC A;  5BW2 A;  5TVC A;  3WTN A;  2MAW A;  2WNL A;  2LKG A;  5HEJ A;  2X00 D;  4XHE A;  3UUB A;  5BRX A;  2Y58 A;  4LMJ A;  3U8M A;  4Z90 A;  3RQU A;  5J5H A;  2BR7 A;  4HQP A;  4AFH A;  2BG9 A;  4UM3 A;  1OED C;  4ZZB A;  4IL9 A;  4X5T A;  5KZU A;  2XQ5 A;  4WV9 A;  2XZ5 A;  3UU8 A;  2BG9 E;  3SQ9 A;  2XYT A;  4QH5 A;  3SQ6 A;  2WZY A;  3PMZ A;  2LKH A;  4TWH A;  4HFI A;  4ZJS A;  2XYS A;  2YOE A;  3WTJ A;  3UU4 A; 
#chains in the Genus database with same CATH topology
 4AFG A;  3L8R A;  4ZOL E;  2IDO B;  1UK5 A;  5LCY A;  5LGN B;  3NRY A;  4A97 A;  4P0A A;  2Q9Q C;  2J4G A;  5AQQ B;  4LF6 T;  3AE2 A;  2JJ9 A;  4O8S A;  4QWN B;  2LT3 A;  4QH1 A;  2D0T A;  4HFB A;  3VR9 A;  1OXZ A;  1WYB A;  3AA6 B;  2VKD A;  1W9R A;  3AXJ A;  2BYQ A;  1XDP A;  2LM2 A;  3TLS A;  2X9X A;  4EYY R;  4N78 D;  5AFN A;  2YU2 A;  2VKJ A;  4G2A A;  4BQT A;  5KE4 A;  2DHR A;  3AE7 A;  3DP7 A;  2JMH A;  3FZL B;  2X66 A;  5AFM B;  2X9Y A;  2XZ6 A;  3LSV A;  2W62 A;  4IE4 A;  3N9M A;  4DND A;  3E08 A;  4ZRU A;  2BG9 C;  4CZZ B;  1N36 T;  4HFH A;  5FXW A;  2NW8 A;  2XHE B;  4ZI2 C;  4OK0 A;  2XQ4 A;  2ODU A;  1R8I A;  2WNC A;  5BRX A;  4KUM B;  3ETU A;  4QXH B;  4Z90 A;  4HWC A;  4WV9 A;  4L9I A;  4DV2 T;  2BG9 E;  1XMQ T;  2BS2 A;  3SQ6 A;  2WZY A;  3N9N A;  4CN4 A;  2IIU A;  2WCA A;  1XWM A;  1VCS A;  3ZC1 A;  5LB7 B;  2XZE A;  2JMK A;  2VKO A;  3QB5 A;  5AQS B;  2CXL A;  5IYZ E;  3SWH A;  4QHO A;  2CWO A;  2XM1 A;  2SPC A;  3HKB E;  4TV9 E;  1I94 T;  2D0U A;  3ZEF B;  4B3M T;  2W4X A;  1QUU A;  2V7L A;  3AE9 A;  5J5F A;  5FXX A;  4QAC A;  5AQH B;  3UQ4 A;  2H7V C;  1IAP A;  4DV6 T;  1UX4 A;  4DUY T;  4HEA A;  4KP3 C;  4U33 A;  4FRR A;  3CVR A;  1WR0 A;  1AJ3 A;  1HNZ T;  4NUV A;  5FKY A;  2XNU A;  5ADX L;  3T1Y T;  1BR1 A;  2WNJ A;  5HXR A;  5FL0 A;  3EUH A;  3JC6 D;  2WP9 A;  5FVL A;  1IBK T;  2Z6E A;  1MIY A;  2W0G A;  3WTO A;  1O3X A;  3G06 A;  1UUS A;  3BQK A;  4D01 A;  1G73 A;  3RQW A;  2PGZ A;  2X51 A;  2KSR A;  5JR9 C;  4EZ1 A;  3GN5 B;  4I0U A;  2D2S A;  5FVK A;  4DVD A;  2BBJ A;  3IEE A;  5HXE A;  3ZMU B;  5CO5 A;  3AE3 A;  2YN6 A;  3ZYM A;  2XSB A;  3P7I A;  5LGT B;  2ZM8 A;  3LDQ B;  3D0T A;  4LF9 T;  2QA7 A;  2LHN A;  3I1A A;  2LEH A;  4XAX B;  2X00 D;  4KHP T;  1UUR A;  3UFG A;  3ZMT B;  2VWA A;  2XAH B;  2UXD T;  5KZU A;  2XQ5 A;  3Q5E A;  1ZHC A;  1ZP0 A;  3FBL A;  2DL1 A;  4PNI A;  5JTG A;  4LFA T;  4H63 V;  1U5P A;  3N9L A;  4OFZ A;  4DR6 T;  3CK6 A;  3FXE B;  4M1P A;  3EHZ A;  4IE6 A;  1KNP A;  2UUC T;  4OYJ A;  2D9D A;  4EEB A;  2UXC T;  5L4H A;  3KVA A;  5JVD E;  3U8N A;  5EK4 A;  4Q25 A;  2V1D B;  2LSY A;  4BJM A;  4HWI B;  3RC3 A;  2V7K A;  4EZ4 A;  2BVL A;  3L09 A;  3PUZ F;  5FJV A;  4IE5 A;  3RPU A;  4TWD A;  2PH9 A;  4DUZ T;  2VVS A;  3NWI A;  3U78 A;  5AQN B;  5LP6 E;  4PK5 A;  3GUA A;  4MFR A;  2ZJU A;  4UM3 P;  2VUR A;  3RIA A;  4NPP A;  3LBX A;  4P09 A;  1M7K A;  4PFO A;  3KBU A;  4DBM A;  4ZK4 A;  4DV1 T;  3NKZ A;  4ADZ A;  2H89 A;  2C0S A;  4AQG A;  5FYM A;  4JV5 T;  2XQ7 A;  4JI3 T;  3ZT6 A;  2I0M A;  4AQF A;  2WAU A;  4DMW A;  4B3S T;  2AXD S;  2WBL A;  3ZMZ B;  3U8M A;  2ES0 A;  2KWH A;  3E0Z A;  3RQU A;  5EK2 A;  4AFH A;  4EAH A;  4V1A v;  2Q9Q A;  3GMI A;  3C4Z A;  4WZX A;  4HFI A;  1W09 A;  4OX9 T;  3ZPO A;  2LSK A;  2LSI A;  3CX8 B;  3KIN B;  4UV8 B;  3R84 B;  3ZT7 A;  5F8P A;  5HCM A;  2BKN A;  1XNR T;  3KVB A;  4E7S A;  2NWB A;  4UIG A;  4U31 A;  3WTL A;  3HI2 A;  4H9Q C;  2VK9 A;  2LSG A;  4UR9 A;  4YHH T;  2CM0 A;  3P50 A;  2Q9Q B;  3DJB A;  5LJN A;  4JI8 T;  3T1H T;  3LK2 B;  1HNX T;  3JAF A;  4PIR A;  4TNV A;  4AIS A;  3H3A A;  4U2Z A;  3AEF A;  2DWK A;  1NEN A;  4AKR B;  3C98 B;  2ZJV A;  2ZLY A;  5SYO A;  3P4P A;  2LRK A;  3LFM A;  2IC6 A;  2E5L T;  2LLY A;  2Y54 A;  2DCF A;  3FXD B;  4DBR A;  2YME A;  2N1G A;  5AIN A;  3RH3 A;  4AKH A;  3Q5D A;  2WB5 A;  1QLB A;  3C84 A;  2Y6X A;  4HWF A;  3CX7 B;  4XHE A;  4LMJ A;  4IL9 A;  4HGA A;  2XZ5 A;  2FJB A;  3VU7 H;  2Q9Q D;  4IRE A;  1SA0 E;  1N32 T;  2KLQ A;  3T8O A;  3P4Q A;  2BVM A;  5DQW A;  3RKO A;  2XQY A;  2W67 A;  5ETW A;  4HE8 A;  4DR5 T;  2BR8 A;  4ZS2 A;  2IML A;  2WS3 A;  4J2C A;  4QAB A;  4QX7 B;  5FP3 A;  2WZI A;  5L3C B;  1LVF A;  1HX1 B;  2WZH A;  3RF1 A;  1IBM T;  3AE4 A;  3AA0 B;  2N2N A;  3N2G E;  4X62 T;  5JDF A;  2NW9 A;  2M6I A;  2BYR A;  2UUB T;  1CHU A;  4OHF A;  3RKG A;  4IHJ E;  2VL0 A;  1HG5 A;  3PTR B;  4GK0 E;  1HX8 A;  1MMG A;  5KX5 E;  3AE8 A;  1MNE A;  5JDH A;  2X0L B;  3J7Y q;  5JME A;  2KXP B;  2XQA A;  3CQC B;  3IBP A;  3FBZ A;  4KX6 A;  3EDV A;  3V5S A;  4EED A;  2MAW A;  2LKG A;  2NTX A;  2Y58 A;  4H9R C;  2CE7 A;  2BR7 A;  4ZZB A;  4DR1 T;  4H9S E;  3SQ9 A;  4DR7 T;  3WI3 A;  5HWX A;  2IAK A;  5AQR B;  2KIN B;  2IUB A;  5BMV E;  4GK5 E;  4C90 A;  3ZJ2 A;  3L39 A;  5JQG E;  2NR4 A;  4UV9 B;  3Q5W A;  4UY2 A;  2L8K A;  4ILU A;  3KBT A;  4EOZ B;  1T72 A;  2CLY B;  4EGW A;  3UTK A;  5KMG P;  4P0B A;  4LFB T;  5AFJ A;  5BP0 A;  3U3I A;  1VRB A;  3SFE A;  3VKG A;  2WDR A;  5AQU B;  5LHH B;  1NAF A;  3U8L A;  3Q9D A;  1J1J A;  4DV5 T;  5L47 A;  4L0R A;  2QGS A;  1US7 B;  4XBF B;  4CI2 B;  1XNQ T;  3B5M A;  1WFD A;  3UQ7 A;  2CA5 A;  2HN1 A;  4K0K T;  3PU3 A;  3PUR A;  2LRL A;  3SRZ A;  2H88 A;  2K5B B;  4ASK A;  2JQ9 A;  4IE7 A;  4YFS A;  4O4J E;  4YT0 A;  1MMA A;  2E8I A;  1J5E T;  4AI6 A;  3JAE A;  4LML A;  1UCU A;  4A56 A;  5L3B B;  4TNW A;  2HPL A;  1WLX A;  4EXT A;  5TVC A;  3LBX B;  2XAF B;  2CPT A;  2WNL A;  3PUW F;  3CQG B;  4ERR A;  1E2A A;  3J9X 1;  3K3N A;  1BR2 A;  3S4U A;  2N9D A;  4JI0 T;  3QK6 A;  4QH5 A;  2LKH A;  4YSZ A;  1NWM X;  2VVN A;  2BDE A;  5AQG B;  4UVA B;  3R6N A;  5LG3 A;  3PUQ A;  4GYR A;  1U4Q A;  2XAQ B;  3C64 A;  5DJQ C;  2EHO B;  4ZJT A;  1FIO A;  2XNV A;  3WTI A;  1CUN A;  4A98 A;  3WTH A;  1UX2 A;  2BG9 B;  4UVB B;  3ZJ1 A;  4I55 E;  3N5L A;  4H63 H;  4U7Y A;  4PK6 A;  4DR3 T;  2J1D G;  5AQK B;  1X79 A;  2PFV A;  4X64 T;  1I6Z A;  3SH1 A;  5J2T E;  1W0B A;  5LMU T;  1MIV A;  2V26 A;  5C3J A;  5HWY A;  4YLH A;  2YKS A;  5IUX A;  1YW0 A;  2V5C A;  2NTY A;  2M67 A;  3ZLI A;  4DV7 T;  3RIU A;  3FHN A;  2MYS A;  5IHY A;  3ZCI A;  4AXP A;  2XM2 A;  5LHG B;  3RYI E;  1HG2 A;  3MKD A;  4CXY A;  3MK7 C;  2E5V A;  2FBW A;  1T98 A;  4H9O C;  3AE1 A;  2QYW A;  3KV4 A;  1G8X A;  2EHO A;  3C51 A;  2V5D A;  2WMN A;  2NOX A;  3JCF A;  2BS4 A;  3N2K E;  3FZF B;  1ZV4 X;  4ZI3 D;  2XYT A;  2C5K T;  1FEW A;  2X0Y A;  2YOE A;  3WAK A;  3I9Y A;  5FXV A;  2VL8 A;  5HYA A;  1JNR A;  4AQY T;  3H37 A;  1MND A;  4C91 A;  5GON E;  2V7J A;  1KFY A;  2E2A A;  2VQE T;  4IDO A;  3B13 A;  5JR9 B;  5CFB A;  3WTK A;  3LK4 2;  2XQ3 A;  4NIQ A;  1M62 A;  2WDQ A;  2K9A A;  3NBX X;  4IT4 A;  4ZK1 A;  3BQL A;  4GIW A;  1D1B A;  2V6Y B;  5DAB A;  4CXX A;  2E9X A;  4MHC A;  5EK3 A;  3RYC E;  2QRX A;  4TV8 E;  2FJD A;  3RX6 A;  2DWG A;  3PU8 A;  4HFD A;  3CKD A;  3JAD A;  3K8P C;  4I50 E;  2MOZ A;  4ILA A;  4CN1 A;  1D1A A;  2K3W A;  4UF0 A;  2E9X B;  4OYK A;  5JDL A;  5IWA T;  5J1G A;  2IW5 B;  4UXN B;  1XMO T;  3A8Y C;  2EHO D;  1VCT A;  5LA6 E;  4YY3 T;  1D0X A;  3TLV A;  3ZN0 B;  3TLW A;  2C5J A;  5A1L A;  2DNX A;  4UM3 S;  4U74 A;  2LOS A;  2VKH A;  3O9X A;  2VB6 A;  5BW2 A;  3WTN A;  2KT9 A;  5HEJ A;  2ZM0 A;  1LVK A;  5CB4 E;  1OED C;  2UUA T;  3LK3 B;  2YU1 A;  4TWH A;  4NXN T;  3UU4 A;  3NRX A;  2WSS V;  2GK9 A;  4WW0 A;  2V7M A;  4IGU A;  4YHJ A;  2UXN B;  2FJE A;  5CA0 E;  4PJN A;  4JI1 T;  3WAJ A;  4DR4 T;  4GYS A;  2D5U A;  2X68 A;  4U2Y A;  5HEG A;  3C50 A;  5AFK A;  4CI3 B;  2W2U A;  3C79 A;  4MBQ A;  4U72 A;  3TLU A;  2KWI B;  3CPZ A;  4FI5 A;  3AA1 B;  3K3Q C;  1V9D A;  4WBN E;  1JNZ A;  2J47 A;  3AEC A;  3EAM A;  5HCJ A;  2CMR A;  4QX8 B;  3V5U A;  4ALX A;  5EZY E;  1XZY A;  2WDV A;  2XUE A;  5AQM B;  1ZOY A;  4L5G A;  4PW8 A;  3QC9 A;  4QXB B;  4DV4 T;  3P4R A;  1HNW T;  3M3Z B;  4HWD A;  1MMD A;  5L3G B;  2JIW A;  2OA5 A;  5JDG A;  2ODV A;  3EAB A;  3UUB A;  3DTO A;  3HR0 A;  1VOM A;  1KF6 A;  1QSD A;  5LOV E;  2WU2 A;  2PBI A;  2B1E A;  3WTJ A;  5AQV B;  5ABF B;  1MMN A;  4X20 E;  4HKA A;  3GWH A;  4PFP A;  4F8H A;  1WCR A;  5J5I A;  4WBO A;  2IC9 A;  4BA9 A;  3RC8 A;  2WN9 A;  5HAX A;  2B76 A;  2Y57 A;  2XQ8 A;  2UXX B;  2Y56 A;  3QNU A;  3PJA J;  3PUY F;  2E9X C;  2CRB A;  5AFH A;  5LMN T;  3AEB A;  3AAI A;  5H6R B;  1W0A A;  3U8J A;  3PUS A;  1FMV A;  3ZMV B;  2K48 A;  2DI4 A;  5HXC A;  4PJJ A;  2QVA A;  4UVC B;  3KV5 A;  4HFV A;  4QAA A;  1HTJ F;  2RP4 A;  1S35 A;  4NZB A;  3HKE E;  1I9B A;  4NUU A;  1N34 T;  2JQK A;  3IA3 A;  2LM9 A;  2CXF A;  3FB2 A;  3RYF E;  4TX5 A;  2RA1 A;  3EI0 A;  3PUX F;  2J62 A;  5TAO A;  2K24 A;  4COF A;  4A5X A;  3LG7 A;  3WTM A;  3O1H A;  3MJX A;  1D0Y A;  1B7T A;  4UF0 B;  3CIR A;  2CXD A;  3QUJ A;  3AB3 B;  1MIW A;  4AIU A;  3OYX A;  3OJA A;  3AVR A;  4X65 T;  1HF8 A;  1LRZ A;  3RGL A;  4P1N A;  3SOL A;  5LYJ E;  1WR6 A;  4GKJ T;  2R6G F;  3K1S A;  4ZXL A;  4IST A;  2WM9 A;  2HHH T;  3BK9 A;  3N2O A;  1UX5 A;  2XAJ B;  1GQE A;  2CWY A;  3CML A;  1ZEE A;  3UT5 E;  2CCQ A;  1KEY A;  4G63 A;  4LMK A;  3UUM A;  4JI7 T;  4BAY B;  2BYS A;  4JI6 T;  4B6X A;  3PDY A;  4HFC A;  4H9P C;  2JQH A;  1KNR A;  3IGQ A;  3QB5 K;  4EB6 E;  1UV6 A;  2ACX A;  3OVU A;  1S94 A;  2JQQ A;  2PG8 A;  3ZN1 B;  3UU6 A;  2X67 A;  5JH7 E;  4ZI7 E;  3P8C D;  2W63 A;  2AE9 A;  2LE8 A;  1SE7 A;  3PEO A;  1D1C A;  2CHN A;  2A9U A;  3LJC A;  2V6X A;  1HS7 A;  5AQP B;  5L2L A;  1XDO A;  4LF4 T;  2NP9 A;  1UW6 A;  2X9W A;  4HTE A;  2I59 A;  3O4X E;  2QC1 B;  3UUL A;  2W61 A;  5AFL A;  2V8S V;  3AAA B;  4WNK A;  4AFT A;  2ZMA A;  3SFD A;  2H3R A;  3ZMS B;  1T8B A;  4E7Z A;  3N9Q A;  4H9N C;  1YQ4 A;  3MZK B;  4K0U A;  3HA4 A;  5HXH A;  3CQX C;  3UU8 A;  3C4W A;  2LJL A;  3K3O A;  2PJQ A;  3EVY A;  4IL4 A;  4U3C A;  4EIW A;  5L4E A;  4X66 T;  1OED B;  5JRC B;  2VAS A;  3P4S A;  2X00 A;  4YSY A;  4X1K E;  5JDM A;  2OV9 A;  1OED A;  5L3F B;  4ZI3 C;  4TUY E;  4JI4 T;  5CA1 E;  3ZYL A;  2L3L A;  2XAS B;  2MTQ A;  4MAL A;  2YK0 A;  3PJA A;  1FMW A;  2V7I A;  5LHI B;  4CN6 A;  1L0V A;  2PTF A;  3N9P A;  4UXU A;  4UEM A;  3RLF F;  3UUX B;  3GN5 A;  4LFC T;  3TLT A;  5FL1 A;  3PE0 A;  3U8K A;  3OKQ A;  4O4L E;  3ZYK A;  2BBH A;  4CXW A;  5F5W A;  3M65 A;  2IHR 1;  3RIF A;  5FY7 A;  5AFU L;  4GOU A;  2LSJ A;  3UFE A;  4PAG A;  2HN2 A;  2YMD A;  4DBQ A;  4YJ2 E;  4QKN A;  3ESL A;  4O2B E;  3E22 E;  3AEE A;  3UU3 A;  2WQY A;  3RHW A;  2BZB A;  3PUV F;  4ISS A;  1Z8U A;  5AQJ B;  3RYH E;  1OWA A;  2FUP A;  3BQI A;  2EHO C;  5ABE A;  2KMF A;  2XPK A;  3Q5X A;  2G0U A;  4JEU B;  2W00 A;  3OTO T;  3PUA A;  1BR4 A;  2A2F X;  3QOF A;  5JRE A;  2BKP A;  5C2T A;  3N9O A;  4MLK A;  4ZJS A;  2ZM6 T;  4PJL A;  3P4W A;  3ONX A;  3ZST A;  3HKC E;  3KDS E;  2WY2 A;  4Z8X A;  5FY0 A;  2BJ0 A;  2A3D A;  4DO0 A;  3T4M A;  3ANW A;  3ONJ A;  1OED E;  2WWV A;  2H7O A;  3KV9 A;  3IF8 B;  2W8F A;  3OYZ A;  4Z91 A;  5J2U E;  2CEA A;  3ANW B;  1SUM B;  2BYP A;  3GA8 A;  3MAC A;  4YTM A;  3MA9 A;  1Y01 A;  4QXC B;  5AQT B;  4JBW F;  4FJO A;  3AE6 A;  2WWU A;  4HN9 A;  3PUG A;  4B3T T;  2Y7Y A;  3C4X A;  2XSA A;  4B5D A;  2KND A;  5LBM A;  2XAG B;  3ZDG A;  1IJ6 A;  1KK7 A;  3PV0 F;  1E7P A;  2LHR A;  4LF5 T;  4UM1 A;  4UEL A;  4AKG A;  5CGM A;  4XK9 A;  2MBG A;  4O2A E;  2MPK A;  3VRA A;  5CJ5 A;  3NVO A;  3WIP A;  3B57 A;  2HH7 A;  2CBJ A;  4I4T E;  1IBL T;  4DR2 T;  4KBM B;  5HEU A;  4LF8 T;  3AEA A;  4UM3 A;  5F3J A;  4CQI A;  5JDQ A;  3PMZ A;  3F31 A;  1H7C A;  5L3D B;  3AE5 A;  1WRD A;  5HEH A;  4ANJ A;  4ILC A;  5JDN A;  4GKK T;  4IDN A;  4JI5 T;  4CI1 B;  4B3R T;  2Y48 B;  3O1I A;  5LNK A;  3ZDH A;  3HKD E;  4WYV A;  4TN7 B;  5LBQ B;  2Y8D A;  4YXD A;  1UGO A;  2X9H A;  5HXS A;  3I0O A;  4TWF A;  5H6Q B;  5AQF B;  4IDP A;  4JLE A;  4TZ4 C;  2LOP A;  4JEH B;  3ZSS A;  5BR8 T;  1N33 T;  1EZ3 A;  1YKH B;  3ZCJ A;  3NZP A;  4F6R C;  3IHR A;  3CWZ B;  4HFE A;  3ZC0 A;  3H3M A;  2C5I T;  5JRC A;  5DQV A;  4X1Y E;  1D0Z A;  5FMN A;  5L3E B;  3NZQ A;  5J0Z A;  2JRK A;  3CX6 B;  4XZC A;  1T7S A;  4YTN A;  4IE0 A;  3RIU C;  3SS1 A;  2BKO A;  4PK4 A;  4ZEY A;  4ZI2 D;  1Y64 B;  5J5H A;  3OBV E;  4KMC A;  4O4I E;  2X0H A;  3RRW A;  4DID B;  2DLR A;  2VQF T;  5FXZ A;  2W66 A;  3RRC A;  2OLT A;  4X1I E;  2C9T A;  3FZM B;  2CLY C;  3AAE B;  4IIJ E;  2YIN A;  4I43 B;  1ZKE A;  3I9W A;  2BYN A;  4ZR6 A;  2UZ6 A;  4DMV A;  3ONL C;  4EYU A;  1WYC A;  1IZN B;  3W15 B;  1YKE B;  3L3P A;  3ABV A;  3MXZ A;  4AKL A;  2WU5 A;  4EV6 A;  3UUN A;  4ILB A;  5LGU B;  2YDS A;  5AFM A;  2CHO A;  3SIO A;  4BJN A;  5AQI B;  1E1H B;  5LXB A;  2UXB T;  2CBI A;  4JYA T;  3VKH A;  4ZS3 A;  3TKL B;  3AXJ B;  2XQ9 A;  4DV3 T;  3ZKR A;  3FZH B;  3OPC A;  4IDZ A;  3ETV A;  2ZM2 A;  2XQ6 A;  2XNT A;  1IJ5 A;  5ABH A;  2XTL A;  5M4Y A;  1LKX A;  3JC6 C;  2HPJ A;  2FJA A;  3A5X A;  3HL6 A;  4HWH A;  1HR0 T;  4KI0 F;  3O1J A;  4X5T A;  3F57 A;  2F4V T;  5KDM C;  4YTP A;  3FZK B;  2NW7 A;  2I6H A;  5JR9 A;  5ABG A;  2YEV C;  3KV6 A;  4KHZ F;  1YXR A;  4JI2 T;  5C8Y E;  3I0Q A;  2V6Y A;  1YQ3 A;  2UU9 T;  5LG4 A;  5J5G A;  4ZHQ E;  4ZZC A;  3AVS A;  2W8G A;  3AED A;  4NXM T;  4O4H E;  3X1D A;  2KZ7 B;  3Q2M A;  5AQO B;  3VHL A;  4JUY A;  3VR8 A;  5ABF A;  3VRB A;  4QH4 A;  1SHZ C;  2ACZ A;  1HFA A;  1HCI A;  4PJM A;  2XY8 B;  5AQL B;  5HEO A;  5E0O A;  3RI5 A;  2RPA A;  2L9Q A;  3A7M A;  1KNZ A;  1J5W A;  2E9X D;  1Z0P A;  4YSX A;  3F2E A;  4BFQ A;  1FJG T;  2P9B A;  2M6B A;  4IDQ A;  4U7I A;  5LXT E;  3UU5 A;  1DU2 A;  1X9B A;  2WMO A;  4AKI A;  4DV0 T;  1NEK A;  2YDQ A;  4EZH A;  3AEG A;  1BR0 A;  2YDR A;  3KFW X;  4AQF C;  1YD8 G;  5FNV E;  4HQP A;  2BG9 A;  5FY1 A;  3EDU A;  5LJM A;  5KXJ A;  4YJ3 E;  3AA7 B;  2XJ7 A;  3ZT5 A;  2BS3 A;  2XYS A;  2JPF A;  4LF7 T;  2A72 A; 
#chains in the Genus database with same CATH homology
 3P4W A;  5HEH A;  4AFG A;  4IRE A;  4ILC A;  4IL4 A;  4LMK A;  5L4E A;  4F8H A;  1OED B;  2BJ0 A;  2C9T A;  2BYS A;  4A97 A;  2X00 A;  5HCM A;  3ZDH A;  5J5I A;  5J5G A;  3T4M A;  4UY2 A;  2WN9 A;  1OED A;  4HFC A;  4ZZC A;  2Y57 A;  2BYN A;  5LG3 A;  2XQ8 A;  4ZR6 A;  1OED E;  2UZ6 A;  3EHZ A;  2BR8 A;  2Y56 A;  3WTL A;  5CFB A;  3WTK A;  2W8F A;  5J5F A;  2W8G A;  4QAB A;  2XQ3 A;  4Z91 A;  5L4H A;  3UQ4 A;  4QAC A;  3P50 A;  4QH1 A;  4ZJT A;  3IGQ A;  5AFH A;  2XNV A;  3U8N A;  3WTI A;  4A98 A;  1UV6 A;  3WTH A;  1UX2 A;  4HFB A;  4FRR A;  2BYP A;  2BG9 B;  5AFJ A;  5BP0 A;  4TWF A;  3U8J A;  4ZK1 A;  4UXU A;  5HEG A;  3JAF A;  4PIR A;  4TNV A;  2XNU A;  5AFK A;  4ILB A;  2BYQ A;  3C79 A;  3TLT A;  2WNJ A;  2LM2 A;  3TLS A;  3TLU A;  5FJV A;  3U8K A;  3UU6 A;  5AFM A;  3U8L A;  4QH4 A;  2M6I A;  2BYR A;  4QAA A;  5AFN A;  5L47 A;  2Y7Y A;  3SH1 A;  4TWD A;  3SIO A;  4BQT A;  2PH9 A;  5KE4 A;  4NZB A;  2ZJV A;  3WTO A;  4B5D A;  4HFD A;  5LXB A;  3JAD A;  3RIF A;  1I9B A;  5SYO A;  5HEO A;  3ZDG A;  4D01 A;  4ILA A;  2YKS A;  5IUX A;  3RI5 A;  3EAM A;  3UQ7 A;  5HCJ A;  5AFM B;  3PEO A;  3GUA A;  2YMD A;  2LLY A;  2Y54 A;  2ZJU A;  3RQW A;  4UM3 P;  2VL0 A;  2PGZ A;  4UM1 A;  3RIA A;  2XQ9 A;  2KSR A;  4NPP A;  4ALX A;  4BFQ A;  4DBM A;  4HFE A;  4EZ1 A;  2XZ6 A;  2YME A;  3EI0 A;  2M6B A;  3LSV A;  3ZKR A;  4ZK4 A;  1UW6 A;  5CO5 A;  4XK9 A;  3UU5 A;  4COF A;  4ZRU A;  5AIN A;  2BG9 C;  2YN6 A;  3WIP A;  3TLV A;  5JME A;  3WTM A;  4HFH A;  3TLW A;  3UU3 A;  2XQA A;  3JAE A;  4LML A;  4UM3 S;  3RHW A;  3C84 A;  2QC1 B;  2XQ6 A;  2XNT A;  2XQ4 A;  2XQ7 A;  5AFL A;  4TNW A;  5J0Z A;  4AFT A;  5HEU A;  2WNC A;  5BW2 A;  5TVC A;  3WTN A;  2MAW A;  2WNL A;  2LKG A;  5HEJ A;  2X00 D;  4XHE A;  3UUB A;  5BRX A;  2Y58 A;  4LMJ A;  3U8M A;  4Z90 A;  3RQU A;  5J5H A;  2BR7 A;  4HQP A;  4AFH A;  2BG9 A;  4UM3 A;  1OED C;  4ZZB A;  4IL9 A;  4X5T A;  5KZU A;  2XQ5 A;  4WV9 A;  2XZ5 A;  3UU8 A;  2BG9 E;  3SQ9 A;  2XYT A;  4QH5 A;  3SQ6 A;  2WZY A;  3PMZ A;  2LKH A;  4TWH A;  4HFI A;  4ZJS A;  2XYS A;  2YOE A;  3WTJ A;  3UU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...