2BG9C

Refined structure of the nicotinic acetylcholine receptor at 4a resolution.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
369
structure length
369
Chain Sequence
VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISILRLRPELIWIPDIVLQNNNDGQYNVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEISMDLIIDPEAFTENGEWEIIHKPAKKNIYGDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLISFLAALAFYLPAESGEKMSTAICVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVVVNCGIVLNFHFRTPSTHSGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNRPPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Refined Structure of the Nicotinic Acetylcholine Receptor at 4A Resolution
pubmed doi rcsb
molecule tags Ion channel/receptor
total genus 83
structure length 369
sequence length 369
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
C PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2bg9C02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bg9C01
3TLUA 4UM1A 4WV9A 3JAFA 2XNTA 5SYOA 5IUXA 3WTJA 2BG9E 2XQ9A 2BYQA 2BG9B 3RIAA 3WTMA 4NPPA 2XZ5A 2BYNA 4AFTA 4HFCA 4QAAA 4UXUA 3RIFA 5KE4A 5HEHA 2UZ6A 4ILCA 3U8JA 2Y7YA 1UW6A 3RQUA 4HFBA 4HQPA 4ALXA 5AFNA 3EI0A 4IREA 3UU3A 2W8FA 3SIOA 4ILAA 1OEDE 5HEJA 3C84A 4ILBA 2VL0A 2LKHA 4AFGA 2BG9A 2X00A 4XHEA 4Z91A 3WTIA 2LLYA 4ZJSA 4QABA 4ZK1A 4ZR6A 3WTNA 2KSRA 4BQTA 4NZBA 4TWHA 3UU8A 5J0ZA 4ZZCA 3WIPA 5AFLA 2XYSA 1OEDA 3WTKA 4UY2A 3EAMA 5BP0A 3LSVA 2XQ3A 2WNCA 3T4MA 5AFMB 2BG9C 2Y56A 4HFHA 3U8LA 3SH1A 2M6IA 2WZYA 3ZKRA 2XQ5A 4ZJTA 2XQ8A 2M6BA 4LMJA 3TLSA 2XYTA 5CO5A 4LMKA 2LKGA 2PGZA 3TLWA 5TVCA 4A97A 4UM3P 4AFHA 3C79A 1UV6A 3SQ9A 1OEDC 4DBMA 5HCMA 3WTHA 5HEUA 2YMDA 2ZJUA 4QH1A 3UUBA 3JAEA 1I9BA 2XNVA 5FJVA 4QH4A 3ZDGA 3EHZA 4TWDA 4ZRUA 4TNWA 3WTLA 4UM3S 4HFEA 2BYRA 3PMZA 3TLTA 5J5GA 4FRRA 3JADA 4BFQA 2XQ4A 4HFDA 2BJ0A 3UQ7A 4QH5A 4Z90A 3U8NA 2YN6A 2W8GA 3RQWA 4TWFA 1UX2A 5L47A 4F8HA 2WN9A 2LM2A 4QACA 4IL4A 5LG3A 2Y57A 4A98A 4PIRA 5L4EA 2YKSA 2XQ6A 3TLVA 3PEOA 2Y54A 5L4HA 2BYSA 3U8MA 2Y58A 2XQAA 2BR7A 2BR8A 3ZDHA 5AFMA 3UU4A 5LXBA 3P50A 2BYPA 2PH9A 4UM3A 3GUAA 5AFJA 5BW2A 2XZ6A 2ZJVA 3U8KA 3IGQA 3RHWA 5AFKA 3UU5A 2YOEA 3SQ6A 2MAWA 5JMEA 4ZZBA 4EZ1A 4X5TA 3UQ4A 4D01A 4HFIA 3WTOA 5AFHA 5KZUA 1OEDB 5CFBA 2XNUA 5BRXA 4LMLA 5AINA 2QC1B 5HEOA 2WNLA 4B5DA 5J5IA 3RI5A 2XQ7A 4IL9A 3P4WA 3UU6A 4ZK4A 2YMEA 5HEGA 2X00D 4COFA 5J5FA 4TNVA 5HCJA 2C9TA 4XK9A 2WNJA 5J5HA
chains in the Genus database with same CATH superfamily
1WRDA 3JAFA 2BKNA 4UV8B 4YTNA 5KE4A 4UXNB 3U8JA 3PE0A 5HXCA 5LHIB 1XDOA 3AE4A 4PK5A 3ZMZB 3ZYKA 3N9NA 2VL0A 4EXTA 3SFDA 4AIUA 2LHRA 4UELA 3AECA 2KLQA 4BQTA 1I94T 3CX8B 3ETVA 3PU8A 3RH3A 2M6IA 2WP9A 3P4QA 2CWYA 1N34T 2QA7A 4LF9T 2A9UA 1UGOA 4AFHA 3C79A 4YXDA 4X66T 2CHOA 2BBHA 2XNVA 4ZRUA 4CXWA 4O4HE 3LJCA 3JADA 4YTMA 1D1AA 1LRZA 1QSDA 3ZMSB 2BDEA 4DIDB 2M67A 5LG4A 2DLRA 4QACA 3LK3B 4A98A 2YKSA 2XQ6A 3TLVA 4MLKA 2BVMA 4U31A 3FHNA 1N36T 4NUUA 2BBJA 2NR4A 5AFMA 4L5GA 4DMVA 3RHWA 2YOEA 2V7MA 2WU5A 3K3NA 4I43B 2L8KA 5LCYA 2W0GA 4U3CA 5HEOA 2V7IA 4IDOA 2LSJA 2V7KA 4JYAT 4IE6A 4O4IE 5LHHB 5IUXA 3T8OA 1XDPA 4NPPA 1XNRT 2LE8A 4JEHB 4UF0A 5GONE 4HFBA 4CXYA 4ALXA 2JRKA 3PJAA 2IW5B 3DJBA 4DUYT 3FZKB 4DNDA 4WNKA 1S94A 4DO0A 5DJQC 2DI4A 5LXTE 1T72A 1O3XA 2X68A 3UU8A 2PBIA 5AQHB 3LSVA 3LBXB 5HWXA 4I55E 3FBZA 2BS4A 2CEAA 2ES0A 5HWYA 3AE3A 5CA1E 3UFGA 1XZYA 2A2FX 4PK6A 2W63A 3JAEA 4GOUA 5AQGB 2J62A 1Y01A 1CHUA 3DP7A 4YSYA 1KNRA 2BYRA 4UIGA 4HFDA 1MIWA 2CLYB 2BJ0A 2JQKA 4EYYR 2D9DA 3ZJ1A 4KHZF 5L4HA 3AEBA 3U8MA 3AEAA 2IHR1 2VURA 5LXBA 1BR4A 4H63H 2BS3A 5AFKA 3VKHA 4LFAT 4AQGA 2N9DA 3W15B 3HL6A 3P4WA 4ZK4A 2VQFT 2X00D 2C5JA 2C5KT 3N9QA 2V5DA 5LGUB 3L09A 5FY1A 2HH7A 3GN5B 4H9OC 5AFUL 3VU7H 3N2GE 2BYNA 2YDSA 3AVSA 2CXLA 2V26A 5AQJB 1MNDA 3I0OA 4IDPA 3HA4A 3C84A 3KV5A 4WYVA 5L3DB 3VHLA 3IF8B 4ZK1A 4ZR6A 2WZIA 1MMGA 1WR0A 5J0ZA 3CQCB 3LK42 1MIVA 2WDQA 2XAQB 4DV0T 4HFHA 5LNKA 2Y56A 4JI3T 4ILUA 2M6BA 2IDOB 2WSSV 5HCMA 2NTXA 4BJNA 3HKCE 4KX6A 4GYRA 2L3LA 4YJ3E 4UVCB 3EDVA 3BK9A 3SFEA 3RGLA 5FYMA 2R6GF 1UUSA 3PEOA 3P4PA 5BR8T 2OA5A 3RYIE 5L3GB 2Y58A 3N9PA 3T1YT 2PTFA 2PH9A 2LEHA 3P7IA 4XBFB 2WZHA 2ZM2A 4D01A 3EVYA 3WTOA 3ZN0B 1IAPA 1NWMX 3AXJA 4IGUA 2XAJB 4EGWA 4DV1T 4HEAA 4NXNT 5J5HA 4DR3T 5SYOA 1WYCA 4PJJA 4JUYA 3C4WA 3E22E 2D0UA 3UFEA 4EAHA 3GA8A 4H63V 5L3EB 4ZI2D 4B6XA 4X65T 3C50A 4X20E 4OYKA 4ZS3A 2W4XA 2LRKA 3R6NA 2LOSA 5LHGB 3AAIA 3ZPOA 2LHNA 2K3WA 5AQSB 1YQ4A 2EHOB 2XAGB 3AAAB 3FXEB 2E5LT 5ABGA 3FZHB 3P8CD 2P9BA 4JI2T 2WS3A 2XQ4A 4Z90A 4FI5A 4DV6T 4AQFA 3CQXC 2F4VT 3GWHA 2KXPB 3KFWX 3LFMA 2X51A 3VR9A 3FXDB 4JLEA 4A5XA 4P0BA 4PJLA 3ZJ2A 3JCFA 3ZDHA 2BYPA 2XUEA 3FZMB 1I6ZA 3IGQA 3N2OA 4JI8T 2N1GA 3SQ6A 3CWZB 5J2TE 3A8YC 1OEDB 5J5IA 5AINA 1OWAA 4B5DA 1YKHB 2XQ7A 2Q9QB 2X0HA 2YMEA 2DHRA 1BR1A 5E0OA 2QGSA 4DR6T 5HAXA 3AE1A 3AE8A 1MMDA 4ILCA 2XSBA 1UK5A 4HQPA 2K24A 3UU3A 2Y8DA 4WW0A 3OVUA 2LKHA 5AQKB 4ERRA 4AXPA 4OK0A 2D2SA 3IBPA 3PJAJ 5CB4E 5JRCB 3ZEFB 1B7TA 1XMOT 3ZCIA 3EAMA 4HWCA 3IHRA 2V7JA 2XQ5A 3LDQB 2FJAA 5JR9C 3AE9A 4A97A 4DR1T 3SQ9A 2X9YA 1OXZA 4DBQA 4QH1A 4G2AA 2OV9A 5ETWA 3QNUA 3QOFA 4TWFA 4WBNE 3ONXA 4ZEYA 3KV6A 4YJ2E 4X64T 2NW9A 3CVRA 4F6RC 5FP3A 4NUVA 1LVFA 4JI1T 3AXJB 3C51A 3KINB 3I9WA 3LBXA 3P50A 4AI6A 1DU2A 3F57A 4PJMA 1FJGT 1G8XA 5JMEA 4DV7T 4ZI2C 4HFIA 4LF7T 3EABA 4X1KE 2WB5A 2E8IA 4WV9A 3AE2A 1CUNA 5AQOB 3UUMA 3CIRA 3ZN1B 2VKDA 1J1JA 2WQYA 3PUWF 4CI1B 5HXHA 5CJ5A 2H88A 3OBVE 4GKJT 3AEGA 4JI0T 2CBIA 2CRBA 4HWIB 2I6HA 4DMWA 1W0BA 1AJ3A 1H7CA 4MALA 2HN2A 4K0UA 5H6RB 4OFZA 4UEMA 3SRZA 4I50E 2ZM8A 1U4QA 3EDUA 3ABVA 2CXDA 5JDHA 2VKOA 5AQFB 3GN5A 3RKGA 5LB7B 5DQWA 4QH4A 5LA6E 4BA9A 4FRRA 3BQIA 5AQQB 2X9HA 2XM2A 5JREA 4YT0A 2H89A 1HNXT 2LM2A 2XASB 2K48A 2V6XA 1GQEA 1IJ6A 4AKGA 4P0AA 2CPTA 3AVRA 3PUXF 2W67A 4LFBT 2XSAA 2C5IT 2G0UA 3UQ4A 1J5ET 2UXXB 4U2YA 3UU6A 2V6YA 2GK9A 2IIUA 5J5FA 1LVKA 4TNVA 5ADXL 5FMNA 1T98A 2CHNA 2CBJA 3TLUA 3PUYF 1WCRA 3PU3A 4C90A 2RA1A 2Y7YA 2CMRA 2LJLA 4TN7B 2CE7A 3NRXA 5LGTB 4AFGA 2Y48B 2IMLA 4Z91A 3VRBA 5JDLA 5L2LA 4EZHA 3KVBA 4O8SA 3RRWA 1EZ3A 2WZYA 5AQMB 4ZJTA 3OYZA 4HWDA 1BR2A 4HWFA 2IUBA 3UUBA 4U33A 3I1AA 1W0AA 4QWNB 3O9XA 5LGNB 3U8NA 2W62A 3RQWA 4TUYE 4JI5T 3RPUA 4H9NC 1S35A 2ACXA 4AQFC 2NWBA 3RIUA 1IJ5A 2EHOA 2JPFA 2CXFA 4X1YE 5KXJA 3AAEB 2WAUA 5BRXA 4LMLA 4O2BE 3AA1B 4QXBB 3K3QC 1VOMA 2LRLA 2C0SA 2ZM0A 4AKIA 2BYQA 5AQRB 2UZ6A 1OEDE 3AE6A 2I59A 3AEDA 5ABEA 3OYXA 3ZC1A 3OTOT 1UCUA 1OEDA 4PAGA 4UY2A 5BP0A 3AE7A 2X66A 1E1HB 3T4MA 2Q9QA 4N78D 3PTRB 4CXXA 2NP9A 1N32T 2NW8A 5CO5A 5EK4A 2FJBA 2J47A 4B3ST 1MMNA 4UM3S 2KNDA 4HFEA 3TLTA 1KEYA 3QK6A 5L3FB 5M4YA 4YFSA 2E9XB 2B1EA 5AQLB 2UUCT 1VRBA 4NXMT 1X9BA 4IE7A 3EUHA 5FKYA 5FVKA 4IL4A 3MJXA 5JRCA 4EEDA 1HNZT 3F31A 2UU9T 4QXCB 1IBKT 4I0UA 2V6YB 2NTYA 3K3OA 2Z6EA 1T8BA 4UVBB 1MIYA 2W61A 5KZUA 5JDQA 5CFBA 2WCAA 3C4XA 2MPKA 5JDFA 3ZLIA 2HPLA 5JVDE 5EK2A 4JI7T 2VKJA 3P4SA 4M1PA 3SWHA 4ZHQE 2XY8B 2XQ9A 3RIAA 4GIWA 2XZEA 5ABFB 2H7OA 4U2ZA 2H7VC 3N9LA 4BJMA 4L9IA 3EI0A 2X9XA 2CLYC 1SE7A 3HR0A 5KMGP 1D0YA 4XHEA 4QHOA 2V1DB 4IT4A 4MBQA 2EHOD 2XAHB 4GYSA 4ZZCA 4A56A 3KDSE 4PFOA 2WNCA 2XQ3A 3KV9A 3K1SA 5LBMA 2XYTA 2ODUA 5AQPB 2LKGA 5IYZE 2XAFB 3E0ZA 3MXZA 3RYCE 4DR7T 1BR0A 2I0MA 4DBMA 4JV5T 1US7B 1I9BA 5FJVA 4CZZB 3AA7B 3N9OA 3NZPA 3U78A 2BZBA 2A3DA 3WTLA 3ZCJA 3PMZA 4LF6T 4YHJA 5FNVE 1D0XA 4B3TT 3ESLA 3T1HT 4ANJA 3BQKA 4QKNA 3MZKB 3PUVF 1XNQT 3V5UA 3CMLA 4H9PC 3ONJA 2MTQA 4MFRA 1IBMT 4GK0E 5AFJA 3GUAA 2MYSA 2Q9QD 2ACZA 3UU5A 4LF5T 3RYHE 4UV9B 3N5LA 2DWKA 1ZOYA 2WNLA 2JMHA 5HEGA 3SOLA 3ANWB 3E08A 2JIWA 1QLBA 2XNTA 2WU2A 5LMNT 3I0QA 2XZ5A 2FJEA 1UW6A 4EEBA 3Q5WA 2WWVA 2H3RA 2RPAA 2UXBT 3A7MA 3RLFF 4IHJE 1R8IA 2MBGA 3VR8A 4QXHB 4KMCA 3ZYLA 3AA0B 2KINB 2LLYA 3U3IA 4O2AE 2IC9A 2XYSA 2BKPA 3WAKA 3H37A 5FY0A 2W66A 3AEFA 4B3MT 4IDQA 5AQUB 3AE5A 5KDMC 4TZ4C 3TLSA 3DTOA 3HKBE 3TLWA 4UM3P 3C4ZA 1UV6A 4KI0F 4CN4A 1HF8A 3CK6A 3ZSTA 2JQ9A 1Z0PA 2ZMAA 3O1IA 2BVLA 2JQHA 3AB3B 3IEEA 4KP3C 4E7ZA 3NZQA 1FEWA 3ONLC 3UUNA 2BR7A 1YKEB 3M3ZB 2XZ6A 1D1BA 2NOXA 3U8KA 2LOPA 5IHYA 4EZ1A 4WBOA 1FIOA 4DR4T 1NENA 1W09A 2VWAA 3L8RA 2EHOC 3NBXX 4YLHA 5HCJA 3ZYMA 5LP6E 2C9TA 2XM1A 2WNJA 3Q2MA 4XZCA 3FZLB 2JMKA 4AFTA 5HXRA 4ISTA 3RQUA 4AKLA 4OHFA 2IAKA 3X1DA 4ZI3D 1UX4A 4DBRA 5H6QB 4Q25A 4PK4A 1FMVA 3WTNA 5HYAA 4NZBA 3RC3A 4KUMB 2JJ9A 2XQYA 3RF1A 4DR5T 2WMOA 2B76A 4CN6A 2CWOA 3CX7B 3F2EA 3K8PC 3CPZA 2ZLYA 4LMKA 5ABHA 3WI3A 1OEDC 2QYWA 2Q9QC 5LJMA 4C91A 2CM0A 4TWDA 2L9QA 5L3BB 1M7KA 5F5WA 3N2KE 5IWAT 1UX2A 5L47A 3V5SA 1UX5A 3Q9DA 2WMNA 1KFYA 1IZNB 4B3RT 2Y57A 4PIRA 5BMVE 1WFDA 5JQGE 4XAXB 2XQAA 3QB5A 4L0RA 5LYJE 4DR2T 5BW2A 2DNXA 3B5MA 2WDRA 3ETUA 2RP4A 3CKDA 3KVAA 3MA9A 3RI5A 2SPCA 5LBQB 3BQLA 4COFA 2X0LB 3MKDA 5EK3A 2E9XA 3WTJA 2HHHT 2X9WA 3HI2A 4HFCA 4UXUA 3H3MA 4HN9A 4EV6A 5FXWA 4IREA 1HNWT 2W8FA 4ILAA 4DV5T 4TV8E 2VB6A 4X62T 4DV2T 1HCIA 2X00A 1D0ZA 3PURA 2KWHA 1KNPA 4DV3T 4KHPT 4U74A 3JC6C 3WIPA 3ZMTB 1HG2A 3ZMVB 3U8LA 1NEKA 2K5BB 4BAYB 2HN1A 2LSKA 4WZXA 4QX8B 4HGAA 3J7Yq 2PGZA 4J2CA 2JQQA 2AXDS 2XTLA 1IBLT 3UUXB 5AQTB 2YDQA 2WY2A 5ABFA 2ZJUA 4H9RC 1HS7A 4IDZA 3KBUA 2FBWA 3EHZA 5LOVE 4BFQA 4TV9E 3ZSSA 2UXNB 2WN9A 3C64A 5CGMA 3FB2A 5FXZA 3FZFB 4LF4T 2VL8A 3UU4A 2PFVA 2ZJVA 1XMQT 4ZI3C 3MACA 2QVAA 2FUPA 4IL9A 2AE9A 5DQVA 2UXCT 4CN1A 3NRYA 4YY3T 5JDNA 1WYBA 2ODVA 5LJNA 4UM1A 5JR9A 2X67A 5J2UE 4H9SE 4HFVA 2BG9E 1KK7A 4UR9A 3A5XA 1HTJF 1Z8UA 1WLXA 4G63A 4H9QC 4IIJE 2BG9A 4ZS2A 3B57A 4ZJSA 5TAOA 1ZEEA 4ZXLA 5JDMA 1SA0E 1YD8G 3G06A 4P1NA 4FJOA 4GK5E 2KMFA 4ADZA 5HXSA 1JNRA 3PUAA 1HX8A 1VCSA 3ANWA 4LMJA 3H3AA 4PW8A 3QUJA 1ZKEA 3OKQA 2DWGA 2E9XD 3WAJA 5FL0A 1UURA 5J5GA 3O4XE 5HXEA 2VASA 5KX5E 3CQGB 3NWIA 4I4TE 3MK7C 4AISA 5LG3A 4NIQA 4O4LE 2FJDA 2BYSA 5DABA 2N2NA 2BR8A 4UM3A 4LFCT 2LSGA 5F3JA 5AFHA 2QC1B 2K9AA 3Q5DA 2VKHA 5EZYE 4AQYT 4EOZB 2PJQA 3VRAA 4EB6E 4OYJA 5FXXA 3ZMUB 5A1LA 3IA3A 3O1HA 3WTMA 4HKAA 4QAAA 2VVNA 5HEHA 3Q5EA 1U5PA 2W2UA 3SIOA 2VVSA 2UXDT 4PNIA 4O4JE 3PUSA 4AKRB 1YW0A 1NAFA 4U7YA 2IC6A 3Q5XA 1WR6A 2UUAT 4IE5A 1HX1B 5AFLA 2LT3A 3FBLA 5AFMB 1HFAA 4V1Av 2XQ8A 4K0KT 5F8PA 1VCTA 4IDNA 2ZM6T 2D0TA 2LSIA 4ISSA 2KZ7B 1ZP0A 3VKGA 4QX7B 4TNWA 4TX5A 2W8GA 4U72A 2DL1A 4F8HA 3SS1A 2LM9A 4JI6T 5JDGA 4MHCA 4UF0B 2YINA 5L4EA 1Y64B 3D0TA 2MOZA 4CI2B 3P4RA 3NVOA 3TKLB 1E2AA 5FVLA 1XWMA 4DVDA 4CI3B 3PV0F 3OJAA 2NW7A 5LMUT 5JR9B 2MAWA 2CCQA 3PDYA 5C2TA 3N9MA 3CX6B 5FY7A 1W9RA 3UULA 4EZ4A 2YU2A 1ZHCA 1KF6A 2BG9B 4DUZT 4X1IE 1SUMB 1N33T 5AFNA 2E9XC 3OPCA 4ILBA 4YSZA 4U7IA 3WTIA 4P09A 4QABA 2WWUA 2KSRA 2DCFA 4Z8XA 4HTEA 3RRCA 3ZC0A 5JH7E 1MNEA 2PG8A 5C3JA 3SH1A 3LK2B 4DV4T 3GMIA 3ZT6A 4EIWA 3KBTA 3S4UA 3NKZA 2KWIB 3AA6B 1SHZC 3QC9A 3PUZF 4JI4T 2YMDA 1QUUA 4IE4A 4CQIA 3AEEA 2WBLA 4PJNA 1J5WA 1X79A 3C98B 1G73A 2YN6A 1YQ3A 2XPKA 4PFPA 1LKXA 3KV4A 1HG5A 2Y6XA 2Y54A 2YDRA 3RC8A 1L0VA 3L3PA 1T7SA 2CA5A 5FL1A 2X0YA 3UT5E 4ASKA 2BS2A 2D5UA 2OLTA 4X5TA 3JC6D 5FXVA 4OX9T 5AQVB 3QB5K 3HKEE 3B13A 4HE8A 1E7PA 2WDVA 4GKKT 2UUBT 1YXRA 2E5VA 4IE0A 3RX6A 4LF8T 2A72A 3RIFA 2V7LA 4UVAB 5JTGA 2QRXA 1KNZA 2YU1A 3RKOA 5HEJA 3L39A 3RIUC 2V5CA 2YEVC 4EYUA 1HR0T 2KT9A 4JBWF 5J1GA 3UTKA 4YTPA 4TWHA 2WM9A 3WTKA 3I9YA 2BG9C 2XJ7A 3HKDE 3LG7A 3ZT5A 3ZKRA 3J9X1 5TVCA 3R84B 3WTHA 4HWHA 5HEUA 2HPJA 1ZV4X 2V8SV 3ZDGA 3PUQA 5L3CB 2BKOA 2VK9A 3UQ7A 4QH5A 2J4GA 5AQIB 2W00A 4ZI7E 1FMWA 3O1JA 4JEUB 2LSYA 2XHEB 2E2AA 4E7SA 2J1DG 5CA0E 4AKHA 1D1CA 1M62A 2YK0A 4ZZBA 4YSXA 1JNZA 4YHHT 2XNUA 2VQET 4KBMB 1V9DA 3ZT7A 3PUGA 1MMAA 4ZOLE 3RYFE 4XK9A 3M65A 5C8YE 5AQNB
chains in the Genus database with same CATH topology
3TLUA 4UM1A 4WV9A 3JAFA 2XNTA 5SYOA 5IUXA 3WTJA 2BG9E 2XQ9A 2BYQA 2BG9B 3RIAA 3WTMA 4NPPA 2XZ5A 2BYNA 4AFTA 4HFCA 4QAAA 4UXUA 3RIFA 5KE4A 5HEHA 2UZ6A 4ILCA 3U8JA 2Y7YA 1UW6A 3RQUA 4HFBA 4HQPA 4ALXA 5AFNA 3EI0A 4IREA 3UU3A 2W8FA 3SIOA 4ILAA 1OEDE 5HEJA 3C84A 4ILBA 2VL0A 2LKHA 4AFGA 2BG9A 2X00A 4XHEA 4Z91A 3WTIA 2LLYA 4ZJSA 4QABA 4ZK1A 4ZR6A 3WTNA 2KSRA 4BQTA 4NZBA 4TWHA 3UU8A 5J0ZA 4ZZCA 3WIPA 5AFLA 2XYSA 1OEDA 3WTKA 4UY2A 3EAMA 5BP0A 3LSVA 2XQ3A 2WNCA 3T4MA 5AFMB 2BG9C 2Y56A 4HFHA 3U8LA 3SH1A 2M6IA 2WZYA 3ZKRA 2XQ5A 4ZJTA 2XQ8A 2M6BA 4LMJA 3TLSA 2XYTA 5CO5A 4LMKA 2LKGA 2PGZA 3TLWA 5TVCA 4A97A 4UM3P 4AFHA 3C79A 1UV6A 3SQ9A 1OEDC 4DBMA 5HCMA 3WTHA 5HEUA 2YMDA 2ZJUA 4QH1A 3UUBA 3JAEA 1I9BA 2XNVA 5FJVA 4QH4A 3ZDGA 3EHZA 4TWDA 4ZRUA 4TNWA 3WTLA 4UM3S 4HFEA 2BYRA 3PMZA 3TLTA 5J5GA 4FRRA 3JADA 4BFQA 2XQ4A 4HFDA 2BJ0A 3UQ7A 4QH5A 4Z90A 3U8NA 2YN6A 2W8GA 3RQWA 4TWFA 1UX2A 5L47A 4F8HA 2WN9A 2LM2A 4QACA 4IL4A 5LG3A 2Y57A 4A98A 4PIRA 5L4EA 2YKSA 2XQ6A 3TLVA 3PEOA 2Y54A 5L4HA 2BYSA 3U8MA 2Y58A 2XQAA 2BR7A 2BR8A 3ZDHA 5AFMA 3UU4A 5LXBA 3P50A 2BYPA 2PH9A 4UM3A 3GUAA 5AFJA 5BW2A 2XZ6A 2ZJVA 3U8KA 3IGQA 3RHWA 5AFKA 3UU5A 2YOEA 3SQ6A 2MAWA 5JMEA 4ZZBA 4EZ1A 4X5TA 3UQ4A 4D01A 4HFIA 3WTOA 5AFHA 5KZUA 1OEDB 5CFBA 2XNUA 5BRXA 4LMLA 5AINA 2QC1B 5HEOA 2WNLA 4B5DA 5J5IA 3RI5A 2XQ7A 4IL9A 3P4WA 3UU6A 4ZK4A 2YMEA 5HEGA 2X00D 4COFA 5J5FA 4TNVA 5HCJA 2C9TA 4XK9A 2WNJA 5J5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLU A;  4UM1 A;  4WV9 A;  3JAF A;  2XNT A;  5SYO A;  5IUX A;  3WTJ A;  2BG9 E;  2XQ9 A;  2BYQ A;  2BG9 B;  3RIA A;  3WTM A;  4NPP A;  2XZ5 A;  2BYN A;  4AFT A;  4HFC A;  4QAA A;  4UXU A;  3RIF A;  5KE4 A;  5HEH A;  2UZ6 A;  4ILC A;  3U8J A;  2Y7Y A;  1UW6 A;  3RQU A;  4HFB A;  4HQP A;  4ALX A;  5AFN A;  3EI0 A;  4IRE A;  3UU3 A;  2W8F A;  3SIO A;  4ILA A;  1OED E;  5HEJ A;  3C84 A;  4ILB A;  2VL0 A;  2LKH A;  4AFG A;  2BG9 A;  2X00 A;  4XHE A;  4Z91 A;  3WTI A;  2LLY A;  4ZJS A;  4QAB A;  4ZK1 A;  4ZR6 A;  3WTN A;  2KSR A;  4BQT A;  4NZB A;  4TWH A;  3UU8 A;  5J0Z A;  4ZZC A;  3WIP A;  5AFL A;  2XYS A;  1OED A;  3WTK A;  4UY2 A;  3EAM A;  5BP0 A;  3LSV A;  2XQ3 A;  2WNC A;  3T4M A;  5AFM B;  2BG9 C;  2Y56 A;  4HFH A;  3U8L A;  3SH1 A;  2M6I A;  2WZY A;  3ZKR A;  2XQ5 A;  4ZJT A;  2XQ8 A;  2M6B A;  4LMJ A;  3TLS A;  2XYT A;  5CO5 A;  4LMK A;  2LKG A;  2PGZ A;  3TLW A;  5TVC A;  4A97 A;  4UM3 P;  4AFH A;  3C79 A;  1UV6 A;  3SQ9 A;  1OED C;  4DBM A;  5HCM A;  3WTH A;  5HEU A;  2YMD A;  2ZJU A;  4QH1 A;  3UUB A;  3JAE A;  1I9B A;  2XNV A;  5FJV A;  4QH4 A;  3ZDG A;  3EHZ A;  4TWD A;  4ZRU A;  4TNW A;  3WTL A;  4UM3 S;  4HFE A;  2BYR A;  3PMZ A;  3TLT A;  5J5G A;  4FRR A;  3JAD A;  4BFQ A;  2XQ4 A;  4HFD A;  2BJ0 A;  3UQ7 A;  4QH5 A;  4Z90 A;  3U8N A;  2YN6 A;  2W8G A;  3RQW A;  4TWF A;  1UX2 A;  5L47 A;  4F8H A;  2WN9 A;  2LM2 A;  4QAC A;  4IL4 A;  5LG3 A;  2Y57 A;  4A98 A;  4PIR A;  5L4E A;  2YKS A;  2XQ6 A;  3TLV A;  3PEO A;  2Y54 A;  5L4H A;  2BYS A;  3U8M A;  2Y58 A;  2XQA A;  2BR7 A;  2BR8 A;  3ZDH A;  5AFM A;  3UU4 A;  5LXB A;  3P50 A;  2BYP A;  2PH9 A;  4UM3 A;  3GUA A;  5AFJ A;  5BW2 A;  2XZ6 A;  2ZJV A;  3U8K A;  3IGQ A;  3RHW A;  5AFK A;  3UU5 A;  2YOE A;  3SQ6 A;  2MAW A;  5JME A;  4ZZB A;  4EZ1 A;  4X5T A;  3UQ4 A;  4D01 A;  4HFI A;  3WTO A;  5AFH A;  5KZU A;  1OED B;  5CFB A;  2XNU A;  5BRX A;  4LML A;  5AIN A;  2QC1 B;  5HEO A;  2WNL A;  4B5D A;  5J5I A;  3RI5 A;  2XQ7 A;  4IL9 A;  3P4W A;  3UU6 A;  4ZK4 A;  2YME A;  5HEG A;  2X00 D;  4COF A;  5J5F A;  4TNV A;  5HCJ A;  2C9T A;  4XK9 A;  2WNJ A;  5J5H A; 
#chains in the Genus database with same CATH topology
 1WRD A;  3JAF A;  2BKN A;  4UV8 B;  4YTN A;  5KE4 A;  4UXN B;  3U8J A;  3PE0 A;  5HXC A;  5LHI B;  1XDO A;  3AE4 A;  4PK5 A;  3ZMZ B;  3ZYK A;  3N9N A;  2VL0 A;  4EXT A;  3SFD A;  4AIU A;  2LHR A;  4UEL A;  3AEC A;  2KLQ A;  4BQT A;  1I94 T;  3CX8 B;  3ETV A;  3PU8 A;  3RH3 A;  2M6I A;  2WP9 A;  3P4Q A;  2CWY A;  1N34 T;  2QA7 A;  4LF9 T;  2A9U A;  1UGO A;  4AFH A;  3C79 A;  4YXD A;  4X66 T;  2CHO A;  2BBH A;  2XNV A;  4ZRU A;  4CXW A;  4O4H E;  3LJC A;  3JAD A;  4YTM A;  1D1A A;  1LRZ A;  1QSD A;  3ZMS B;  2BDE A;  4DID B;  2M67 A;  5LG4 A;  2DLR A;  4QAC A;  3LK3 B;  4A98 A;  2YKS A;  2XQ6 A;  3TLV A;  4MLK A;  2BVM A;  4U31 A;  3FHN A;  1N36 T;  4NUU A;  2BBJ A;  2NR4 A;  5AFM A;  4L5G A;  4DMV A;  3RHW A;  2YOE A;  2V7M A;  2WU5 A;  3K3N A;  4I43 B;  2L8K A;  5LCY A;  2W0G A;  4U3C A;  5HEO A;  2V7I A;  4IDO A;  2LSJ A;  2V7K A;  4JYA T;  4IE6 A;  4O4I E;  5LHH B;  5IUX A;  3T8O A;  1XDP A;  4NPP A;  1XNR T;  2LE8 A;  4JEH B;  4UF0 A;  5GON E;  4HFB A;  4CXY A;  4ALX A;  2JRK A;  3PJA A;  2IW5 B;  3DJB A;  4DUY T;  3FZK B;  4DND A;  4WNK A;  1S94 A;  4DO0 A;  5DJQ C;  2DI4 A;  5LXT E;  1T72 A;  1O3X A;  2X68 A;  3UU8 A;  2PBI A;  5AQH B;  3LSV A;  3LBX B;  5HWX A;  4I55 E;  3FBZ A;  2BS4 A;  2CEA A;  2ES0 A;  5HWY A;  3AE3 A;  5CA1 E;  3UFG A;  1XZY A;  2A2F X;  4PK6 A;  2W63 A;  3JAE A;  4GOU A;  5AQG B;  2J62 A;  1Y01 A;  1CHU A;  3DP7 A;  4YSY A;  1KNR A;  2BYR A;  4UIG A;  4HFD A;  1MIW A;  2CLY B;  2BJ0 A;  2JQK A;  4EYY R;  2D9D A;  3ZJ1 A;  4KHZ F;  5L4H A;  3AEB A;  3U8M A;  3AEA A;  2IHR 1;  2VUR A;  5LXB A;  1BR4 A;  4H63 H;  2BS3 A;  5AFK A;  3VKH A;  4LFA T;  4AQG A;  2N9D A;  3W15 B;  3HL6 A;  3P4W A;  4ZK4 A;  2VQF T;  2X00 D;  2C5J A;  2C5K T;  3N9Q A;  2V5D A;  5LGU B;  3L09 A;  5FY1 A;  2HH7 A;  3GN5 B;  4H9O C;  5AFU L;  3VU7 H;  3N2G E;  2BYN A;  2YDS A;  3AVS A;  2CXL A;  2V26 A;  5AQJ B;  1MND A;  3I0O A;  4IDP A;  3HA4 A;  3C84 A;  3KV5 A;  4WYV A;  5L3D B;  3VHL A;  3IF8 B;  4ZK1 A;  4ZR6 A;  2WZI A;  1MMG A;  1WR0 A;  5J0Z A;  3CQC B;  3LK4 2;  1MIV A;  2WDQ A;  2XAQ B;  4DV0 T;  4HFH A;  5LNK A;  2Y56 A;  4JI3 T;  4ILU A;  2M6B A;  2IDO B;  2WSS V;  5HCM A;  2NTX A;  4BJN A;  3HKC E;  4KX6 A;  4GYR A;  2L3L A;  4YJ3 E;  4UVC B;  3EDV A;  3BK9 A;  3SFE A;  3RGL A;  5FYM A;  2R6G F;  1UUS A;  3PEO A;  3P4P A;  5BR8 T;  2OA5 A;  3RYI E;  5L3G B;  2Y58 A;  3N9P A;  3T1Y T;  2PTF A;  2PH9 A;  2LEH A;  3P7I A;  4XBF B;  2WZH A;  2ZM2 A;  4D01 A;  3EVY A;  3WTO A;  3ZN0 B;  1IAP A;  1NWM X;  3AXJ A;  4IGU A;  2XAJ B;  4EGW A;  4DV1 T;  4HEA A;  4NXN T;  5J5H A;  4DR3 T;  5SYO A;  1WYC A;  4PJJ A;  4JUY A;  3C4W A;  3E22 E;  2D0U A;  3UFE A;  4EAH A;  3GA8 A;  4H63 V;  5L3E B;  4ZI2 D;  4B6X A;  4X65 T;  3C50 A;  4X20 E;  4OYK A;  4ZS3 A;  2W4X A;  2LRK A;  3R6N A;  2LOS A;  5LHG B;  3AAI A;  3ZPO A;  2LHN A;  2K3W A;  5AQS B;  1YQ4 A;  2EHO B;  2XAG B;  3AAA B;  3FXE B;  2E5L T;  5ABG A;  3FZH B;  3P8C D;  2P9B A;  4JI2 T;  2WS3 A;  2XQ4 A;  4Z90 A;  4FI5 A;  4DV6 T;  4AQF A;  3CQX C;  2F4V T;  3GWH A;  2KXP B;  3KFW X;  3LFM A;  2X51 A;  3VR9 A;  3FXD B;  4JLE A;  4A5X A;  4P0B A;  4PJL A;  3ZJ2 A;  3JCF A;  3ZDH A;  2BYP A;  2XUE A;  3FZM B;  1I6Z A;  3IGQ A;  3N2O A;  4JI8 T;  2N1G A;  3SQ6 A;  3CWZ B;  5J2T E;  3A8Y C;  1OED B;  5J5I A;  5AIN A;  1OWA A;  4B5D A;  1YKH B;  2XQ7 A;  2Q9Q B;  2X0H A;  2YME A;  2DHR A;  1BR1 A;  5E0O A;  2QGS A;  4DR6 T;  5HAX A;  3AE1 A;  3AE8 A;  1MMD A;  4ILC A;  2XSB A;  1UK5 A;  4HQP A;  2K24 A;  3UU3 A;  2Y8D A;  4WW0 A;  3OVU A;  2LKH A;  5AQK B;  4ERR A;  4AXP A;  4OK0 A;  2D2S A;  3IBP A;  3PJA J;  5CB4 E;  5JRC B;  3ZEF B;  1B7T A;  1XMO T;  3ZCI A;  3EAM A;  4HWC A;  3IHR A;  2V7J A;  2XQ5 A;  3LDQ B;  2FJA A;  5JR9 C;  3AE9 A;  4A97 A;  4DR1 T;  3SQ9 A;  2X9Y A;  1OXZ A;  4DBQ A;  4QH1 A;  4G2A A;  2OV9 A;  5ETW A;  3QNU A;  3QOF A;  4TWF A;  4WBN E;  3ONX A;  4ZEY A;  3KV6 A;  4YJ2 E;  4X64 T;  2NW9 A;  3CVR A;  4F6R C;  5FP3 A;  4NUV A;  1LVF A;  4JI1 T;  3AXJ B;  3C51 A;  3KIN B;  3I9W A;  3LBX A;  3P50 A;  4AI6 A;  1DU2 A;  3F57 A;  4PJM A;  1FJG T;  1G8X A;  5JME A;  4DV7 T;  4ZI2 C;  4HFI A;  4LF7 T;  3EAB A;  4X1K E;  2WB5 A;  2E8I A;  4WV9 A;  3AE2 A;  1CUN A;  5AQO B;  3UUM A;  3CIR A;  3ZN1 B;  2VKD A;  1J1J A;  2WQY A;  3PUW F;  4CI1 B;  5HXH A;  5CJ5 A;  2H88 A;  3OBV E;  4GKJ T;  3AEG A;  4JI0 T;  2CBI A;  2CRB A;  4HWI B;  2I6H A;  4DMW A;  1W0B A;  1AJ3 A;  1H7C A;  4MAL A;  2HN2 A;  4K0U A;  5H6R B;  4OFZ A;  4UEM A;  3SRZ A;  4I50 E;  2ZM8 A;  1U4Q A;  3EDU A;  3ABV A;  2CXD A;  5JDH A;  2VKO A;  5AQF B;  3GN5 A;  3RKG A;  5LB7 B;  5DQW A;  4QH4 A;  5LA6 E;  4BA9 A;  4FRR A;  3BQI A;  5AQQ B;  2X9H A;  2XM2 A;  5JRE A;  4YT0 A;  2H89 A;  1HNX T;  2LM2 A;  2XAS B;  2K48 A;  2V6X A;  1GQE A;  1IJ6 A;  4AKG A;  4P0A A;  2CPT A;  3AVR A;  3PUX F;  2W67 A;  4LFB T;  2XSA A;  2C5I T;  2G0U A;  3UQ4 A;  1J5E T;  2UXX B;  4U2Y A;  3UU6 A;  2V6Y A;  2GK9 A;  2IIU A;  5J5F A;  1LVK A;  4TNV A;  5ADX L;  5FMN A;  1T98 A;  2CHN A;  2CBJ A;  3TLU A;  3PUY F;  1WCR A;  3PU3 A;  4C90 A;  2RA1 A;  2Y7Y A;  2CMR A;  2LJL A;  4TN7 B;  2CE7 A;  3NRX A;  5LGT B;  4AFG A;  2Y48 B;  2IML A;  4Z91 A;  3VRB A;  5JDL A;  5L2L A;  4EZH A;  3KVB A;  4O8S A;  3RRW A;  1EZ3 A;  2WZY A;  5AQM B;  4ZJT A;  3OYZ A;  4HWD A;  1BR2 A;  4HWF A;  2IUB A;  3UUB A;  4U33 A;  3I1A A;  1W0A A;  4QWN B;  3O9X A;  5LGN B;  3U8N A;  2W62 A;  3RQW A;  4TUY E;  4JI5 T;  3RPU A;  4H9N C;  1S35 A;  2ACX A;  4AQF C;  2NWB A;  3RIU A;  1IJ5 A;  2EHO A;  2JPF A;  2CXF A;  4X1Y E;  5KXJ A;  3AAE B;  2WAU A;  5BRX A;  4LML A;  4O2B E;  3AA1 B;  4QXB B;  3K3Q C;  1VOM A;  2LRL A;  2C0S A;  2ZM0 A;  4AKI A;  2BYQ A;  5AQR B;  2UZ6 A;  1OED E;  3AE6 A;  2I59 A;  3AED A;  5ABE A;  3OYX A;  3ZC1 A;  3OTO T;  1UCU A;  1OED A;  4PAG A;  4UY2 A;  5BP0 A;  3AE7 A;  2X66 A;  1E1H B;  3T4M A;  2Q9Q A;  4N78 D;  3PTR B;  4CXX A;  2NP9 A;  1N32 T;  2NW8 A;  5CO5 A;  5EK4 A;  2FJB A;  2J47 A;  4B3S T;  1MMN A;  4UM3 S;  2KND A;  4HFE A;  3TLT A;  1KEY A;  3QK6 A;  5L3F B;  5M4Y A;  4YFS A;  2E9X B;  2B1E A;  5AQL B;  2UUC T;  1VRB A;  4NXM T;  1X9B A;  4IE7 A;  3EUH A;  5FKY A;  5FVK A;  4IL4 A;  3MJX A;  5JRC A;  4EED A;  1HNZ T;  3F31 A;  2UU9 T;  4QXC B;  1IBK T;  4I0U A;  2V6Y B;  2NTY A;  3K3O A;  2Z6E A;  1T8B A;  4UVB B;  1MIY A;  2W61 A;  5KZU A;  5JDQ A;  5CFB A;  2WCA A;  3C4X A;  2MPK A;  5JDF A;  3ZLI A;  2HPL A;  5JVD E;  5EK2 A;  4JI7 T;  2VKJ A;  3P4S A;  4M1P A;  3SWH A;  4ZHQ E;  2XY8 B;  2XQ9 A;  3RIA A;  4GIW A;  2XZE A;  5ABF B;  2H7O A;  4U2Z A;  2H7V C;  3N9L A;  4BJM A;  4L9I A;  3EI0 A;  2X9X A;  2CLY C;  1SE7 A;  3HR0 A;  5KMG P;  1D0Y A;  4XHE A;  4QHO A;  2V1D B;  4IT4 A;  4MBQ A;  2EHO D;  2XAH B;  4GYS A;  4ZZC A;  4A56 A;  3KDS E;  4PFO A;  2WNC A;  2XQ3 A;  3KV9 A;  3K1S A;  5LBM A;  2XYT A;  2ODU A;  5AQP B;  2LKG A;  5IYZ E;  2XAF B;  3E0Z A;  3MXZ A;  3RYC E;  4DR7 T;  1BR0 A;  2I0M A;  4DBM A;  4JV5 T;  1US7 B;  1I9B A;  5FJV A;  4CZZ B;  3AA7 B;  3N9O A;  3NZP A;  3U78 A;  2BZB A;  2A3D A;  3WTL A;  3ZCJ A;  3PMZ A;  4LF6 T;  4YHJ A;  5FNV E;  1D0X A;  4B3T T;  3ESL A;  3T1H T;  4ANJ A;  3BQK A;  4QKN A;  3MZK B;  3PUV F;  1XNQ T;  3V5U A;  3CML A;  4H9P C;  3ONJ A;  2MTQ A;  4MFR A;  1IBM T;  4GK0 E;  5AFJ A;  3GUA A;  2MYS A;  2Q9Q D;  2ACZ A;  3UU5 A;  4LF5 T;  3RYH E;  4UV9 B;  3N5L A;  2DWK A;  1ZOY A;  2WNL A;  2JMH A;  5HEG A;  3SOL A;  3ANW B;  3E08 A;  2JIW A;  1QLB A;  2XNT A;  2WU2 A;  5LMN T;  3I0Q A;  2XZ5 A;  2FJE A;  1UW6 A;  4EEB A;  3Q5W A;  2WWV A;  2H3R A;  2RPA A;  2UXB T;  3A7M A;  3RLF F;  4IHJ E;  1R8I A;  2MBG A;  3VR8 A;  4QXH B;  4KMC A;  3ZYL A;  3AA0 B;  2KIN B;  2LLY A;  3U3I A;  4O2A E;  2IC9 A;  2XYS A;  2BKP A;  3WAK A;  3H37 A;  5FY0 A;  2W66 A;  3AEF A;  4B3M T;  4IDQ A;  5AQU B;  3AE5 A;  5KDM C;  4TZ4 C;  3TLS A;  3DTO A;  3HKB E;  3TLW A;  4UM3 P;  3C4Z A;  1UV6 A;  4KI0 F;  4CN4 A;  1HF8 A;  3CK6 A;  3ZST A;  2JQ9 A;  1Z0P A;  2ZMA A;  3O1I A;  2BVL A;  2JQH A;  3AB3 B;  3IEE A;  4KP3 C;  4E7Z A;  3NZQ A;  1FEW A;  3ONL C;  3UUN A;  2BR7 A;  1YKE B;  3M3Z B;  2XZ6 A;  1D1B A;  2NOX A;  3U8K A;  2LOP A;  5IHY A;  4EZ1 A;  4WBO A;  1FIO A;  4DR4 T;  1NEN A;  1W09 A;  2VWA A;  3L8R A;  2EHO C;  3NBX X;  4YLH A;  5HCJ A;  3ZYM A;  5LP6 E;  2C9T A;  2XM1 A;  2WNJ A;  3Q2M A;  4XZC A;  3FZL B;  2JMK A;  4AFT A;  5HXR A;  4IST A;  3RQU A;  4AKL A;  4OHF A;  2IAK A;  3X1D A;  4ZI3 D;  1UX4 A;  4DBR A;  5H6Q B;  4Q25 A;  4PK4 A;  1FMV A;  3WTN A;  5HYA A;  4NZB A;  3RC3 A;  4KUM B;  2JJ9 A;  2XQY A;  3RF1 A;  4DR5 T;  2WMO A;  2B76 A;  4CN6 A;  2CWO A;  3CX7 B;  3F2E A;  3K8P C;  3CPZ A;  2ZLY A;  4LMK A;  5ABH A;  3WI3 A;  1OED C;  2QYW A;  2Q9Q C;  5LJM A;  4C91 A;  2CM0 A;  4TWD A;  2L9Q A;  5L3B B;  1M7K A;  5F5W A;  3N2K E;  5IWA T;  1UX2 A;  5L47 A;  3V5S A;  1UX5 A;  3Q9D A;  2WMN A;  1KFY A;  1IZN B;  4B3R T;  2Y57 A;  4PIR A;  5BMV E;  1WFD A;  5JQG E;  4XAX B;  2XQA A;  3QB5 A;  4L0R A;  5LYJ E;  4DR2 T;  5BW2 A;  2DNX A;  3B5M A;  2WDR A;  3ETU A;  2RP4 A;  3CKD A;  3KVA A;  3MA9 A;  3RI5 A;  2SPC A;  5LBQ B;  3BQL A;  4COF A;  2X0L B;  3MKD A;  5EK3 A;  2E9X A;  3WTJ A;  2HHH T;  2X9W A;  3HI2 A;  4HFC A;  4UXU A;  3H3M A;  4HN9 A;  4EV6 A;  5FXW A;  4IRE A;  1HNW T;  2W8F A;  4ILA A;  4DV5 T;  4TV8 E;  2VB6 A;  4X62 T;  4DV2 T;  1HCI A;  2X00 A;  1D0Z A;  3PUR A;  2KWH A;  1KNP A;  4DV3 T;  4KHP T;  4U74 A;  3JC6 C;  3WIP A;  3ZMT B;  1HG2 A;  3ZMV B;  3U8L A;  1NEK A;  2K5B B;  4BAY B;  2HN1 A;  2LSK A;  4WZX A;  4QX8 B;  4HGA A;  3J7Y q;  2PGZ A;  4J2C A;  2JQQ A;  2AXD S;  2XTL A;  1IBL T;  3UUX B;  5AQT B;  2YDQ A;  2WY2 A;  5ABF A;  2ZJU A;  4H9R C;  1HS7 A;  4IDZ A;  3KBU A;  2FBW A;  3EHZ A;  5LOV E;  4BFQ A;  4TV9 E;  3ZSS A;  2UXN B;  2WN9 A;  3C64 A;  5CGM A;  3FB2 A;  5FXZ A;  3FZF B;  4LF4 T;  2VL8 A;  3UU4 A;  2PFV A;  2ZJV A;  1XMQ T;  4ZI3 C;  3MAC A;  2QVA A;  2FUP A;  4IL9 A;  2AE9 A;  5DQV A;  2UXC T;  4CN1 A;  3NRY A;  4YY3 T;  5JDN A;  1WYB A;  2ODV A;  5LJN A;  4UM1 A;  5JR9 A;  2X67 A;  5J2U E;  4H9S E;  4HFV A;  2BG9 E;  1KK7 A;  4UR9 A;  3A5X A;  1HTJ F;  1Z8U A;  1WLX A;  4G63 A;  4H9Q C;  4IIJ E;  2BG9 A;  4ZS2 A;  3B57 A;  4ZJS A;  5TAO A;  1ZEE A;  4ZXL A;  5JDM A;  1SA0 E;  1YD8 G;  3G06 A;  4P1N A;  4FJO A;  4GK5 E;  2KMF A;  4ADZ A;  5HXS A;  1JNR A;  3PUA A;  1HX8 A;  1VCS A;  3ANW A;  4LMJ A;  3H3A A;  4PW8 A;  3QUJ A;  1ZKE A;  3OKQ A;  2DWG A;  2E9X D;  3WAJ A;  5FL0 A;  1UUR A;  5J5G A;  3O4X E;  5HXE A;  2VAS A;  5KX5 E;  3CQG B;  3NWI A;  4I4T E;  3MK7 C;  4AIS A;  5LG3 A;  4NIQ A;  4O4L E;  2FJD A;  2BYS A;  5DAB A;  2N2N A;  2BR8 A;  4UM3 A;  4LFC T;  2LSG A;  5F3J A;  5AFH A;  2QC1 B;  2K9A A;  3Q5D A;  2VKH A;  5EZY E;  4AQY T;  4EOZ B;  2PJQ A;  3VRA A;  4EB6 E;  4OYJ A;  5FXX A;  3ZMU B;  5A1L A;  3IA3 A;  3O1H A;  3WTM A;  4HKA A;  4QAA A;  2VVN A;  5HEH A;  3Q5E A;  1U5P A;  2W2U A;  3SIO A;  2VVS A;  2UXD T;  4PNI A;  4O4J E;  3PUS A;  4AKR B;  1YW0 A;  1NAF A;  4U7Y A;  2IC6 A;  3Q5X A;  1WR6 A;  2UUA T;  4IE5 A;  1HX1 B;  5AFL A;  2LT3 A;  3FBL A;  5AFM B;  1HFA A;  4V1A v;  2XQ8 A;  4K0K T;  5F8P A;  1VCT A;  4IDN A;  2ZM6 T;  2D0T A;  2LSI A;  4ISS A;  2KZ7 B;  1ZP0 A;  3VKG A;  4QX7 B;  4TNW A;  4TX5 A;  2W8G A;  4U72 A;  2DL1 A;  4F8H A;  3SS1 A;  2LM9 A;  4JI6 T;  5JDG A;  4MHC A;  4UF0 B;  2YIN A;  5L4E A;  1Y64 B;  3D0T A;  2MOZ A;  4CI2 B;  3P4R A;  3NVO A;  3TKL B;  1E2A A;  5FVL A;  1XWM A;  4DVD A;  4CI3 B;  3PV0 F;  3OJA A;  2NW7 A;  5LMU T;  5JR9 B;  2MAW A;  2CCQ A;  3PDY A;  5C2T A;  3N9M A;  3CX6 B;  5FY7 A;  1W9R A;  3UUL A;  4EZ4 A;  2YU2 A;  1ZHC A;  1KF6 A;  2BG9 B;  4DUZ T;  4X1I E;  1SUM B;  1N33 T;  5AFN A;  2E9X C;  3OPC A;  4ILB A;  4YSZ A;  4U7I A;  3WTI A;  4P09 A;  4QAB A;  2WWU A;  2KSR A;  2DCF A;  4Z8X A;  4HTE A;  3RRC A;  3ZC0 A;  5JH7 E;  1MNE A;  2PG8 A;  5C3J A;  3SH1 A;  3LK2 B;  4DV4 T;  3GMI A;  3ZT6 A;  4EIW A;  3KBT A;  3S4U A;  3NKZ A;  2KWI B;  3AA6 B;  1SHZ C;  3QC9 A;  3PUZ F;  4JI4 T;  2YMD A;  1QUU A;  4IE4 A;  4CQI A;  3AEE A;  2WBL A;  4PJN A;  1J5W A;  1X79 A;  3C98 B;  1G73 A;  2YN6 A;  1YQ3 A;  2XPK A;  4PFP A;  1LKX A;  3KV4 A;  1HG5 A;  2Y6X A;  2Y54 A;  2YDR A;  3RC8 A;  1L0V A;  3L3P A;  1T7S A;  2CA5 A;  5FL1 A;  2X0Y A;  3UT5 E;  4ASK A;  2BS2 A;  2D5U A;  2OLT A;  4X5T A;  3JC6 D;  5FXV A;  4OX9 T;  5AQV B;  3QB5 K;  3HKE E;  3B13 A;  4HE8 A;  1E7P A;  2WDV A;  4GKK T;  2UUB T;  1YXR A;  2E5V A;  4IE0 A;  3RX6 A;  4LF8 T;  2A72 A;  3RIF A;  2V7L A;  4UVA B;  5JTG A;  2QRX A;  1KNZ A;  2YU1 A;  3RKO A;  5HEJ A;  3L39 A;  3RIU C;  2V5C A;  2YEV C;  4EYU A;  1HR0 T;  2KT9 A;  4JBW F;  5J1G A;  3UTK A;  4YTP A;  4TWH A;  2WM9 A;  3WTK A;  3I9Y A;  2BG9 C;  2XJ7 A;  3HKD E;  3LG7 A;  3ZT5 A;  3ZKR A;  3J9X 1;  5TVC A;  3R84 B;  3WTH A;  4HWH A;  5HEU A;  2HPJ A;  1ZV4 X;  2V8S V;  3ZDG A;  3PUQ A;  5L3C B;  2BKO A;  2VK9 A;  3UQ7 A;  4QH5 A;  2J4G A;  5AQI B;  2W00 A;  4ZI7 E;  1FMW A;  3O1J A;  4JEU B;  2LSY A;  2XHE B;  2E2A A;  4E7S A;  2J1D G;  5CA0 E;  4AKH A;  1D1C A;  1M62 A;  2YK0 A;  4ZZB A;  4YSX A;  1JNZ A;  4YHH T;  2XNU A;  2VQE T;  4KBM B;  1V9D A;  3ZT7 A;  3PUG A;  1MMA A;  4ZOL E;  3RYF E;  4XK9 A;  3M65 A;  5C8Y E;  5AQN B; 
#chains in the Genus database with same CATH homology
 3TLU A;  4UM1 A;  4WV9 A;  3JAF A;  2XNT A;  5SYO A;  5IUX A;  3WTJ A;  2BG9 E;  2XQ9 A;  2BYQ A;  2BG9 B;  3RIA A;  3WTM A;  4NPP A;  2XZ5 A;  2BYN A;  4AFT A;  4HFC A;  4QAA A;  4UXU A;  3RIF A;  5KE4 A;  5HEH A;  2UZ6 A;  4ILC A;  3U8J A;  2Y7Y A;  1UW6 A;  3RQU A;  4HFB A;  4HQP A;  4ALX A;  5AFN A;  3EI0 A;  4IRE A;  3UU3 A;  2W8F A;  3SIO A;  4ILA A;  1OED E;  5HEJ A;  3C84 A;  4ILB A;  2VL0 A;  2LKH A;  4AFG A;  2BG9 A;  2X00 A;  4XHE A;  4Z91 A;  3WTI A;  2LLY A;  4ZJS A;  4QAB A;  4ZK1 A;  4ZR6 A;  3WTN A;  2KSR A;  4BQT A;  4NZB A;  4TWH A;  3UU8 A;  5J0Z A;  4ZZC A;  3WIP A;  5AFL A;  2XYS A;  1OED A;  3WTK A;  4UY2 A;  3EAM A;  5BP0 A;  3LSV A;  2XQ3 A;  2WNC A;  3T4M A;  5AFM B;  2BG9 C;  2Y56 A;  4HFH A;  3U8L A;  3SH1 A;  2M6I A;  2WZY A;  3ZKR A;  2XQ5 A;  4ZJT A;  2XQ8 A;  2M6B A;  4LMJ A;  3TLS A;  2XYT A;  5CO5 A;  4LMK A;  2LKG A;  2PGZ A;  3TLW A;  5TVC A;  4A97 A;  4UM3 P;  4AFH A;  3C79 A;  1UV6 A;  3SQ9 A;  1OED C;  4DBM A;  5HCM A;  3WTH A;  5HEU A;  2YMD A;  2ZJU A;  4QH1 A;  3UUB A;  3JAE A;  1I9B A;  2XNV A;  5FJV A;  4QH4 A;  3ZDG A;  3EHZ A;  4TWD A;  4ZRU A;  4TNW A;  3WTL A;  4UM3 S;  4HFE A;  2BYR A;  3PMZ A;  3TLT A;  5J5G A;  4FRR A;  3JAD A;  4BFQ A;  2XQ4 A;  4HFD A;  2BJ0 A;  3UQ7 A;  4QH5 A;  4Z90 A;  3U8N A;  2YN6 A;  2W8G A;  3RQW A;  4TWF A;  1UX2 A;  5L47 A;  4F8H A;  2WN9 A;  2LM2 A;  4QAC A;  4IL4 A;  5LG3 A;  2Y57 A;  4A98 A;  4PIR A;  5L4E A;  2YKS A;  2XQ6 A;  3TLV A;  3PEO A;  2Y54 A;  5L4H A;  2BYS A;  3U8M A;  2Y58 A;  2XQA A;  2BR7 A;  2BR8 A;  3ZDH A;  5AFM A;  3UU4 A;  5LXB A;  3P50 A;  2BYP A;  2PH9 A;  4UM3 A;  3GUA A;  5AFJ A;  5BW2 A;  2XZ6 A;  2ZJV A;  3U8K A;  3IGQ A;  3RHW A;  5AFK A;  3UU5 A;  2YOE A;  3SQ6 A;  2MAW A;  5JME A;  4ZZB A;  4EZ1 A;  4X5T A;  3UQ4 A;  4D01 A;  4HFI A;  3WTO A;  5AFH A;  5KZU A;  1OED B;  5CFB A;  2XNU A;  5BRX A;  4LML A;  5AIN A;  2QC1 B;  5HEO A;  2WNL A;  4B5D A;  5J5I A;  3RI5 A;  2XQ7 A;  4IL9 A;  3P4W A;  3UU6 A;  4ZK4 A;  2YME A;  5HEG A;  2X00 D;  4COF A;  5J5F A;  4TNV A;  5HCJ A;  2C9T A;  4XK9 A;  2WNJ A;  5J5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...