2BG9C

Refined structure of the nicotinic acetylcholine receptor at 4a resolution.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
369
structure length
369
Chain Sequence
VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISILRLRPELIWIPDIVLQNNNDGQYNVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEISMDLIIDPEAFTENGEWEIIHKPAKKNIYGDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLISFLAALAFYLPAESGEKMSTAICVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVVVNCGIVLNFHFRTPSTHSGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNRPPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Refined Structure of the Nicotinic Acetylcholine Receptor at 4A Resolution
pubmed doi rcsb
molecule tags Ion channel/receptor
total genus 83
structure length 369
sequence length 369
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
C PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2bg9C02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bg9C01
4QH5A 4QAAA 4HFBA 5LXBA 2WNJA 4XHEA 3UUBA 5KE4A 3TLTA 2Y58A 4UM3P 2XYSA 2XNVA 3C79A 3WTNA 2BR7A 4NZBA 4TWHA 4HFIA 5J5IA 3P4WA 5J0ZA 3WTMA 2XQ4A 4QABA 3RI5A 3WIPA 2XNTA 4AFGA 5AFNA 4ZZBA 4FRRA 3WTOA 4IL9A 3WTIA 3EAMA 5J5FA 3UQ4A 3U8NA 3JADA 5CFBA 4BQTA 2PGZA 2PH9A 3SQ6A 4AFHA 3LSVA 4TNWA 2Y56A 4Z91A 3T4MA 2BYNA 3GUAA 3WTJA 5L4EA 2MAWA 3U8MA 3TLVA 3WTLA 3EHZA 3TLSA 4UXUA 3ZDHA 2BG9A 2WZYA 5IUXA 2BYSA 3PMZA 3ZDGA 4UY2A 4IREA 5CO5A 4ILBA 3RHWA 3JAFA 3UU5A 5SYOA 2M6BA 2ZJUA 4F8HA 3C84A 3U8LA 2KSRA 5HCMA 4ZZCA 2XQ3A 3UU8A 3WTKA 2XQ9A 4DBMA 5AFLA 5AFKA 4QACA 2Y57A 5BW2A 5JMEA 4ILAA 4TWFA 1UW6A 5AINA 2BG9C 4QH4A 2W8GA 5L47A 2YN6A 4Z90A 2C9TA 2BG9E 3RQWA 3PEOA 3UQ7A 5HCJA 4UM3A 2YMDA 4PIRA 2BYQA 4AFTA 5L4HA 4HFHA 3UU4A 2BG9B 2XYTA 2YMEA 3UU3A 4XK9A 4TWDA 3SQ9A 4ZJTA 3P50A 1UV6A 5BP0A 2BJ0A 2LKGA 4HFEA 3WTHA 4HFCA 5BRXA 4ZJSA 2XZ5A 1I9BA 3IGQA 5HEGA 4LMKA 2LKHA 1OEDA 2VL0A 4A97A 2YKSA 3TLUA 3SH1A 4LMJA 4UM1A 5FJVA 5J5HA 3SIOA 3UU6A 1UX2A 5AFMA 4ZK1A 2XQ8A 4COFA 2WN9A 3U8KA 3RQUA 2BR8A 2XZ6A 2XQ7A 3TLWA 4ZK4A 2X00A 4HFDA 4ZR6A 2QC1B 2YOEA 5HEJA 4BFQA 5TVCA 1OEDE 4EZ1A 4QH1A 2XQAA 2ZJVA 4D01A 4ILCA 4NPPA 2Y7YA 4X5TA 3ZKRA 5LG3A 2W8FA 4UM3S 2BYRA 1OEDB 4B5DA 4ZRUA 2WNCA 3U8JA 5AFJA 4A98A 3EI0A 5HEUA 2XQ6A 2Y54A 5KZUA 2WNLA 2LLYA 2X00D 5AFHA 5J5GA 5AFMB 4HQPA 4TNVA 3RIAA 3JAEA 4WV9A 2XNUA 4LMLA 3RIFA 4ALXA 2LM2A 5HEHA 4IL4A 2XQ5A 2UZ6A 2M6IA 1OEDC 2BYPA 5HEOA
chains in the Genus database with same CATH superfamily
5LMNT 4HFBA 4UEMA 4AISA 2CM0A 2KNDA 4AKGA 5HAXA 3A8YC 2XYSA 4DR2T 3PUQA 4LF4T 3Q5DA 2W0GA 5HWYA 5KX5E 4BQTA 3SQ6A 2OLTA 2C5JA 2H7VC 2WP9A 3RYHE 2XAJB 3NRYA 3FZMB 4E7SA 4UVCB 1JNRA 1KFYA 3G06A 3Q9DA 4QACA 2IC9A 3AE8A 2XSAA 4UVAB 3AEGA 4X64T 3I0OA 1AJ3A 4LF8T 2LHRA 2YU2A 2V26A 5FXVA 4LF5T 4N78D 1J5WA 1M7KA 1WCRA 3CPZA 4YSXA 4TWDA 2XAHB 4ZJTA 3P50A 5H6RB 2KZ7B 5AQFB 2CWOA 5JVDE 3CMLA 1KNZA 4HWDA 1FJGT 4X66T 1B7TA 1XMQT 5EZYE 2ODVA 4TUYE 3AEEA 2ZM8A 4HN9A 4H63V 4BFQA 3RC3A 2LRLA 2V7LA 3ZKRA 3QB5A 1J1JA 3W15B 5FXZA 2WZHA 4HE8A 4Z8XA 5KZUA 3FBLA 4U33A 3RIUA 3AE3A 1E7PA 3O1JA 2DHRA 3QNUA 2WNJA 4DV4T 1VOMA 2W4XA 2ZLYA 3RKOA 3HKDE 3WTNA 5LG4A 3NZPA 3MXZA 1LVKA 1BR1A 2R6GF 3U8NA 4NIQA 3OKQA 4U2ZA 3PJAJ 2X0YA 1MNEA 3N2OA 4OYKA 4G2AA 3RIUC 2XPKA 2ZJUA 3WTKA 1WR6A 1FMWA 4ZHQE 4QWNB 2V6YA 1Y64B 1UX4A 3KBTA 3C51A 4K0UA 3OJAA 4PIRA 3ZMUB 5FL1A 4LFCT 3LG7A 4I50E 4C90A 3Q5XA 4HFEA 1NWMX 2XASB 4EB6E 3FHNA 2NWBA 2MPKA 4QHOA 4PJLA 3QUJA 3NZQA 4JI4T 2ODUA 5LA6E 4U7IA 3VR9A 3VHLA 1S35A 3K3NA 2QC1B 2KLQA 4P09A 4TX5A 1MMGA 4YXDA 4JEUB 5AFJA 3PTRB 2UUCT 5JDHA 2X9YA 5DQVA 1WYBA 3S4UA 3AA1B 4JI6T 4YHHT 2J4GA 2CXLA 1I6ZA 3WAKA 2UXCT 1ZOYA 3UTKA 3I1AA 2BS4A 3HI2A 2IW5B 4QXBB 4OYJA 2D0TA 2CE7A 2BS2A 5CA0E 5F8PA 3HL6A 3O9XA 3NKZA 2WDRA 3MJXA 3I9WA 2LSJA 2FJAA 5L4EA 3VKGA 2NTXA 3FZKB 2N9DA 4GIWA 4U7YA 2WZYA 2MOZA 2W61A 4UF0B 2MBGA 2V7IA 4DR5T 3UU8A 4DIDB 2W66A 2XQ9A 5L3CB 2V7KA 2RP4A 2FJBA 4IDQA 1R8IA 5IHYA 4X62T 4Z90A 4WYVA 3OVUA 1LKXA 4AFTA 1MIVA 3LFMA 2KXPB 2YMEA 4B3RT 3ONLC 3FB2A 3AVRA 1X9BA 3KBUA 4XBFB 3SIOA 3V5UA 5AFMA 5AQIB 1M62A 5FP3A 2WU2A 2VL8A 3UUXB 1OEDE 3RH3A 4WBOA 4X5TA 5FVLA 4PFOA 4JI5T 3P4RA 2WNCA 1D0XA 2L9QA 2X00D 4HQPA 4AKLA 3RIFA 5JRCA 4P0AA 2I0MA 5FL0A 3U78A 5HEOA 1HR0T 2X0LB 3EDVA 3FZHB 3OTOT 4UR9A 3AE9A 4AI6A 4EYYR 4ZZBA 1MIWA 3ONJA 3WTIA 1HFAA 1XMOT 3N9MA 2HHHT 2E8IA 2MAWA 2BZBA 4DV0T 3T1YT 1YD8G 3UU5A 5SYOA 2M6BA 3SRZA 4J2CA 4OHFA 2Y6XA 5JMEA 4TWFA 1VRBA 4X65T 3VRBA 2WMOA 3PUAA 3ZC0A 2BYQA 5L4HA 2VK9A 2BKNA 2HPLA 3UU3A 4PK5A 2KMFA 2LKGA 2N2NA 3CWZB 5JDLA 5LYJE 3AE2A 3RLFF 3TLUA 3AA7B 2E9XA 3P7IA 4X1YE 4UM1A 3A7MA 5JR9A 3AE7A 1E1HB 1EZ3A 2XZ6A 3P4PA 5HEJA 3ZT6A 5BMVE 5TVCA 3GMIA 3L09A 4DV1T 1LRZA 4JI7T 3K3QC 3AAAB 3LK3B 5EK2A 4ZI7E 2YK0A 3U8JA 3NRXA 3JCFA 4A5XA 3UFEA 3UUMA 1W0AA 5HEHA 3R84B 5AQLB 4PJNA 4DR6T 4DBRA 4JI3T 3BK9A 2LSKA 1HTJF 2E9XC 2V5DA 5LXBA 4YSYA 5M4YA 4X20E 4HFIA 2V5CA 2CBJA 2KINB 5LJNA 1H7CA 2PH9A 4DUYT 3CQXC 3LSVA 2X9HA 4BA9A 2V6XA 4PK6A 2BYSA 2K24A 4IE4A 1D1AA 2UU9T 2JMHA 5HCMA 2WWUA 4OX9T 1UW6A 2W00A 2LOSA 2BG9C 4QH4A 4HWCA 2W8GA 2XY8B 3JC6C 5J1GA 4YFSA 3UQ7A 2YMDA 2UUAT 3V5SA 4O4LE 4GKKT 1UV6A 4ZS3A 3CX8B 5J2UE 3ZEFB 3T1HT 5IYZE 4IE0A 2YKSA 5DABA 4HGAA 3L8RA 4TV9E 2N1GA 2NP9A 5J2TE 4DV5T 3ZYMA 1HX8A 4COFA 3AEAA 3QB5K 3KDSE 3TLWA 2Q9QA 2KWHA 4ZI2D 2JQ9A 4AQGA 4IE7A 4ILCA 4NPPA 2XAFB 2XHEB 3T8OA 4L9IA 4PK4A 4WBNE 4A98A 2D0UA 4MHCA 2WNLA 3P4QA 3AE6A 4O4IE 3JAEA 2V7MA 2LM2A 1NAFA 2DWKA 2XQ5A 2DCFA 5L3GB 5HXEA 4O2AE 5JDQA 3ANWB 1YQ4A 3RPUA 3CQCB 3F2EA 2VURA 4YTMA 5LGTB 2L3LA 5LMUT 1UUSA 2E2AA 5J5IA 3ABVA 2ACXA 4KUMB 2Q9QC 5JDNA 3QK6A 5AQPB 3RI5A 3WTOA 4IL9A 3ZMVB 3B5MA 3FXEB 5JTGA 4NXMT 4OK0A 5IWAT 4CQIA 4ISTA 3ZLIA 4BJMA 2J62A 2QYWA 4JI8T 2XQ3A 2LJLA 5LHIB 4ILAA 2ZM0A 4WW0A 4YLHA 4ZXLA 1W09A 2BG9E 3AVSA 1IBLT 2WQYA 4HWHA 4DV7T 5CGMA 4K0KT 2LHNA 1U4QA 2IHR1 3EUHA 4IDZA 4TN7B 2AXDS 2I6HA 1YKHB 4AKIA 4IE6A 4U31A 2WN9A 3CX7B 2YOEA 2B1EA 4UELA 3J9X1 2LOPA 4EZ4A 3HR0A 1T8BA 3NVOA 3EI0A 5HEUA 2A2FX 1BR4A 2WAUA 4GK5E 5LHGB 2HH7A 2XM1A 5TAOA 5LHHB 2WWVA 1HNZT 3AECA 4CI3B 1US7B 4DR1T 4B3ST 2QVAA 3RRWA 2XNVA 3AEDA 4NZBA 2NR4A 4TWHA 1VCTA 3C98B 3U3IA 4DO0A 2FUPA 2PGZA 2WZIA 2P9BA 4H63H 4X1IE 4YSZA 4CN1A 2C0SA 2EHOA 4KHZF 4YY3T 3ZDGA 3JAFA 1XWMA 2SPCA 2C5KT 3ZT7A 2CXDA 1CUNA 4G63A 3AE1A 5FNVE 2YDRA 3MZKB 2E5VA 1IBKT 1KEYA 1OEDA 2K3WA 1HS7A 4IHJE 5A1LA 2EHOC 1MNDA 3PUWF 4EEDA 2V7JA 4ZK4A 3RYFE 2Y8DA 2W67A 4P0BA 4EZ1A 5ABFA 2XQAA 1MIYA 4WNKA 2YDQA 2E9XD 2XQ6A 3WI3A 1E2AA 4CXWA 2WBLA 4BAYB 4CN4A 4A56A 5HWXA 5AFUL 5AQTB 2DNXA 3O1HA 2FJEA 1OEDC 1KNRA 3SS1A 3A5XA 1YQ3A 3Q5WA 3ZJ2A 3CQGB 5LBMA 2XSBA 2BR7A 2JPFA 3ETVA 5AFNA 1S94A 3PUGA 1ZEEA 3IBPA 4DUZT 4TNWA 4Z91A 5ADXL 3JC6D 3KVAA 2YEVC 3WTLA 3ZDHA 2J47A 1WYCA 3PMZA 2ZMAA 4KHPT 3E0ZA 2MTQA 3DP7A 3MKDA 4KBMB 1UX5A 4DV3T 4B3TT 1T7SA 3WAJA 2JMKA 4EOZB 1OXZA 1QUUA 4TZ4C 2PJQA 4O2BE 3GWHA 3F57A 4O4JE 1MMNA 2A9UA 4I55E 2XTLA 3VU7H 5FY0A 4H9QC 1GQEA 4KMCA 2PFVA 2VL0A 2VKHA 2V6YB 3AXJA 3SH1A 4AIUA 3AE4A 5FMNA 4MALA 3HA4A 5LGUB 4YJ2E 4AQFA 2VQET 4UXNB 1NEKA 5LOVE 1HX1B 3PUYF 2XUEA 4U72A 4O8SA 4PAGA 1IZNB 2YINA 2Q9QD 2IMLA 5GONE 3RIAA 3N9PA 3ZSTA 2UZ6A 3PDYA 2LT3A 4U74A 4JBWF 2LSGA 2CA5A 5AQKB 4NXNT 4GYSA 4AQFC 3R6NA 4KP3C 3WTMA 3WIPA 2V8SV 3N9OA 3H3AA 3CVRA 2NW9A 4EAHA 3N2GE 2BS3A 4UV8B 2J1DG 3BQIA 4QXCB 5IUXA 3RX6A 4L0RA 3RHWA 4YTNA 4DMWA 4H9SE 3ZYKA 2BBHA 2VASA 4AQYT 4JLEA 2IAKA 2CBIA 4UIGA 3B57A 4EIWA 1QLBA 2WU5A 3RGLA 4PW8A 3UUNA 5HCJA 4XZCA 5FY7A 5C3JA 2LM9A 1J5ET 5BP0A 1HCIA 4I43B 5L3FB 4HFCA 2W2UA 3AAIA 3KINB 1QSDA 2XQYA 2WB5A 5HEGA 1N32T 1KK7A 2YDSA 2LSIA 3RQUA 2WDVA 4ZEYA 5EK4A 2DL1A 1X79A 4ZI3C 4QH1A 5AQGB 2Y7YA 2WDQA 2BYRA 4UVBB 3KV6A 1O3XA 5AFMB 2A72A 1FIOA 3EDUA 3PUVF 4YJ3E 4EEBA 1VCSA 4ZOLE 3EABA 4CXYA 1BR2A 3TKLB 5JRCB 2H88A 2JIWA 5KXJA 3L3PA 5FYMA 2BG9A 5L2LA 1HNXT 5FXXA 4L5GA 4LF9T 1NENA 2K5BB 4CXXA 2EHOD 5LNKA 3PEOA 5DQWA 2MYSA 4IT4A 1Y01A 4EXTA 2XYTA 2QA7A 3SOLA 3RRCA 4OFZA 3RC8A 4BJNA 3WTHA 3LBXA 2V1DB 2NTYA 4LMJA 5F5WA 5JH7E 4QX7B 2UXXB 3GN5A 5CA1E 2WMNA 3RYIE 1D1CA 1IBMT 5LBQB 4ZR6A 2WSSV 2NW7A 1YW0A 3L39A 2CXFA 2C5IT 1T98A 3MA9A 3OYXA 2A3DA 2JQKA 4PFPA 2X67A 2E9XB 2Y54A 2LLYA 2WS3A 5JR9B 2L8KA 3SWHA 2D5UA 3RYCE 2XNUA 4AKRB 4HWFA 3N5LA 1SHZC 1XZYA 1FMVA 1W9RA 5FVKA 2NOXA 3N9QA 3RKGA 1UCUA 3QOFA 4AFGA 4FRRA 3LDQB 2ZM2A 5ETWA 2CCQA 3TLVA 3EHZA 2WCAA 2ACZA 4X1KE 3U8LA 4F8HA 3LJCA 5AFLA 5AFKA 3N9NA 1Z0PA 2NW8A 3X1DA 4IDPA 3UFGA 5AQJB 3ESLA 3I0QA 1HG5A 5JDFA 2BKPA 4UM3A 1MMDA 2CLYB 2XZEA 2VKJA 4DR7T 4PJJA 3LBXB 5BR8T 5LXTE 3I9YA 2XZ5A 4A97A 5JDMA 5HYAA 3MK7C 3CK6A 2XQ7A 4PJMA 5F3JA 4DVDA 3SFDA 2VVNA 2VKOA 3H3MA 2X66A 1XNQT 2W8FA 4ZRUA 4DV6T 1SA0E 1U5PA 2X9XA 3BQLA 2IC6A 3EVYA 5KDMC 4ALXA 5L3BB 2Q9QB 5H6QB 3O4XE 4F6RC 3KFWX 3ONXA 5KE4A 5L3DB 3TLTA 4GYRA 3PJAA 4MBQA 3P4WA 3PUXF 3C4XA 2XQ4A 4QABA 1D0YA 2XM2A 3UQ4A 3AAEB 3IEEA 4AFHA 4ZS2A 4EV6A 5FXWA 5C8YE 3TLSA 3C4ZA 4DBQA 3D0TA 3DTOA 4DBMA 3IF8B 2VWAA 3AA6B 2VQFT 1WFDA 2X68A 3N2KE 5EK3A 5AQUB 3K8PC 3ZCJA 3RF1A 3SQ9A 5FY1A 3PUSA 2BVLA 4ZI3D 4V1Av 5E0OA 2HN2A 5AQHB 1I9BA 3IGQA 4NUVA 3OPCA 2LKHA 3CKDA 4HTEA 2Y48B 3KVBA 4ANJA 4IGUA 3KV9A 3PV0F 3C64A 3PE0A 1HG2A 4YHJA 1D0ZA 1G73A 2KWIB 5LB7B 2D9DA 2D2SA 4KX6A 4DV2T 1YXRA 4H9PC 1XNRT 2JJ9A 4QX8B 2WY2A 1XDPA 4WV9A 5L3EB 2W62A 3E08A 4IL4A 2PBIA 5LCYA 1IAPA 4XHEA 3UUBA 4UF0A 5HXHA 4GK0E 2CEAA 1LVFA 1DU2A 5J0ZA 2BBJA 4KI0F 4JEHB 3PU8A 3EAMA 2H3RA 3M65A 1N34T 3ZMSB 3ZYLA 4UXUA 5JQGE 2HN1A 3H37A 3ZT5A 2UXDT 4IREA 5CO5A 1FEWA 1IJ6A 2VKDA 1T72A 4O4HE 1SUMB 5AINA 4HWIB 2CHOA 2EHOB 3P4SA 4JUYA 3SFEA 5CB4E 4EZHA 3KV4A 3ZJ1A 4NUUA 4LMKA 3FZFB 3FXDB 4ERRA 5LP6E 5FJVA 5J5HA 3UU6A 3AB3B 1D1BA 4C91A 4ZI2C 4M1PA 3ZC1A 5AQSB 2XJ7A 4IDOA 4YTPA 1Z8UA 4CZZB 2XAGB 1OEDB 2JRKA 2X9WA 2CRBA 4H9OC 1IJ5A 5DJQC 4B3MT 4H9RC 2GK9A 4LFAT 2OV9A 4CN6A 4AXPA 3C4WA 2AE9A 4QH5A 5ABFB 4JV5T 2Y58A 3C79A 2BKOA 2DWGA 2VB6A 3ETUA 5HXCA 4GKJT 4U2YA 2YU1A 1ZKEA 2JQHA 2H7OA 2Y56A 3AA0B 3GUAA 3WTJA 3ZPOA 4CI1B 4LF7T 2PTFA 3U8MA 1UK5A 3AE5A 4UY2A 2IIUA 3C84A 3FZLB 1I94T 4ZZCA 3DJBA 4XAXB 2UXNB 4EYUA 3HKBE 5BW2A 3BQKA 2CMRA 2K48A 2FBWA 4ADZA 2BVMA 2QRXA 5HXSA 5L47A 1G8XA 2PG8A 4E7ZA 3E22E 2H89A 4GOUA 3UU4A 3KV5A 4TV8E 1HF8A 5CJ5A 3CX6B 1YKEB 3F31A 2CWYA 4ILUA 4Q25A 4ZK1A 2XQ8A 3ZN1B 3HKCE 2RA1A 5LJMA 4ASKA 4HFDA 4P1NA 3VR8A 4EGWA 4D01A 3K3OA 2WM9A 2DI4A 5FKYA 3PU3A 2Z6EA 1N36T 3AXJB 4DR4T 2M67A 5J5GA 4JYAT 4QKNA 1WLXA 1V9DA 1JNZA 1UURA 3QC9A 2X0HA 3AEFA 3P8CD 2UUBT 2LRKA 1L0VA 1UGOA 3PURA 5ABEA 5AQVB 2XNTA 3B13A 4H9NC 4HKAA 3JADA 3Q2MA 1KF6A 4IDNA 3T4MA 4CI2B 5JREA 1ZV4X 4ILBA 5AQRB 1ZP0A 4JI2T 2B76A 4WZXA 3ZMTB 4AKHA 3N9LA 1WR0A 2FJDA 3C50A 5KMGP 2HPJA 2YN6A 1ZHCA 2LEHA 3M3ZB 5JDGA 3VRAA 2UXBT 4HFHA 2IUBA 4XK9A 2VVSA 2LSYA 4ISSA 2G0UA 2BJ0A 2OA5A 5BRXA 4ZJSA 3ZCIA 4PNIA 2BR8A 1N33T 3ANWA 3FBZA 4LF6T 2ZJVA 5JR9C 3IA3A 3LK2B 3VKHA 5LG3A 3ZMZB 2RPAA 1WRDA 2K9AA 4DNDA 4IIJE 5AFHA 3OYZA 4I4TE 4TNVA 1OWAA 4HFVA 5AQMB 2M6IA 3Q5EA 2BYPA 5AQOB 4QAAA 4DR3T 4MLKA 3IHRA 5LGNB 4UM3P 2BDEA 3J7Yq 2DLRA 2KT9A 4YT0A 4MFRA 5J5FA 4I0UA 5CFBA 1MMAA 4IE5A 2XAQB 3OBVE 2BYNA 3CIRA 1CHUA 3O1IA 2I59A 4HEAA 1XDOA 2KSRA 3ZN0B 2Y57A 2CLYC 4B6XA 1BR0A 4QXHB 2C9TA 3RQWA 5C2TA 1SE7A 5AQNB 5AQQB 2F4VT 4UV9B 3K1SA 2BG9B 3ZSSA 4FI5A 3UT5E 2LE8A 4FJOA 1HNWT 3NWIA 2CHNA 5ABHA 5ABGA 4JI1T 1UX2A 3GA8A 3HKEE 5HXRA 3U8KA 3MACA 3NBXX 2X00A 2QGSA 4DMVA 3UULA 2ZM6T 2IDOB 3LK42 4UM3S 4B5DA 1KNPA 4JI0T 3PUZF 3AEBA 2E5LT 4U3CA 2JQQA 3GN5B 2ES0A 2W63A 4LMLA 1W0BA 2CPTA 4LFBT 2X51A
chains in the Genus database with same CATH topology
4QH5A 4QAAA 4HFBA 5LXBA 2WNJA 4XHEA 3UUBA 5KE4A 3TLTA 2Y58A 4UM3P 2XYSA 2XNVA 3C79A 3WTNA 2BR7A 4NZBA 4TWHA 4HFIA 5J5IA 3P4WA 5J0ZA 3WTMA 2XQ4A 4QABA 3RI5A 3WIPA 2XNTA 4AFGA 5AFNA 4ZZBA 4FRRA 3WTOA 4IL9A 3WTIA 3EAMA 5J5FA 3UQ4A 3U8NA 3JADA 5CFBA 4BQTA 2PGZA 2PH9A 3SQ6A 4AFHA 3LSVA 4TNWA 2Y56A 4Z91A 3T4MA 2BYNA 3GUAA 3WTJA 5L4EA 2MAWA 3U8MA 3TLVA 3WTLA 3EHZA 3TLSA 4UXUA 3ZDHA 2BG9A 2WZYA 5IUXA 2BYSA 3PMZA 3ZDGA 4UY2A 4IREA 5CO5A 4ILBA 3RHWA 3JAFA 3UU5A 5SYOA 2M6BA 2ZJUA 4F8HA 3C84A 3U8LA 2KSRA 5HCMA 4ZZCA 2XQ3A 3UU8A 3WTKA 2XQ9A 4DBMA 5AFLA 5AFKA 4QACA 2Y57A 5BW2A 5JMEA 4ILAA 4TWFA 1UW6A 5AINA 2BG9C 4QH4A 2W8GA 5L47A 2YN6A 4Z90A 2C9TA 2BG9E 3RQWA 3PEOA 3UQ7A 5HCJA 4UM3A 2YMDA 4PIRA 2BYQA 4AFTA 5L4HA 4HFHA 3UU4A 2BG9B 2XYTA 2YMEA 3UU3A 4XK9A 4TWDA 3SQ9A 4ZJTA 3P50A 1UV6A 5BP0A 2BJ0A 2LKGA 4HFEA 3WTHA 4HFCA 5BRXA 4ZJSA 2XZ5A 1I9BA 3IGQA 5HEGA 4LMKA 2LKHA 1OEDA 2VL0A 4A97A 2YKSA 3TLUA 3SH1A 4LMJA 4UM1A 5FJVA 5J5HA 3SIOA 3UU6A 1UX2A 5AFMA 4ZK1A 2XQ8A 4COFA 2WN9A 3U8KA 3RQUA 2BR8A 2XZ6A 2XQ7A 3TLWA 4ZK4A 2X00A 4HFDA 4ZR6A 2QC1B 2YOEA 5HEJA 4BFQA 5TVCA 1OEDE 4EZ1A 4QH1A 2XQAA 2ZJVA 4D01A 4ILCA 4NPPA 2Y7YA 4X5TA 3ZKRA 5LG3A 2W8FA 4UM3S 2BYRA 1OEDB 4B5DA 4ZRUA 2WNCA 3U8JA 5AFJA 4A98A 3EI0A 5HEUA 2XQ6A 2Y54A 5KZUA 2WNLA 2LLYA 2X00D 5AFHA 5J5GA 5AFMB 4HQPA 4TNVA 3RIAA 3JAEA 4WV9A 2XNUA 4LMLA 3RIFA 4ALXA 2LM2A 5HEHA 4IL4A 2XQ5A 2UZ6A 2M6IA 1OEDC 2BYPA 5HEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH5 A;  4QAA A;  4HFB A;  5LXB A;  2WNJ A;  4XHE A;  3UUB A;  5KE4 A;  3TLT A;  2Y58 A;  4UM3 P;  2XYS A;  2XNV A;  3C79 A;  3WTN A;  2BR7 A;  4NZB A;  4TWH A;  4HFI A;  5J5I A;  3P4W A;  5J0Z A;  3WTM A;  2XQ4 A;  4QAB A;  3RI5 A;  3WIP A;  2XNT A;  4AFG A;  5AFN A;  4ZZB A;  4FRR A;  3WTO A;  4IL9 A;  3WTI A;  3EAM A;  5J5F A;  3UQ4 A;  3U8N A;  3JAD A;  5CFB A;  4BQT A;  2PGZ A;  2PH9 A;  3SQ6 A;  4AFH A;  3LSV A;  4TNW A;  2Y56 A;  4Z91 A;  3T4M A;  2BYN A;  3GUA A;  3WTJ A;  5L4E A;  2MAW A;  3U8M A;  3TLV A;  3WTL A;  3EHZ A;  3TLS A;  4UXU A;  3ZDH A;  2BG9 A;  2WZY A;  5IUX A;  2BYS A;  3PMZ A;  3ZDG A;  4UY2 A;  4IRE A;  5CO5 A;  4ILB A;  3RHW A;  3JAF A;  3UU5 A;  5SYO A;  2M6B A;  2ZJU A;  4F8H A;  3C84 A;  3U8L A;  2KSR A;  5HCM A;  4ZZC A;  2XQ3 A;  3UU8 A;  3WTK A;  2XQ9 A;  4DBM A;  5AFL A;  5AFK A;  4QAC A;  2Y57 A;  5BW2 A;  5JME A;  4ILA A;  4TWF A;  1UW6 A;  5AIN A;  2BG9 C;  4QH4 A;  2W8G A;  5L47 A;  2YN6 A;  4Z90 A;  2C9T A;  2BG9 E;  3RQW A;  3PEO A;  3UQ7 A;  5HCJ A;  4UM3 A;  2YMD A;  4PIR A;  2BYQ A;  4AFT A;  5L4H A;  4HFH A;  3UU4 A;  2BG9 B;  2XYT A;  2YME A;  3UU3 A;  4XK9 A;  4TWD A;  3SQ9 A;  4ZJT A;  3P50 A;  1UV6 A;  5BP0 A;  2BJ0 A;  2LKG A;  4HFE A;  3WTH A;  4HFC A;  5BRX A;  4ZJS A;  2XZ5 A;  1I9B A;  3IGQ A;  5HEG A;  4LMK A;  2LKH A;  1OED A;  2VL0 A;  4A97 A;  2YKS A;  3TLU A;  3SH1 A;  4LMJ A;  4UM1 A;  5FJV A;  5J5H A;  3SIO A;  3UU6 A;  1UX2 A;  5AFM A;  4ZK1 A;  2XQ8 A;  4COF A;  2WN9 A;  3U8K A;  3RQU A;  2BR8 A;  2XZ6 A;  2XQ7 A;  3TLW A;  4ZK4 A;  2X00 A;  4HFD A;  4ZR6 A;  2QC1 B;  2YOE A;  5HEJ A;  4BFQ A;  5TVC A;  1OED E;  4EZ1 A;  4QH1 A;  2XQA A;  2ZJV A;  4D01 A;  4ILC A;  4NPP A;  2Y7Y A;  4X5T A;  3ZKR A;  5LG3 A;  2W8F A;  4UM3 S;  2BYR A;  1OED B;  4B5D A;  4ZRU A;  2WNC A;  3U8J A;  5AFJ A;  4A98 A;  3EI0 A;  5HEU A;  2XQ6 A;  2Y54 A;  5KZU A;  2WNL A;  2LLY A;  2X00 D;  5AFH A;  5J5G A;  5AFM B;  4HQP A;  4TNV A;  3RIA A;  3JAE A;  4WV9 A;  2XNU A;  4LML A;  3RIF A;  4ALX A;  2LM2 A;  5HEH A;  4IL4 A;  2XQ5 A;  2UZ6 A;  2M6I A;  1OED C;  2BYP A;  5HEO A; 
#chains in the Genus database with same CATH topology
 5LMN T;  4HFB A;  4UEM A;  4AIS A;  2CM0 A;  2KND A;  4AKG A;  5HAX A;  3A8Y C;  2XYS A;  4DR2 T;  3PUQ A;  4LF4 T;  3Q5D A;  2W0G A;  5HWY A;  5KX5 E;  4BQT A;  3SQ6 A;  2OLT A;  2C5J A;  2H7V C;  2WP9 A;  3RYH E;  2XAJ B;  3NRY A;  3FZM B;  4E7S A;  4UVC B;  1JNR A;  1KFY A;  3G06 A;  3Q9D A;  4QAC A;  2IC9 A;  3AE8 A;  2XSA A;  4UVA B;  3AEG A;  4X64 T;  3I0O A;  1AJ3 A;  4LF8 T;  2LHR A;  2YU2 A;  2V26 A;  5FXV A;  4LF5 T;  4N78 D;  1J5W A;  1M7K A;  1WCR A;  3CPZ A;  4YSX A;  4TWD A;  2XAH B;  4ZJT A;  3P50 A;  5H6R B;  2KZ7 B;  5AQF B;  2CWO A;  5JVD E;  3CML A;  1KNZ A;  4HWD A;  1FJG T;  4X66 T;  1B7T A;  1XMQ T;  5EZY E;  2ODV A;  4TUY E;  3AEE A;  2ZM8 A;  4HN9 A;  4H63 V;  4BFQ A;  3RC3 A;  2LRL A;  2V7L A;  3ZKR A;  3QB5 A;  1J1J A;  3W15 B;  5FXZ A;  2WZH A;  4HE8 A;  4Z8X A;  5KZU A;  3FBL A;  4U33 A;  3RIU A;  3AE3 A;  1E7P A;  3O1J A;  2DHR A;  3QNU A;  2WNJ A;  4DV4 T;  1VOM A;  2W4X A;  2ZLY A;  3RKO A;  3HKD E;  3WTN A;  5LG4 A;  3NZP A;  3MXZ A;  1LVK A;  1BR1 A;  2R6G F;  3U8N A;  4NIQ A;  3OKQ A;  4U2Z A;  3PJA J;  2X0Y A;  1MNE A;  3N2O A;  4OYK A;  4G2A A;  3RIU C;  2XPK A;  2ZJU A;  3WTK A;  1WR6 A;  1FMW A;  4ZHQ E;  4QWN B;  2V6Y A;  1Y64 B;  1UX4 A;  3KBT A;  3C51 A;  4K0U A;  3OJA A;  4PIR A;  3ZMU B;  5FL1 A;  4LFC T;  3LG7 A;  4I50 E;  4C90 A;  3Q5X A;  4HFE A;  1NWM X;  2XAS B;  4EB6 E;  3FHN A;  2NWB A;  2MPK A;  4QHO A;  4PJL A;  3QUJ A;  3NZQ A;  4JI4 T;  2ODU A;  5LA6 E;  4U7I A;  3VR9 A;  3VHL A;  1S35 A;  3K3N A;  2QC1 B;  2KLQ A;  4P09 A;  4TX5 A;  1MMG A;  4YXD A;  4JEU B;  5AFJ A;  3PTR B;  2UUC T;  5JDH A;  2X9Y A;  5DQV A;  1WYB A;  3S4U A;  3AA1 B;  4JI6 T;  4YHH T;  2J4G A;  2CXL A;  1I6Z A;  3WAK A;  2UXC T;  1ZOY A;  3UTK A;  3I1A A;  2BS4 A;  3HI2 A;  2IW5 B;  4QXB B;  4OYJ A;  2D0T A;  2CE7 A;  2BS2 A;  5CA0 E;  5F8P A;  3HL6 A;  3O9X A;  3NKZ A;  2WDR A;  3MJX A;  3I9W A;  2LSJ A;  2FJA A;  5L4E A;  3VKG A;  2NTX A;  3FZK B;  2N9D A;  4GIW A;  4U7Y A;  2WZY A;  2MOZ A;  2W61 A;  4UF0 B;  2MBG A;  2V7I A;  4DR5 T;  3UU8 A;  4DID B;  2W66 A;  2XQ9 A;  5L3C B;  2V7K A;  2RP4 A;  2FJB A;  4IDQ A;  1R8I A;  5IHY A;  4X62 T;  4Z90 A;  4WYV A;  3OVU A;  1LKX A;  4AFT A;  1MIV A;  3LFM A;  2KXP B;  2YME A;  4B3R T;  3ONL C;  3FB2 A;  3AVR A;  1X9B A;  3KBU A;  4XBF B;  3SIO A;  3V5U A;  5AFM A;  5AQI B;  1M62 A;  5FP3 A;  2WU2 A;  2VL8 A;  3UUX B;  1OED E;  3RH3 A;  4WBO A;  4X5T A;  5FVL A;  4PFO A;  4JI5 T;  3P4R A;  2WNC A;  1D0X A;  2L9Q A;  2X00 D;  4HQP A;  4AKL A;  3RIF A;  5JRC A;  4P0A A;  2I0M A;  5FL0 A;  3U78 A;  5HEO A;  1HR0 T;  2X0L B;  3EDV A;  3FZH B;  3OTO T;  4UR9 A;  3AE9 A;  4AI6 A;  4EYY R;  4ZZB A;  1MIW A;  3ONJ A;  3WTI A;  1HFA A;  1XMO T;  3N9M A;  2HHH T;  2E8I A;  2MAW A;  2BZB A;  4DV0 T;  3T1Y T;  1YD8 G;  3UU5 A;  5SYO A;  2M6B A;  3SRZ A;  4J2C A;  4OHF A;  2Y6X A;  5JME A;  4TWF A;  1VRB A;  4X65 T;  3VRB A;  2WMO A;  3PUA A;  3ZC0 A;  2BYQ A;  5L4H A;  2VK9 A;  2BKN A;  2HPL A;  3UU3 A;  4PK5 A;  2KMF A;  2LKG A;  2N2N A;  3CWZ B;  5JDL A;  5LYJ E;  3AE2 A;  3RLF F;  3TLU A;  3AA7 B;  2E9X A;  3P7I A;  4X1Y E;  4UM1 A;  3A7M A;  5JR9 A;  3AE7 A;  1E1H B;  1EZ3 A;  2XZ6 A;  3P4P A;  5HEJ A;  3ZT6 A;  5BMV E;  5TVC A;  3GMI A;  3L09 A;  4DV1 T;  1LRZ A;  4JI7 T;  3K3Q C;  3AAA B;  3LK3 B;  5EK2 A;  4ZI7 E;  2YK0 A;  3U8J A;  3NRX A;  3JCF A;  4A5X A;  3UFE A;  3UUM A;  1W0A A;  5HEH A;  3R84 B;  5AQL B;  4PJN A;  4DR6 T;  4DBR A;  4JI3 T;  3BK9 A;  2LSK A;  1HTJ F;  2E9X C;  2V5D A;  5LXB A;  4YSY A;  5M4Y A;  4X20 E;  4HFI A;  2V5C A;  2CBJ A;  2KIN B;  5LJN A;  1H7C A;  2PH9 A;  4DUY T;  3CQX C;  3LSV A;  2X9H A;  4BA9 A;  2V6X A;  4PK6 A;  2BYS A;  2K24 A;  4IE4 A;  1D1A A;  2UU9 T;  2JMH A;  5HCM A;  2WWU A;  4OX9 T;  1UW6 A;  2W00 A;  2LOS A;  2BG9 C;  4QH4 A;  4HWC A;  2W8G A;  2XY8 B;  3JC6 C;  5J1G A;  4YFS A;  3UQ7 A;  2YMD A;  2UUA T;  3V5S A;  4O4L E;  4GKK T;  1UV6 A;  4ZS3 A;  3CX8 B;  5J2U E;  3ZEF B;  3T1H T;  5IYZ E;  4IE0 A;  2YKS A;  5DAB A;  4HGA A;  3L8R A;  4TV9 E;  2N1G A;  2NP9 A;  5J2T E;  4DV5 T;  3ZYM A;  1HX8 A;  4COF A;  3AEA A;  3QB5 K;  3KDS E;  3TLW A;  2Q9Q A;  2KWH A;  4ZI2 D;  2JQ9 A;  4AQG A;  4IE7 A;  4ILC A;  4NPP A;  2XAF B;  2XHE B;  3T8O A;  4L9I A;  4PK4 A;  4WBN E;  4A98 A;  2D0U A;  4MHC A;  2WNL A;  3P4Q A;  3AE6 A;  4O4I E;  3JAE A;  2V7M A;  2LM2 A;  1NAF A;  2DWK A;  2XQ5 A;  2DCF A;  5L3G B;  5HXE A;  4O2A E;  5JDQ A;  3ANW B;  1YQ4 A;  3RPU A;  3CQC B;  3F2E A;  2VUR A;  4YTM A;  5LGT B;  2L3L A;  5LMU T;  1UUS A;  2E2A A;  5J5I A;  3ABV A;  2ACX A;  4KUM B;  2Q9Q C;  5JDN A;  3QK6 A;  5AQP B;  3RI5 A;  3WTO A;  4IL9 A;  3ZMV B;  3B5M A;  3FXE B;  5JTG A;  4NXM T;  4OK0 A;  5IWA T;  4CQI A;  4IST A;  3ZLI A;  4BJM A;  2J62 A;  2QYW A;  4JI8 T;  2XQ3 A;  2LJL A;  5LHI B;  4ILA A;  2ZM0 A;  4WW0 A;  4YLH A;  4ZXL A;  1W09 A;  2BG9 E;  3AVS A;  1IBL T;  2WQY A;  4HWH A;  4DV7 T;  5CGM A;  4K0K T;  2LHN A;  1U4Q A;  2IHR 1;  3EUH A;  4IDZ A;  4TN7 B;  2AXD S;  2I6H A;  1YKH B;  4AKI A;  4IE6 A;  4U31 A;  2WN9 A;  3CX7 B;  2YOE A;  2B1E A;  4UEL A;  3J9X 1;  2LOP A;  4EZ4 A;  3HR0 A;  1T8B A;  3NVO A;  3EI0 A;  5HEU A;  2A2F X;  1BR4 A;  2WAU A;  4GK5 E;  5LHG B;  2HH7 A;  2XM1 A;  5TAO A;  5LHH B;  2WWV A;  1HNZ T;  3AEC A;  4CI3 B;  1US7 B;  4DR1 T;  4B3S T;  2QVA A;  3RRW A;  2XNV A;  3AED A;  4NZB A;  2NR4 A;  4TWH A;  1VCT A;  3C98 B;  3U3I A;  4DO0 A;  2FUP A;  2PGZ A;  2WZI A;  2P9B A;  4H63 H;  4X1I E;  4YSZ A;  4CN1 A;  2C0S A;  2EHO A;  4KHZ F;  4YY3 T;  3ZDG A;  3JAF A;  1XWM A;  2SPC A;  2C5K T;  3ZT7 A;  2CXD A;  1CUN A;  4G63 A;  3AE1 A;  5FNV E;  2YDR A;  3MZK B;  2E5V A;  1IBK T;  1KEY A;  1OED A;  2K3W A;  1HS7 A;  4IHJ E;  5A1L A;  2EHO C;  1MND A;  3PUW F;  4EED A;  2V7J A;  4ZK4 A;  3RYF E;  2Y8D A;  2W67 A;  4P0B A;  4EZ1 A;  5ABF A;  2XQA A;  1MIY A;  4WNK A;  2YDQ A;  2E9X D;  2XQ6 A;  3WI3 A;  1E2A A;  4CXW A;  2WBL A;  4BAY B;  4CN4 A;  4A56 A;  5HWX A;  5AFU L;  5AQT B;  2DNX A;  3O1H A;  2FJE A;  1OED C;  1KNR A;  3SS1 A;  3A5X A;  1YQ3 A;  3Q5W A;  3ZJ2 A;  3CQG B;  5LBM A;  2XSB A;  2BR7 A;  2JPF A;  3ETV A;  5AFN A;  1S94 A;  3PUG A;  1ZEE A;  3IBP A;  4DUZ T;  4TNW A;  4Z91 A;  5ADX L;  3JC6 D;  3KVA A;  2YEV C;  3WTL A;  3ZDH A;  2J47 A;  1WYC A;  3PMZ A;  2ZMA A;  4KHP T;  3E0Z A;  2MTQ A;  3DP7 A;  3MKD A;  4KBM B;  1UX5 A;  4DV3 T;  4B3T T;  1T7S A;  3WAJ A;  2JMK A;  4EOZ B;  1OXZ A;  1QUU A;  4TZ4 C;  2PJQ A;  4O2B E;  3GWH A;  3F57 A;  4O4J E;  1MMN A;  2A9U A;  4I55 E;  2XTL A;  3VU7 H;  5FY0 A;  4H9Q C;  1GQE A;  4KMC A;  2PFV A;  2VL0 A;  2VKH A;  2V6Y B;  3AXJ A;  3SH1 A;  4AIU A;  3AE4 A;  5FMN A;  4MAL A;  3HA4 A;  5LGU B;  4YJ2 E;  4AQF A;  2VQE T;  4UXN B;  1NEK A;  5LOV E;  1HX1 B;  3PUY F;  2XUE A;  4U72 A;  4O8S A;  4PAG A;  1IZN B;  2YIN A;  2Q9Q D;  2IML A;  5GON E;  3RIA A;  3N9P A;  3ZST A;  2UZ6 A;  3PDY A;  2LT3 A;  4U74 A;  4JBW F;  2LSG A;  2CA5 A;  5AQK B;  4NXN T;  4GYS A;  4AQF C;  3R6N A;  4KP3 C;  3WTM A;  3WIP A;  2V8S V;  3N9O A;  3H3A A;  3CVR A;  2NW9 A;  4EAH A;  3N2G E;  2BS3 A;  4UV8 B;  2J1D G;  3BQI A;  4QXC B;  5IUX A;  3RX6 A;  4L0R A;  3RHW A;  4YTN A;  4DMW A;  4H9S E;  3ZYK A;  2BBH A;  2VAS A;  4AQY T;  4JLE A;  2IAK A;  2CBI A;  4UIG A;  3B57 A;  4EIW A;  1QLB A;  2WU5 A;  3RGL A;  4PW8 A;  3UUN A;  5HCJ A;  4XZC A;  5FY7 A;  5C3J A;  2LM9 A;  1J5E T;  5BP0 A;  1HCI A;  4I43 B;  5L3F B;  4HFC A;  2W2U A;  3AAI A;  3KIN B;  1QSD A;  2XQY A;  2WB5 A;  5HEG A;  1N32 T;  1KK7 A;  2YDS A;  2LSI A;  3RQU A;  2WDV A;  4ZEY A;  5EK4 A;  2DL1 A;  1X79 A;  4ZI3 C;  4QH1 A;  5AQG B;  2Y7Y A;  2WDQ A;  2BYR A;  4UVB B;  3KV6 A;  1O3X A;  5AFM B;  2A72 A;  1FIO A;  3EDU A;  3PUV F;  4YJ3 E;  4EEB A;  1VCS A;  4ZOL E;  3EAB A;  4CXY A;  1BR2 A;  3TKL B;  5JRC B;  2H88 A;  2JIW A;  5KXJ A;  3L3P A;  5FYM A;  2BG9 A;  5L2L A;  1HNX T;  5FXX A;  4L5G A;  4LF9 T;  1NEN A;  2K5B B;  4CXX A;  2EHO D;  5LNK A;  3PEO A;  5DQW A;  2MYS A;  4IT4 A;  1Y01 A;  4EXT A;  2XYT A;  2QA7 A;  3SOL A;  3RRC A;  4OFZ A;  3RC8 A;  4BJN A;  3WTH A;  3LBX A;  2V1D B;  2NTY A;  4LMJ A;  5F5W A;  5JH7 E;  4QX7 B;  2UXX B;  3GN5 A;  5CA1 E;  2WMN A;  3RYI E;  1D1C A;  1IBM T;  5LBQ B;  4ZR6 A;  2WSS V;  2NW7 A;  1YW0 A;  3L39 A;  2CXF A;  2C5I T;  1T98 A;  3MA9 A;  3OYX A;  2A3D A;  2JQK A;  4PFP A;  2X67 A;  2E9X B;  2Y54 A;  2LLY A;  2WS3 A;  5JR9 B;  2L8K A;  3SWH A;  2D5U A;  3RYC E;  2XNU A;  4AKR B;  4HWF A;  3N5L A;  1SHZ C;  1XZY A;  1FMV A;  1W9R A;  5FVK A;  2NOX A;  3N9Q A;  3RKG A;  1UCU A;  3QOF A;  4AFG A;  4FRR A;  3LDQ B;  2ZM2 A;  5ETW A;  2CCQ A;  3TLV A;  3EHZ A;  2WCA A;  2ACZ A;  4X1K E;  3U8L A;  4F8H A;  3LJC A;  5AFL A;  5AFK A;  3N9N A;  1Z0P A;  2NW8 A;  3X1D A;  4IDP A;  3UFG A;  5AQJ B;  3ESL A;  3I0Q A;  1HG5 A;  5JDF A;  2BKP A;  4UM3 A;  1MMD A;  2CLY B;  2XZE A;  2VKJ A;  4DR7 T;  4PJJ A;  3LBX B;  5BR8 T;  5LXT E;  3I9Y A;  2XZ5 A;  4A97 A;  5JDM A;  5HYA A;  3MK7 C;  3CK6 A;  2XQ7 A;  4PJM A;  5F3J A;  4DVD A;  3SFD A;  2VVN A;  2VKO A;  3H3M A;  2X66 A;  1XNQ T;  2W8F A;  4ZRU A;  4DV6 T;  1SA0 E;  1U5P A;  2X9X A;  3BQL A;  2IC6 A;  3EVY A;  5KDM C;  4ALX A;  5L3B B;  2Q9Q B;  5H6Q B;  3O4X E;  4F6R C;  3KFW X;  3ONX A;  5KE4 A;  5L3D B;  3TLT A;  4GYR A;  3PJA A;  4MBQ A;  3P4W A;  3PUX F;  3C4X A;  2XQ4 A;  4QAB A;  1D0Y A;  2XM2 A;  3UQ4 A;  3AAE B;  3IEE A;  4AFH A;  4ZS2 A;  4EV6 A;  5FXW A;  5C8Y E;  3TLS A;  3C4Z A;  4DBQ A;  3D0T A;  3DTO A;  4DBM A;  3IF8 B;  2VWA A;  3AA6 B;  2VQF T;  1WFD A;  2X68 A;  3N2K E;  5EK3 A;  5AQU B;  3K8P C;  3ZCJ A;  3RF1 A;  3SQ9 A;  5FY1 A;  3PUS A;  2BVL A;  4ZI3 D;  4V1A v;  5E0O A;  2HN2 A;  5AQH B;  1I9B A;  3IGQ A;  4NUV A;  3OPC A;  2LKH A;  3CKD A;  4HTE A;  2Y48 B;  3KVB A;  4ANJ A;  4IGU A;  3KV9 A;  3PV0 F;  3C64 A;  3PE0 A;  1HG2 A;  4YHJ A;  1D0Z A;  1G73 A;  2KWI B;  5LB7 B;  2D9D A;  2D2S A;  4KX6 A;  4DV2 T;  1YXR A;  4H9P C;  1XNR T;  2JJ9 A;  4QX8 B;  2WY2 A;  1XDP A;  4WV9 A;  5L3E B;  2W62 A;  3E08 A;  4IL4 A;  2PBI A;  5LCY A;  1IAP A;  4XHE A;  3UUB A;  4UF0 A;  5HXH A;  4GK0 E;  2CEA A;  1LVF A;  1DU2 A;  5J0Z A;  2BBJ A;  4KI0 F;  4JEH B;  3PU8 A;  3EAM A;  2H3R A;  3M65 A;  1N34 T;  3ZMS B;  3ZYL A;  4UXU A;  5JQG E;  2HN1 A;  3H37 A;  3ZT5 A;  2UXD T;  4IRE A;  5CO5 A;  1FEW A;  1IJ6 A;  2VKD A;  1T72 A;  4O4H E;  1SUM B;  5AIN A;  4HWI B;  2CHO A;  2EHO B;  3P4S A;  4JUY A;  3SFE A;  5CB4 E;  4EZH A;  3KV4 A;  3ZJ1 A;  4NUU A;  4LMK A;  3FZF B;  3FXD B;  4ERR A;  5LP6 E;  5FJV A;  5J5H A;  3UU6 A;  3AB3 B;  1D1B A;  4C91 A;  4ZI2 C;  4M1P A;  3ZC1 A;  5AQS B;  2XJ7 A;  4IDO A;  4YTP A;  1Z8U A;  4CZZ B;  2XAG B;  1OED B;  2JRK A;  2X9W A;  2CRB A;  4H9O C;  1IJ5 A;  5DJQ C;  4B3M T;  4H9R C;  2GK9 A;  4LFA T;  2OV9 A;  4CN6 A;  4AXP A;  3C4W A;  2AE9 A;  4QH5 A;  5ABF B;  4JV5 T;  2Y58 A;  3C79 A;  2BKO A;  2DWG A;  2VB6 A;  3ETU A;  5HXC A;  4GKJ T;  4U2Y A;  2YU1 A;  1ZKE A;  2JQH A;  2H7O A;  2Y56 A;  3AA0 B;  3GUA A;  3WTJ A;  3ZPO A;  4CI1 B;  4LF7 T;  2PTF A;  3U8M A;  1UK5 A;  3AE5 A;  4UY2 A;  2IIU A;  3C84 A;  3FZL B;  1I94 T;  4ZZC A;  3DJB A;  4XAX B;  2UXN B;  4EYU A;  3HKB E;  5BW2 A;  3BQK A;  2CMR A;  2K48 A;  2FBW A;  4ADZ A;  2BVM A;  2QRX A;  5HXS A;  5L47 A;  1G8X A;  2PG8 A;  4E7Z A;  3E22 E;  2H89 A;  4GOU A;  3UU4 A;  3KV5 A;  4TV8 E;  1HF8 A;  5CJ5 A;  3CX6 B;  1YKE B;  3F31 A;  2CWY A;  4ILU A;  4Q25 A;  4ZK1 A;  2XQ8 A;  3ZN1 B;  3HKC E;  2RA1 A;  5LJM A;  4ASK A;  4HFD A;  4P1N A;  3VR8 A;  4EGW A;  4D01 A;  3K3O A;  2WM9 A;  2DI4 A;  5FKY A;  3PU3 A;  2Z6E A;  1N36 T;  3AXJ B;  4DR4 T;  2M67 A;  5J5G A;  4JYA T;  4QKN A;  1WLX A;  1V9D A;  1JNZ A;  1UUR A;  3QC9 A;  2X0H A;  3AEF A;  3P8C D;  2UUB T;  2LRK A;  1L0V A;  1UGO A;  3PUR A;  5ABE A;  5AQV B;  2XNT A;  3B13 A;  4H9N C;  4HKA A;  3JAD A;  3Q2M A;  1KF6 A;  4IDN A;  3T4M A;  4CI2 B;  5JRE A;  1ZV4 X;  4ILB A;  5AQR B;  1ZP0 A;  4JI2 T;  2B76 A;  4WZX A;  3ZMT B;  4AKH A;  3N9L A;  1WR0 A;  2FJD A;  3C50 A;  5KMG P;  2HPJ A;  2YN6 A;  1ZHC A;  2LEH A;  3M3Z B;  5JDG A;  3VRA A;  2UXB T;  4HFH A;  2IUB A;  4XK9 A;  2VVS A;  2LSY A;  4ISS A;  2G0U A;  2BJ0 A;  2OA5 A;  5BRX A;  4ZJS A;  3ZCI A;  4PNI A;  2BR8 A;  1N33 T;  3ANW A;  3FBZ A;  4LF6 T;  2ZJV A;  5JR9 C;  3IA3 A;  3LK2 B;  3VKH A;  5LG3 A;  3ZMZ B;  2RPA A;  1WRD A;  2K9A A;  4DND A;  4IIJ E;  5AFH A;  3OYZ A;  4I4T E;  4TNV A;  1OWA A;  4HFV A;  5AQM B;  2M6I A;  3Q5E A;  2BYP A;  5AQO B;  4QAA A;  4DR3 T;  4MLK A;  3IHR A;  5LGN B;  4UM3 P;  2BDE A;  3J7Y q;  2DLR A;  2KT9 A;  4YT0 A;  4MFR A;  5J5F A;  4I0U A;  5CFB A;  1MMA A;  4IE5 A;  2XAQ B;  3OBV E;  2BYN A;  3CIR A;  1CHU A;  3O1I A;  2I59 A;  4HEA A;  1XDO A;  2KSR A;  3ZN0 B;  2Y57 A;  2CLY C;  4B6X A;  1BR0 A;  4QXH B;  2C9T A;  3RQW A;  5C2T A;  1SE7 A;  5AQN B;  5AQQ B;  2F4V T;  4UV9 B;  3K1S A;  2BG9 B;  3ZSS A;  4FI5 A;  3UT5 E;  2LE8 A;  4FJO A;  1HNW T;  3NWI A;  2CHN A;  5ABH A;  5ABG A;  4JI1 T;  1UX2 A;  3GA8 A;  3HKE E;  5HXR A;  3U8K A;  3MAC A;  3NBX X;  2X00 A;  2QGS A;  4DMV A;  3UUL A;  2ZM6 T;  2IDO B;  3LK4 2;  4UM3 S;  4B5D A;  1KNP A;  4JI0 T;  3PUZ F;  3AEB A;  2E5L T;  4U3C A;  2JQQ A;  3GN5 B;  2ES0 A;  2W63 A;  4LML A;  1W0B A;  2CPT A;  4LFB T;  2X51 A; 
#chains in the Genus database with same CATH homology
 4QH5 A;  4QAA A;  4HFB A;  5LXB A;  2WNJ A;  4XHE A;  3UUB A;  5KE4 A;  3TLT A;  2Y58 A;  4UM3 P;  2XYS A;  2XNV A;  3C79 A;  3WTN A;  2BR7 A;  4NZB A;  4TWH A;  4HFI A;  5J5I A;  3P4W A;  5J0Z A;  3WTM A;  2XQ4 A;  4QAB A;  3RI5 A;  3WIP A;  2XNT A;  4AFG A;  5AFN A;  4ZZB A;  4FRR A;  3WTO A;  4IL9 A;  3WTI A;  3EAM A;  5J5F A;  3UQ4 A;  3U8N A;  3JAD A;  5CFB A;  4BQT A;  2PGZ A;  2PH9 A;  3SQ6 A;  4AFH A;  3LSV A;  4TNW A;  2Y56 A;  4Z91 A;  3T4M A;  2BYN A;  3GUA A;  3WTJ A;  5L4E A;  2MAW A;  3U8M A;  3TLV A;  3WTL A;  3EHZ A;  3TLS A;  4UXU A;  3ZDH A;  2BG9 A;  2WZY A;  5IUX A;  2BYS A;  3PMZ A;  3ZDG A;  4UY2 A;  4IRE A;  5CO5 A;  4ILB A;  3RHW A;  3JAF A;  3UU5 A;  5SYO A;  2M6B A;  2ZJU A;  4F8H A;  3C84 A;  3U8L A;  2KSR A;  5HCM A;  4ZZC A;  2XQ3 A;  3UU8 A;  3WTK A;  2XQ9 A;  4DBM A;  5AFL A;  5AFK A;  4QAC A;  2Y57 A;  5BW2 A;  5JME A;  4ILA A;  4TWF A;  1UW6 A;  5AIN A;  2BG9 C;  4QH4 A;  2W8G A;  5L47 A;  2YN6 A;  4Z90 A;  2C9T A;  2BG9 E;  3RQW A;  3PEO A;  3UQ7 A;  5HCJ A;  4UM3 A;  2YMD A;  4PIR A;  2BYQ A;  4AFT A;  5L4H A;  4HFH A;  3UU4 A;  2BG9 B;  2XYT A;  2YME A;  3UU3 A;  4XK9 A;  4TWD A;  3SQ9 A;  4ZJT A;  3P50 A;  1UV6 A;  5BP0 A;  2BJ0 A;  2LKG A;  4HFE A;  3WTH A;  4HFC A;  5BRX A;  4ZJS A;  2XZ5 A;  1I9B A;  3IGQ A;  5HEG A;  4LMK A;  2LKH A;  1OED A;  2VL0 A;  4A97 A;  2YKS A;  3TLU A;  3SH1 A;  4LMJ A;  4UM1 A;  5FJV A;  5J5H A;  3SIO A;  3UU6 A;  1UX2 A;  5AFM A;  4ZK1 A;  2XQ8 A;  4COF A;  2WN9 A;  3U8K A;  3RQU A;  2BR8 A;  2XZ6 A;  2XQ7 A;  3TLW A;  4ZK4 A;  2X00 A;  4HFD A;  4ZR6 A;  2QC1 B;  2YOE A;  5HEJ A;  4BFQ A;  5TVC A;  1OED E;  4EZ1 A;  4QH1 A;  2XQA A;  2ZJV A;  4D01 A;  4ILC A;  4NPP A;  2Y7Y A;  4X5T A;  3ZKR A;  5LG3 A;  2W8F A;  4UM3 S;  2BYR A;  1OED B;  4B5D A;  4ZRU A;  2WNC A;  3U8J A;  5AFJ A;  4A98 A;  3EI0 A;  5HEU A;  2XQ6 A;  2Y54 A;  5KZU A;  2WNL A;  2LLY A;  2X00 D;  5AFH A;  5J5G A;  5AFM B;  4HQP A;  4TNV A;  3RIA A;  3JAE A;  4WV9 A;  2XNU A;  4LML A;  3RIF A;  4ALX A;  2LM2 A;  5HEH A;  4IL4 A;  2XQ5 A;  2UZ6 A;  2M6I A;  1OED C;  2BYP A;  5HEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...