2BG9C

Refined structure of the nicotinic acetylcholine receptor at 4a resolution.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
369
structure length
369
Chain Sequence
VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISILRLRPELIWIPDIVLQNNNDGQYNVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEISMDLIIDPEAFTENGEWEIIHKPAKKNIYGDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLISFLAALAFYLPAESGEKMSTAICVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVVVNCGIVLNFHFRTPSTHSGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNRPPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ion channel/receptor
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Refined Structure of the Nicotinic Acetylcholine Receptor at 4A Resolution
pubmed doi rcsb
total genus 83
structure length 369
sequence length 369
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
C PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2bg9C02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bg9C01
5AFJA 3UU3A 4ILCA 4UY2A 4NZBA 5TVCA 4AFTA 4TNVA 5HEOA 4LMLA 5J0ZA 3U8KA 2BR7A 2M6IA 3ZKRA 4QH4A 1UV6A 1I9BA 2C9TA 3U8JA 2XNVA 2PGZA 2UZ6A 2M6BA 5J5FA 4ILAA 3U8LA 2XZ6A 4IL4A 3SQ9A 3TLWA 4TNWA 2Y56A 2WNLA 3WTOA 4Z90A 4HFDA 2BYSA 3TLTA 2YOEA 4COFA 5JMEA 4HFHA 4QH1A 2KSRA 5LXBA 4LMKA 3T4MA 4B5DA 4DBMA 4HFEA 4HQPA 3RI5A 2BYNA 3ZDHA 4WV9A 5AFLA 2W8FA 4BQTA 2MAWA 2YKSA 4ZK4A 2LKHA 4A98A 5AFMB 3RIAA 3P4WA 2XQAA 2WZYA 3SIOA 3RIFA 3RQWA 2BYRA 2WNJA 4X5TA 2XQ9A 2Y58A 5AFMA 5KZUA 3U8MA 4ZJSA 3U8NA 2WN9A 4UM1A 2XNTA 3IGQA 3WTKA 1OEDC 2BG9C 4HFBA 4Z91A 4A97A 2BJ0A 2X00A 3SH1A 4LMJA 4EZ1A 5HEHA 5J5IA 3PMZA 4UXUA 4UM3P 2XYTA 3WTJA 4QH5A 4QABA 2LKGA 2W8GA 3C79A 5J5GA 4AFGA 5FJVA 3WTHA 2XQ3A 2XQ5A 2XNUA 2YMDA 4ZK1A 2XZ5A 4TWHA 4ZJTA 4ILBA 5HEGA 4AFHA 3UU4A 2BR8A 4QACA 2BYPA 2WNCA 3LSVA 2VL0A 5J5HA 5BW2A 5BRXA 3RHWA 4FRRA 5HEUA 5AINA 3JADA 5SYOA 5LG3A 1OEDB 2BG9B 3EHZA 3P50A 3TLVA 5IUXA 5L4EA 2YMEA 4BFQA 4ZR6A 3UU5A 3UQ7A 4IREA 5BP0A 3UUBA 4TWDA 4F8HA 2ZJUA 1OEDA 2XYSA 2XQ8A 4NPPA 2XQ4A 5L47A 3EI0A 4XHEA 2BYQA 2LM2A 5HCMA 4ZRUA 2X00D 4ZZCA 5HEJA 5AFHA 4ZZBA 2LLYA 3JAFA 1UX2A 4PIRA 2QC1B 3PEOA 3WTIA 4D01A 5CO5A 4TWFA 2Y7YA 4UM3S 3JAEA 3EAMA 3UU8A 3TLUA 5L4HA 3SQ6A 3C84A 4UM3A 4HFCA 3WIPA 3GUAA 4HFIA 4ALXA 3WTLA 5HCJA 2Y54A 1OEDE 2BG9E 2Y57A 3RQUA 3WTMA 5AFNA 2BG9A 2ZJVA 4QAAA 4XK9A 5AFKA 3UU6A 2XQ7A 2PH9A 3ZDGA 5CFBA 3TLSA 2XQ6A 5KE4A 2YN6A 4IL9A 3WTNA 1UW6A 3UQ4A
chains in the Genus database with same CATH superfamily
2BDEA 4CN1A 2IC9A 4WW0A 4HWCA 4OX9T 3AE1A 2UXDT 4CI2B 3R84B 4IL4A 3JCFA 3C64A 1BR1A 1BR2A 3TLTA 5CB4E 2KSRA 2AE9A 1XNRT 2MTQA 2QRXA 5IYZE 2XAGB 3RRCA 2JQQA 2K5BB 1WLXA 1D1CA 4EEDA 2OLTA 3QNUA 3HI2A 2J47A 4YY3T 4ZOLE 3MXZA 1IJ5A 4XBFB 3PUXF 2CBJA 5LGTB 3SFDA 4UVCB 5C3JA 2XQ3A 1EZ3A 2KMFA 2FUPA 1XNQT 1M7KA 3ZN0B 4UVBB 2BYPA 5JH7E 2L8KA 3N9PA 4JI7T 3ANWB 1AJ3A 3FZHB 4DVDA 3KVAA 3NZPA 4HGAA 5HCMA 2F4VT 1US7B 5AFHA 2A9UA 3NWIA 5L4HA 2DWGA 4DR7T 2K24A 1HS7A 3WTMA 5AFNA 3OYZA 2WCAA 4DUZT 1SUMB 5FXXA 2Y56A 4U72A 3V5SA 2I59A 2WNLA 2MOZA 1OXZA 1HTJF 2D5UA 5LGUB 1OWAA 2G0UA 2WAUA 3AE2A 2BYNA 2KLQA 3EDVA 3RIAA 4HWIB 3GWHA 2WNJA 2V5DA 5EK2A 2WMNA 2Z6EA 3M65A 3VKHA 4HWDA 2CXFA 5ABGA 2OA5A 2E2AA 5J2TE 3RGLA 1HR0T 4JI3T 2XNUA 2YMDA 4ZK1A 4JEHB 3E22E 1D0ZA 2LHNA 4DR4T 3F57A 1QLBA 1MIVA 4BFQA 4UELA 3UQ7A 4X62T 5F3JA 3O1IA 2PFVA 3EI0A 5FMNA 4H9SE 2CEAA 2LM2A 2DLRA 3VKGA 2LJLA 3D0TA 1JNRA 4I43B 2B1EA 1BR4A 2W00A 2E9XC 2NW8A 4HFCA 2WZHA 3HKBE 4P0AA 3AE8A 3LK42 4LF4T 4UF0A 4ILUA 4HWHA 3ZDGA 4DR6T 4ASKA 2XAJB 4I0UA 4MLKA 4GKJT 2KZ7B 2W63A 4K0UA 1LVKA 2EHOB 3ZN1B 4I50E 5JR9B 1VCSA 4EAHA 2JPFA 3MKDA 5HXEA 5FXWA 2HH7A 5JVDE 2XZEA 4DBMA 3RX6A 2H88A 1GQEA 2E5LT 4PFPA 2LKHA 1N34T 4UIGA 5AFMA 4NXMT 3PUZF 4DV0T 2CE7A 4AIUA 3WAKA 4WBNE 2X00A 3BK9A 3QB5K 4AQYT 3ZJ2A 2WU2A 4QXBB 4QH5A 4CN4A 2LKGA 2N9DA 4ZI7E 3WTHA 4ILBA 4KP3C 2BR8A 1UCUA 3KV9A 4ZI2D 3OTOT 3K3QC 4OK0A 3GA8A 3RKOA 2V6YB 5BP0A 1XWMA 2L9QA 4TWDA 1OEDA 4QX7B 4WZXA 3ZCJA 3RC3A 2SPCA 2OV9A 4H9OC 2NR4A 4IGUA 2IHR1 2UXNB 3I0OA 2QC1B 3WTIA 5AQMB 5J2UE 5LB7B 1ZEEA 3AXJB 2X66A 2Y57A 3SFEA 2ZJVA 2V6XA 5CA1E 5CFBA 3H3AA 4JLEA 4QWNB 3ZC1A 2D0TA 1MMDA 2Q9QB 4TV9E 5AQLB 2YDQA 4P1NA 3MJXA 5JMEA 2DL1A 2C5JA 3AVSA 2XAQB 4BQTA 3HR0A 4ZK4A 5LXTE 4BA9A 2W0GA 2X0LB 5H6QB 3RH3A 4ISTA 3CPZA 4LF7T 4ERRA 3DTOA 2BG9C 3CKDA 5L3CB 4IDPA 2W66A 1YW0A 1LKXA 4UXUA 3IBPA 4DV7T 3I1AA 2BVLA 2W8GA 4PJJA 5LJMA 4AFGA 1SA0E 2WM9A 2VL0A 4X20E 1IBLT 3EHZA 3QC9A 3MACA 4AKRB 4U7IA 4O4JE 4QXHB 2RP4A 1SHZC 4YT0A 2VQET 2LSJA 2CLYC 4UEMA 1E7PA 2VB6A 3JAEA 3N9QA 2X67A 1VRBA 2XM1A 2NP9A 1OEDE 3NBXX 1UURA 4L0RA 3H37A 5AQJB 3Q5XA 3WTNA 2BKPA 4YXDA 2UXBT 1VCTA 3L8RA 5HWYA 2D9DA 4HWFA 1I9BA 3U8JA 2PGZA 2UZ6A 4ILAA 2XZ6A 3SQ9A 4ZS3A 5TAOA 3AA1B 4Z90A 3OVUA 3TKLB 3RIUC 4Z8XA 1L0VA 1FMWA 3ABVA 3N2OA 3ZDHA 5FNVE 2K3WA 1G73A 3MA9A 4X1YE 3P7IA 5KXJA 4CZZB 4EYUA 1NAFA 2V5CA 3OBVE 4X64T 5FP3A 1XMQT 2UU9T 2BKNA 2VK9A 1W0AA 3PUQA 3BQKA 4KBMB 4JV5T 2HHHT 4ZXLA 3PUGA 4O2AE 4TN7B 2NW9A 5HWXA 4HN9A 4QXCB 3RF1A 4JI2T 4PJNA 5LCYA 3R6NA 2FJAA 3NRYA 2VL8A 4U31A 2VWAA 5HEUA 5SYOA 2YMEA 4M1PA 4JI8T 2J4GA 2FJEA 2LT3A 3PUSA 5JRCB 2ZJUA 2LSKA 2RPAA 3ZSTA 2VKDA 5FKYA 3BQIA 4O2BE 1WCRA 1D1BA 2X00D 3IEEA 3IHRA 3RRWA 1YXRA 3PEOA 5LP6E 5AQVB 3TLUA 4YTNA 3LG7A 4IT4A 3HL6A 5LBMA 2P9BA 3DP7A 2Y54A 1YQ4A 5AQQB 2PJQA 5JQGE 1QSDA 3UQ4A 5H6RB 4AFTA 1FIOA 5HEOA 1IBKT 3QOFA 3HA4A 1FEWA 1LRZA 2YOEA 3FXEB 3C51A 4DNDA 4WV9A 2FBWA 3KDSE 5LG4A 2V1DB 4L5GA 5BMVE 5FVKA 5FY7A 2KWHA 2ODVA 3UULA 3B13A 3WAJA 4UM1A 4IHJE 4BAYB 2LSGA 1CUNA 3PMZA 4G63A 2XYTA 4LF8T 1HNWT 3P8CD 3H3MA 1MNEA 5AQOB 3L39A 5JREA 4K0KT 5AQFB 4AKGA 2CWYA 4J2CA 2L3LA 4ZJTA 2WNCA 3LSVA 3M3ZB 5AINA 5ABEA 3UU5A 2D0UA 2WMOA 3FXDB 3AE4A 5DABA 2MPKA 5EZYE 2DHRA 5AQNB 2XM2A 3P4RA 3PJAJ 3AB3B 1FJGT 2X9YA 4NUUA 2NOXA 3ZJ1A 5DJQC 2WDRA 1W09A 3F2EA 3HKDE 3FB2A 4EZ4A 4EIWA 5F8PA 2MBGA 2K48A 3E0ZA 4DBQA 3AE5A 3PV0F 4ZEYA 1ZV4X 2BBHA 3UFEA 3C98B 4JBWF 4EV6A 1WRDA 2ZMAA 3O4XE 3UU3A 3SRZA 1NEKA 1N32T 1KFYA 4QH4A 4U74A 2XNVA 2X9HA 2CXLA 3U8LA 2PTFA 4GYRA 5LJNA 5L3FB 2YU2A 4AI6A 4KI0F 2LSIA 3FZMB 3AE7A 2ZLYA 5ABFA 4ZI3D 4GK0E 2XASB 4PFOA 3ONXA 5A1LA 2BS2A 4PJMA 2FJDA 4KHPT 1W0BA 2ZM6T 3ONJA 4AFHA 2XTLA 4YTPA 2YINA 4YSZA 2XUEA 5JDGA 3VU7H 1V9DA 3ZSSA 3AAAB 3FBLA 2IW5B 1Z0PA 3JC6D 4L9IA 3UTKA 1UX2A 4PIRA 4O4LE 5GONE 3F31A 3E08A 5FL0A 2N2NA 5AQIB 4UM3A 2I0MA 5LHIB 2YEVC 2XJ7A 3CVRA 3Q5DA 5AQRB 1HG2A 2XQ7A 5ETWA 1S94A 2CHOA 5TVCA 4NZBA 4P09A 3RYCE 2M6IA 2PBIA 3P4PA 3GN5A 2UUAT 5KMGP 1KNZA 3N2KE 4EOZB 1T72A 3HKCE 2VKOA 3QK6A 3ZT7A 2YKSA 2IC6A 3L3PA 3LJCA 4OFZA 2BYRA 2H3RA 2Y58A 4U33A 5AQSB 2XY8B 3SOLA 3BQLA 4EYYR 3CIRA 1HNXT 1DU2A 5LHGB 1E1HB 3RIUA 5AQHB 4O8SA 4GK5E 4QACA 2CA5A 5LHHB 5BRXA 4B3RT 4JI5T 5L4EA 2CPTA 2WWUA 3LFMA 2V26A 1HX1B 5ADXL 3ZC0A 4A5XA 3ZMSB 4OHFA 2CHNA 4TUYE 3X1DA 3LK2B 1HX8A 4G2AA 2WSSV 4V1Av 3CQGB 2EHOC 4C90A 5JR9C 4IDOA 3C84A 3RLFF 3V5UA 4B3MT 3LBXA 3J9X1 3WIPA 5L2LA 5HAXA 2BG9E 2BBJA 5DQVA 5L3BB 4DBRA 1KEYA 2KNDA 2Y48B 4MBQA 3MZKB 4U3CA 4AXPA 3WI3A 3WTOA 4HFDA 4COFA 4NUVA 1MIYA 2HN2A 4YFSA 4B6XA 3RYHE 4LF6T 3SIOA 4GYSA 2UUCT 2E8IA 4UV8B 1HF8A 3VHLA 5BR8T 4IE7A 2BJ0A 4C91A 3K1SA 4O4IE 5AQPB 2LRLA 4DMWA 2E5VA 4TWHA 2XSAA 3AEFA 5LMNT 1HCIA 3RHWA 3ZMUB 5JDQA 4WNKA 4ZHQE 1UK5A 1W9RA 3ZEFB 1NENA 1UX5A 4DO0A 3AA0B 2W4XA 5AQGB 2V7MA 3U3IA 3RC8A 2WQYA 3ZMVB 3EUHA 4ZZBA 4I4TE 4HE8A 4TWFA 5LNKA 2Q9QC 3NZQA 2A3DA 3ONLC 2A2FX 4UF0B 2R6GF 5JDLA 2YN6A 5IWAT 4U7YA 4NIQA 2ODUA 3U8KA 2BR7A 3ZKRA 3CWZB 2HN1A 5L3DB 2JQKA 2JJ9A 4HFVA 3OYXA 4PW8A 3VRBA 4QH1A 4MFRA 4LMKA 1QUUA 3KFWX 2ZM0A 3ZYLA 3ESLA 2RA1A 2ZM2A 4UV9B 5AFMB 2K9AA 3P4WA 4DV4T 3CK6A 3L09A 2IUBA 5KZUA 2WN9A 2J1DG 4I55E 4DV6T 2WP9A 5JDMA 2BS3A 2JQ9A 3LBXB 3C50A 4HTEA 5EK4A 4X1KE 2VURA 2ES0A 2CM0A 4PNIA 1OEDB 4IDQA 3TLVA 4IREA 1G8XA 1WR0A 2IAKA 1U4QA 1MNDA 3ANWA 2XAFB 1IAPA 4TZ4C 3AAIA 1R8IA 1WR6A 4WBOA 3ZPOA 5HEJA 1I94T 3CQCB 1XMOT 4UM3S 4ADZA 2VKJA 3N5LA 5HCJA 1KK7A 3TLSA 3AE9A 4IL9A 1XZYA 3PUYF 2V7LA 2AXDS 3O1HA 4LMLA 3W15B 2D2SA 3PJAA 3ETUA 5J5FA 3N9MA 4HKAA 3VR9A 3IA3A 3I9YA 4YJ3E 3T4MA 3SWHA 5JDHA 4LF5T 1MIWA 5J1GA 4JI4T 2W8FA 4AQFC 3CMLA 2M67A 3KV6A 4KX6A 2C0SA 1IBMT 3ZMTB 2UUBT 2WZYA 3MK7C 2JIWA 4X5TA 3U8NA 4H63V 5FL1A 3IF8B 3K3NA 3A7MA 2E9XA 5HEHA 3WTJA 3ETVA 2XQ5A 4YSXA 2BS4A 4Q25A 5HEGA 4XZCA 3ZT5A 2JQHA 5J5HA 3RKGA 3QB5A 3PTRB 4ZS2A 3JADA 2X68A 3PUWF 5LG3A 4DUYT 1MMGA 4F8HA 3EVYA 3CX6B 5HXHA 5L3EB 3UUXB 3ZCIA 1J5WA 2NWBA 5CO5A 4PJLA 4DR3T 2CRBA 4DV2T 4AKLA 4EB6E 4HFIA 5LGNB 3WTLA 2H7VC 4F6RC 5C8YE 3NVOA 2PH9A 2IIUA 2W2UA 4E7ZA 2X9WA 4ILCA 2JRKA 3PDYA 5J0ZA 3AEBA 2X9XA 2M6BA 4IDNA 2WDQA 2EHOA 4H9RC 2QGSA 5JR9A 3N9OA 1X79A 4ANJA 3NRXA 3A8YC 2XAHB 4HFEA 3AECA 3Q5WA 3DJBA 2MAWA 2KWIB 4EZHA 4A98A 3OKQA 4IIJE 3RIFA 4U2YA 4DIDB 3U8MA 1WYBA 4QX8B 4HFBA 1Z8UA 1YD8G 4ZI3C 3C79A 3CQXC 3I0QA 3EABA 5FJVA 5HXCA 1E2AA 2XZ5A 4GOUA 4KHZF 2W61A 4FRRA 2LE8A 3CX8B 2V6YA 1S35A 3PUAA 2ACXA 4XHEA 2BYQA 4TX5A 3O9XA 2B76A 2LLYA 4IE0A 5CGMA 4LFBT 3JC6C 4QHOA 3N2GE 4PAGA 4DMVA 2WU5A 4AQGA 2KXPB 1Y01A 2BG9A 4YTMA 4JI0T 3AXJA 4DV5T 3AE3A 4YSYA 4UY2A 5L3GB 2BZBA 4H9PC 3ZYMA 1IZNB 1ZOYA 1NWMX 3PURA 4LF9T 2E9XB 1M62A 3QUJA 2WDVA 5HXSA 5LOVE 3PU3A 2GK9A 1XDPA 3AEAA 2Q9QA 4HFHA 4BJMA 4GKKT 3Q5EA 5IHYA 3OJAA 4B5DA 3KV4A 3HKEE 3VR8A 1HG5A 5KDMC 2Y6XA 4PK6A 3RQWA 5CA0E 5AQUB 2XQ9A 2V7IA 3WTKA 4JI1T 4JEUB 4Z91A 5KX5E 2CXDA 5JTGA 4LMJA 2W62A 4KUMB 2XSBA 2CBIA 3UT5E 4DR2T 2QA7A 3KBUA 2DNXA 5AQTB 3K3OA 3P4SA 2W67A 3K8PC 1XDOA 2LM9A 3NKZA 5ABHA 1JNZA 5IUXA 4IE6A 2XQ8A 4NPPA 5L47A 3KVBA 4EXTA 2FJBA 2E9XD 5LMUT 5HYAA 4D01A 2WWVA 5FYMA 5HXRA 3O1JA 3UU8A 3SQ6A 2UXXB 4O4HE 3GUAA 2XHEB 4ZI2C 4YHHT 3RQUA 1YKEB 2XQ6A 3C4XA 5CJ5A 5AFJA 1D0YA 1T8BA 5C2TA 2C9TA 3T1HT 4FJOA 2X0YA 3Q2MA 2LHRA 2LRKA 2LEHA 4H63H 4TNWA 4UR9A 2VVSA 4ISSA 4CXYA 1ZHCA 5LXBA 2YDSA 1SE7A 3N9NA 3RI5A 1D0XA 3FZFB 5AFLA 4X66T 2JMHA 1YQ3A 3UUNA 1KNRA 3KBTA 5ABFB 2XQAA 2LOPA 4ZJSA 1I6ZA 3SS1A 4A97A 4IE5A 3G06A 5JDNA 4HEAA 4H9NC 4MALA 5FXVA 5J5IA 4CI1B 4DR1T 5LA6E 2EHOD 4X65T 2JMKA 3UU4A 3C4ZA 4AQFA 3EDUA 3FZLB 2ACZA 1WFDA 2BG9B 4H9QC 4ZR6A 4B3ST 3UUBA 4IE4A 4NXNT 2XQ4A 2VVNA 3CX7B 4TV8E 1HNZT 5JRCA 4EGWA 4ZRUA 1LVFA 3A5XA 1WYCA 2WBLA 3PUVF 3JAFA 4LFAT 4AISA 2Y7YA 4FI5A 4AKIA 4YJ2E 1O3XA 4JYAT 4ALXA 2DCFA 5E0OA 3I9WA 2LSYA 1KF6A 1HFAA 5AFKA 1UX4A 3U78A 3PU8A 5AQKB 3AA6B 1J5ET 4PK4A 4TNVA 2CLYB 3GN5B 4OYJA 4AKHA 1X9BA 1UV6A 2IMLA 1CHUA 3VRAA 3FHNA 1B7TA 2VASA 2NW7A 5FY1A 4LFCT 2BYSA 1MMAA 3UFGA 2LOSA 2V8SV 3J7Yq 4YHJA 3ZMZB 4X1IE 3P4QA 3AEDA 2IDOB 4IDZA 2WY2A 2XNTA 3SH1A 2DI4A 2N1GA 4PK5A 4UM3P 4DR5T 2Y8DA 2WZIA 1MMNA 4KMCA 5AFUL 2Q9QD 4UXNB 3PE0A 2DWKA 4CQIA 2PG8A 1Y64B 3C4WA 3LDQB 4CXWA 5BW2A 2V7JA 2BKOA 2XPKA 4EEBA 3AVRA 3P50A 2HPJA 2X0HA 2A72A 2KT9A 3KV5A 1UUSA 1N33T 2KINB 4ZZCA 4U2ZA 4OYKA 2QYWA 3UUMA 5F5WA 3OPCA 1ZP0A 4WYVA 3ZLIA 4E7SA 3B5MA 1J1JA 2J62A 4XK9A 5FXZA 2YK0A 3T1YT 4BJNA 1UW6A 3FZKB 2V7KA 3ZYKA 3RYIE 5M4YA 3GMIA 3TLWA 4A56A 2VKHA 1FMVA 3RYFE 2NTXA 4CXXA 5FY0A 5LBQB 4HQPA 2MYSA 2VQFT 1YKHB 1U5PA 2UXCT 2XQYA 3AAEB 1IJ6A 1T98A 2I6HA 4XAXB 5LYJE 2H89A 5DQWA 4YLHA 3S4UA 1H7CA 2YU1A 3Q9DA 3KINB 3AA7B 3N9LA 2YDRA 3IGQA 1OEDC 2C5IT 2CCQA 1T7SA 2QVAA 4EZ1A 5FVLA 4B3TT 4QABA 1KNPA 4GIWA 5J5GA 1UGOA 2CMRA 3AE6A 5JDFA 5EK3A 1BR0A 2BVMA 3RPUA 1N36T 3B57A 4JUYA 3ZT6A 2H7OA 2HPLA 2WS3A 3T8OA 2WB5A 4JI6T 2XYSA 1ZKEA 4QKNA 3LK3B 4MHCA 4UVAB 2X51A 3AEGA 4CN6A 3EAMA 4CI3B 2ZM8A 3FBZA 2C5KT 1VOMA 2NTYA 4P0BA 4N78D 2CWOA 4QAAA 4DV3T 3UU6A 1D1AA 5KE4A 3AEEA 4DV1T
chains in the Genus database with same CATH topology
5AFJA 3UU3A 4ILCA 4UY2A 4NZBA 5TVCA 4AFTA 4TNVA 5HEOA 4LMLA 5J0ZA 3U8KA 2BR7A 2M6IA 3ZKRA 4QH4A 1UV6A 1I9BA 2C9TA 3U8JA 2XNVA 2PGZA 2UZ6A 2M6BA 5J5FA 4ILAA 3U8LA 2XZ6A 4IL4A 3SQ9A 3TLWA 4TNWA 2Y56A 2WNLA 3WTOA 4Z90A 4HFDA 2BYSA 3TLTA 2YOEA 4COFA 5JMEA 4HFHA 4QH1A 2KSRA 5LXBA 4LMKA 3T4MA 4B5DA 4DBMA 4HFEA 4HQPA 3RI5A 2BYNA 3ZDHA 4WV9A 5AFLA 2W8FA 4BQTA 2MAWA 2YKSA 4ZK4A 2LKHA 4A98A 5AFMB 3RIAA 3P4WA 2XQAA 2WZYA 3SIOA 3RIFA 3RQWA 2BYRA 2WNJA 4X5TA 2XQ9A 2Y58A 5AFMA 5KZUA 3U8MA 4ZJSA 3U8NA 2WN9A 4UM1A 2XNTA 3IGQA 3WTKA 1OEDC 2BG9C 4HFBA 4Z91A 4A97A 2BJ0A 2X00A 3SH1A 4LMJA 4EZ1A 5HEHA 5J5IA 3PMZA 4UXUA 4UM3P 2XYTA 3WTJA 4QH5A 4QABA 2LKGA 2W8GA 3C79A 5J5GA 4AFGA 5FJVA 3WTHA 2XQ3A 2XQ5A 2XNUA 2YMDA 4ZK1A 2XZ5A 4TWHA 4ZJTA 4ILBA 5HEGA 4AFHA 3UU4A 2BR8A 4QACA 2BYPA 2WNCA 3LSVA 2VL0A 5J5HA 5BW2A 5BRXA 3RHWA 4FRRA 5HEUA 5AINA 3JADA 5SYOA 5LG3A 1OEDB 2BG9B 3EHZA 3P50A 3TLVA 5IUXA 5L4EA 2YMEA 4BFQA 4ZR6A 3UU5A 3UQ7A 4IREA 5BP0A 3UUBA 4TWDA 4F8HA 2ZJUA 1OEDA 2XYSA 2XQ8A 4NPPA 2XQ4A 5L47A 3EI0A 4XHEA 2BYQA 2LM2A 5HCMA 4ZRUA 2X00D 4ZZCA 5HEJA 5AFHA 4ZZBA 2LLYA 3JAFA 1UX2A 4PIRA 2QC1B 3PEOA 3WTIA 4D01A 5CO5A 4TWFA 2Y7YA 4UM3S 3JAEA 3EAMA 3UU8A 3TLUA 5L4HA 3SQ6A 3C84A 4UM3A 4HFCA 3WIPA 3GUAA 4HFIA 4ALXA 3WTLA 5HCJA 2Y54A 1OEDE 2BG9E 2Y57A 3RQUA 3WTMA 5AFNA 2BG9A 2ZJVA 4QAAA 4XK9A 5AFKA 3UU6A 2XQ7A 2PH9A 3ZDGA 5CFBA 3TLSA 2XQ6A 5KE4A 2YN6A 4IL9A 3WTNA 1UW6A 3UQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFJ A;  3UU3 A;  4ILC A;  4UY2 A;  4NZB A;  5TVC A;  4AFT A;  4TNV A;  5HEO A;  4LML A;  5J0Z A;  3U8K A;  2BR7 A;  2M6I A;  3ZKR A;  4QH4 A;  1UV6 A;  1I9B A;  2C9T A;  3U8J A;  2XNV A;  2PGZ A;  2UZ6 A;  2M6B A;  5J5F A;  4ILA A;  3U8L A;  2XZ6 A;  4IL4 A;  3SQ9 A;  3TLW A;  4TNW A;  2Y56 A;  2WNL A;  3WTO A;  4Z90 A;  4HFD A;  2BYS A;  3TLT A;  2YOE A;  4COF A;  5JME A;  4HFH A;  4QH1 A;  2KSR A;  5LXB A;  4LMK A;  3T4M A;  4B5D A;  4DBM A;  4HFE A;  4HQP A;  3RI5 A;  2BYN A;  3ZDH A;  4WV9 A;  5AFL A;  2W8F A;  4BQT A;  2MAW A;  2YKS A;  4ZK4 A;  2LKH A;  4A98 A;  5AFM B;  3RIA A;  3P4W A;  2XQA A;  2WZY A;  3SIO A;  3RIF A;  3RQW A;  2BYR A;  2WNJ A;  4X5T A;  2XQ9 A;  2Y58 A;  5AFM A;  5KZU A;  3U8M A;  4ZJS A;  3U8N A;  2WN9 A;  4UM1 A;  2XNT A;  3IGQ A;  3WTK A;  1OED C;  2BG9 C;  4HFB A;  4Z91 A;  4A97 A;  2BJ0 A;  2X00 A;  3SH1 A;  4LMJ A;  4EZ1 A;  5HEH A;  5J5I A;  3PMZ A;  4UXU A;  4UM3 P;  2XYT A;  3WTJ A;  4QH5 A;  4QAB A;  2LKG A;  2W8G A;  3C79 A;  5J5G A;  4AFG A;  5FJV A;  3WTH A;  2XQ3 A;  2XQ5 A;  2XNU A;  2YMD A;  4ZK1 A;  2XZ5 A;  4TWH A;  4ZJT A;  4ILB A;  5HEG A;  4AFH A;  3UU4 A;  2BR8 A;  4QAC A;  2BYP A;  2WNC A;  3LSV A;  2VL0 A;  5J5H A;  5BW2 A;  5BRX A;  3RHW A;  4FRR A;  5HEU A;  5AIN A;  3JAD A;  5SYO A;  5LG3 A;  1OED B;  2BG9 B;  3EHZ A;  3P50 A;  3TLV A;  5IUX A;  5L4E A;  2YME A;  4BFQ A;  4ZR6 A;  3UU5 A;  3UQ7 A;  4IRE A;  5BP0 A;  3UUB A;  4TWD A;  4F8H A;  2ZJU A;  1OED A;  2XYS A;  2XQ8 A;  4NPP A;  2XQ4 A;  5L47 A;  3EI0 A;  4XHE A;  2BYQ A;  2LM2 A;  5HCM A;  4ZRU A;  2X00 D;  4ZZC A;  5HEJ A;  5AFH A;  4ZZB A;  2LLY A;  3JAF A;  1UX2 A;  4PIR A;  2QC1 B;  3PEO A;  3WTI A;  4D01 A;  5CO5 A;  4TWF A;  2Y7Y A;  4UM3 S;  3JAE A;  3EAM A;  3UU8 A;  3TLU A;  5L4H A;  3SQ6 A;  3C84 A;  4UM3 A;  4HFC A;  3WIP A;  3GUA A;  4HFI A;  4ALX A;  3WTL A;  5HCJ A;  2Y54 A;  1OED E;  2BG9 E;  2Y57 A;  3RQU A;  3WTM A;  5AFN A;  2BG9 A;  2ZJV A;  4QAA A;  4XK9 A;  5AFK A;  3UU6 A;  2XQ7 A;  2PH9 A;  3ZDG A;  5CFB A;  3TLS A;  2XQ6 A;  5KE4 A;  2YN6 A;  4IL9 A;  3WTN A;  1UW6 A;  3UQ4 A; 
#chains in the Genus database with same CATH topology
 2BDE A;  4CN1 A;  2IC9 A;  4WW0 A;  4HWC A;  4OX9 T;  3AE1 A;  2UXD T;  4CI2 B;  3R84 B;  4IL4 A;  3JCF A;  3C64 A;  1BR1 A;  1BR2 A;  3TLT A;  5CB4 E;  2KSR A;  2AE9 A;  1XNR T;  2MTQ A;  2QRX A;  5IYZ E;  2XAG B;  3RRC A;  2JQQ A;  2K5B B;  1WLX A;  1D1C A;  4EED A;  2OLT A;  3QNU A;  3HI2 A;  2J47 A;  4YY3 T;  4ZOL E;  3MXZ A;  1IJ5 A;  4XBF B;  3PUX F;  2CBJ A;  5LGT B;  3SFD A;  4UVC B;  5C3J A;  2XQ3 A;  1EZ3 A;  2KMF A;  2FUP A;  1XNQ T;  1M7K A;  3ZN0 B;  4UVB B;  2BYP A;  5JH7 E;  2L8K A;  3N9P A;  4JI7 T;  3ANW B;  1AJ3 A;  3FZH B;  4DVD A;  3KVA A;  3NZP A;  4HGA A;  5HCM A;  2F4V T;  1US7 B;  5AFH A;  2A9U A;  3NWI A;  5L4H A;  2DWG A;  4DR7 T;  2K24 A;  1HS7 A;  3WTM A;  5AFN A;  3OYZ A;  2WCA A;  4DUZ T;  1SUM B;  5FXX A;  2Y56 A;  4U72 A;  3V5S A;  2I59 A;  2WNL A;  2MOZ A;  1OXZ A;  1HTJ F;  2D5U A;  5LGU B;  1OWA A;  2G0U A;  2WAU A;  3AE2 A;  2BYN A;  2KLQ A;  3EDV A;  3RIA A;  4HWI B;  3GWH A;  2WNJ A;  2V5D A;  5EK2 A;  2WMN A;  2Z6E A;  3M65 A;  3VKH A;  4HWD A;  2CXF A;  5ABG A;  2OA5 A;  2E2A A;  5J2T E;  3RGL A;  1HR0 T;  4JI3 T;  2XNU A;  2YMD A;  4ZK1 A;  4JEH B;  3E22 E;  1D0Z A;  2LHN A;  4DR4 T;  3F57 A;  1QLB A;  1MIV A;  4BFQ A;  4UEL A;  3UQ7 A;  4X62 T;  5F3J A;  3O1I A;  2PFV A;  3EI0 A;  5FMN A;  4H9S E;  2CEA A;  2LM2 A;  2DLR A;  3VKG A;  2LJL A;  3D0T A;  1JNR A;  4I43 B;  2B1E A;  1BR4 A;  2W00 A;  2E9X C;  2NW8 A;  4HFC A;  2WZH A;  3HKB E;  4P0A A;  3AE8 A;  3LK4 2;  4LF4 T;  4UF0 A;  4ILU A;  4HWH A;  3ZDG A;  4DR6 T;  4ASK A;  2XAJ B;  4I0U A;  4MLK A;  4GKJ T;  2KZ7 B;  2W63 A;  4K0U A;  1LVK A;  2EHO B;  3ZN1 B;  4I50 E;  5JR9 B;  1VCS A;  4EAH A;  2JPF A;  3MKD A;  5HXE A;  5FXW A;  2HH7 A;  5JVD E;  2XZE A;  4DBM A;  3RX6 A;  2H88 A;  1GQE A;  2E5L T;  4PFP A;  2LKH A;  1N34 T;  4UIG A;  5AFM A;  4NXM T;  3PUZ F;  4DV0 T;  2CE7 A;  4AIU A;  3WAK A;  4WBN E;  2X00 A;  3BK9 A;  3QB5 K;  4AQY T;  3ZJ2 A;  2WU2 A;  4QXB B;  4QH5 A;  4CN4 A;  2LKG A;  2N9D A;  4ZI7 E;  3WTH A;  4ILB A;  4KP3 C;  2BR8 A;  1UCU A;  3KV9 A;  4ZI2 D;  3OTO T;  3K3Q C;  4OK0 A;  3GA8 A;  3RKO A;  2V6Y B;  5BP0 A;  1XWM A;  2L9Q A;  4TWD A;  1OED A;  4QX7 B;  4WZX A;  3ZCJ A;  3RC3 A;  2SPC A;  2OV9 A;  4H9O C;  2NR4 A;  4IGU A;  2IHR 1;  2UXN B;  3I0O A;  2QC1 B;  3WTI A;  5AQM B;  5J2U E;  5LB7 B;  1ZEE A;  3AXJ B;  2X66 A;  2Y57 A;  3SFE A;  2ZJV A;  2V6X A;  5CA1 E;  5CFB A;  3H3A A;  4JLE A;  4QWN B;  3ZC1 A;  2D0T A;  1MMD A;  2Q9Q B;  4TV9 E;  5AQL B;  2YDQ A;  4P1N A;  3MJX A;  5JME A;  2DL1 A;  2C5J A;  3AVS A;  2XAQ B;  4BQT A;  3HR0 A;  4ZK4 A;  5LXT E;  4BA9 A;  2W0G A;  2X0L B;  5H6Q B;  3RH3 A;  4IST A;  3CPZ A;  4LF7 T;  4ERR A;  3DTO A;  2BG9 C;  3CKD A;  5L3C B;  4IDP A;  2W66 A;  1YW0 A;  1LKX A;  4UXU A;  3IBP A;  4DV7 T;  3I1A A;  2BVL A;  2W8G A;  4PJJ A;  5LJM A;  4AFG A;  1SA0 E;  2WM9 A;  2VL0 A;  4X20 E;  1IBL T;  3EHZ A;  3QC9 A;  3MAC A;  4AKR B;  4U7I A;  4O4J E;  4QXH B;  2RP4 A;  1SHZ C;  4YT0 A;  2VQE T;  2LSJ A;  2CLY C;  4UEM A;  1E7P A;  2VB6 A;  3JAE A;  3N9Q A;  2X67 A;  1VRB A;  2XM1 A;  2NP9 A;  1OED E;  3NBX X;  1UUR A;  4L0R A;  3H37 A;  5AQJ B;  3Q5X A;  3WTN A;  2BKP A;  4YXD A;  2UXB T;  1VCT A;  3L8R A;  5HWY A;  2D9D A;  4HWF A;  1I9B A;  3U8J A;  2PGZ A;  2UZ6 A;  4ILA A;  2XZ6 A;  3SQ9 A;  4ZS3 A;  5TAO A;  3AA1 B;  4Z90 A;  3OVU A;  3TKL B;  3RIU C;  4Z8X A;  1L0V A;  1FMW A;  3ABV A;  3N2O A;  3ZDH A;  5FNV E;  2K3W A;  1G73 A;  3MA9 A;  4X1Y E;  3P7I A;  5KXJ A;  4CZZ B;  4EYU A;  1NAF A;  2V5C A;  3OBV E;  4X64 T;  5FP3 A;  1XMQ T;  2UU9 T;  2BKN A;  2VK9 A;  1W0A A;  3PUQ A;  3BQK A;  4KBM B;  4JV5 T;  2HHH T;  4ZXL A;  3PUG A;  4O2A E;  4TN7 B;  2NW9 A;  5HWX A;  4HN9 A;  4QXC B;  3RF1 A;  4JI2 T;  4PJN A;  5LCY A;  3R6N A;  2FJA A;  3NRY A;  2VL8 A;  4U31 A;  2VWA A;  5HEU A;  5SYO A;  2YME A;  4M1P A;  4JI8 T;  2J4G A;  2FJE A;  2LT3 A;  3PUS A;  5JRC B;  2ZJU A;  2LSK A;  2RPA A;  3ZST A;  2VKD A;  5FKY A;  3BQI A;  4O2B E;  1WCR A;  1D1B A;  2X00 D;  3IEE A;  3IHR A;  3RRW A;  1YXR A;  3PEO A;  5LP6 E;  5AQV B;  3TLU A;  4YTN A;  3LG7 A;  4IT4 A;  3HL6 A;  5LBM A;  2P9B A;  3DP7 A;  2Y54 A;  1YQ4 A;  5AQQ B;  2PJQ A;  5JQG E;  1QSD A;  3UQ4 A;  5H6R B;  4AFT A;  1FIO A;  5HEO A;  1IBK T;  3QOF A;  3HA4 A;  1FEW A;  1LRZ A;  2YOE A;  3FXE B;  3C51 A;  4DND A;  4WV9 A;  2FBW A;  3KDS E;  5LG4 A;  2V1D B;  4L5G A;  5BMV E;  5FVK A;  5FY7 A;  2KWH A;  2ODV A;  3UUL A;  3B13 A;  3WAJ A;  4UM1 A;  4IHJ E;  4BAY B;  2LSG A;  1CUN A;  3PMZ A;  4G63 A;  2XYT A;  4LF8 T;  1HNW T;  3P8C D;  3H3M A;  1MNE A;  5AQO B;  3L39 A;  5JRE A;  4K0K T;  5AQF B;  4AKG A;  2CWY A;  4J2C A;  2L3L A;  4ZJT A;  2WNC A;  3LSV A;  3M3Z B;  5AIN A;  5ABE A;  3UU5 A;  2D0U A;  2WMO A;  3FXD B;  3AE4 A;  5DAB A;  2MPK A;  5EZY E;  2DHR A;  5AQN B;  2XM2 A;  3P4R A;  3PJA J;  3AB3 B;  1FJG T;  2X9Y A;  4NUU A;  2NOX A;  3ZJ1 A;  5DJQ C;  2WDR A;  1W09 A;  3F2E A;  3HKD E;  3FB2 A;  4EZ4 A;  4EIW A;  5F8P A;  2MBG A;  2K48 A;  3E0Z A;  4DBQ A;  3AE5 A;  3PV0 F;  4ZEY A;  1ZV4 X;  2BBH A;  3UFE A;  3C98 B;  4JBW F;  4EV6 A;  1WRD A;  2ZMA A;  3O4X E;  3UU3 A;  3SRZ A;  1NEK A;  1N32 T;  1KFY A;  4QH4 A;  4U74 A;  2XNV A;  2X9H A;  2CXL A;  3U8L A;  2PTF A;  4GYR A;  5LJN A;  5L3F B;  2YU2 A;  4AI6 A;  4KI0 F;  2LSI A;  3FZM B;  3AE7 A;  2ZLY A;  5ABF A;  4ZI3 D;  4GK0 E;  2XAS B;  4PFO A;  3ONX A;  5A1L A;  2BS2 A;  4PJM A;  2FJD A;  4KHP T;  1W0B A;  2ZM6 T;  3ONJ A;  4AFH A;  2XTL A;  4YTP A;  2YIN A;  4YSZ A;  2XUE A;  5JDG A;  3VU7 H;  1V9D A;  3ZSS A;  3AAA B;  3FBL A;  2IW5 B;  1Z0P A;  3JC6 D;  4L9I A;  3UTK A;  1UX2 A;  4PIR A;  4O4L E;  5GON E;  3F31 A;  3E08 A;  5FL0 A;  2N2N A;  5AQI B;  4UM3 A;  2I0M A;  5LHI B;  2YEV C;  2XJ7 A;  3CVR A;  3Q5D A;  5AQR B;  1HG2 A;  2XQ7 A;  5ETW A;  1S94 A;  2CHO A;  5TVC A;  4NZB A;  4P09 A;  3RYC E;  2M6I A;  2PBI A;  3P4P A;  3GN5 A;  2UUA T;  5KMG P;  1KNZ A;  3N2K E;  4EOZ B;  1T72 A;  3HKC E;  2VKO A;  3QK6 A;  3ZT7 A;  2YKS A;  2IC6 A;  3L3P A;  3LJC A;  4OFZ A;  2BYR A;  2H3R A;  2Y58 A;  4U33 A;  5AQS B;  2XY8 B;  3SOL A;  3BQL A;  4EYY R;  3CIR A;  1HNX T;  1DU2 A;  5LHG B;  1E1H B;  3RIU A;  5AQH B;  4O8S A;  4GK5 E;  4QAC A;  2CA5 A;  5LHH B;  5BRX A;  4B3R T;  4JI5 T;  5L4E A;  2CPT A;  2WWU A;  3LFM A;  2V26 A;  1HX1 B;  5ADX L;  3ZC0 A;  4A5X A;  3ZMS B;  4OHF A;  2CHN A;  4TUY E;  3X1D A;  3LK2 B;  1HX8 A;  4G2A A;  2WSS V;  4V1A v;  3CQG B;  2EHO C;  4C90 A;  5JR9 C;  4IDO A;  3C84 A;  3RLF F;  3V5U A;  4B3M T;  3LBX A;  3J9X 1;  3WIP A;  5L2L A;  5HAX A;  2BG9 E;  2BBJ A;  5DQV A;  5L3B B;  4DBR A;  1KEY A;  2KND A;  2Y48 B;  4MBQ A;  3MZK B;  4U3C A;  4AXP A;  3WI3 A;  3WTO A;  4HFD A;  4COF A;  4NUV A;  1MIY A;  2HN2 A;  4YFS A;  4B6X A;  3RYH E;  4LF6 T;  3SIO A;  4GYS A;  2UUC T;  2E8I A;  4UV8 B;  1HF8 A;  3VHL A;  5BR8 T;  4IE7 A;  2BJ0 A;  4C91 A;  3K1S A;  4O4I E;  5AQP B;  2LRL A;  4DMW A;  2E5V A;  4TWH A;  2XSA A;  3AEF A;  5LMN T;  1HCI A;  3RHW A;  3ZMU B;  5JDQ A;  4WNK A;  4ZHQ E;  1UK5 A;  1W9R A;  3ZEF B;  1NEN A;  1UX5 A;  4DO0 A;  3AA0 B;  2W4X A;  5AQG B;  2V7M A;  3U3I A;  3RC8 A;  2WQY A;  3ZMV B;  3EUH A;  4ZZB A;  4I4T E;  4HE8 A;  4TWF A;  5LNK A;  2Q9Q C;  3NZQ A;  2A3D A;  3ONL C;  2A2F X;  4UF0 B;  2R6G F;  5JDL A;  2YN6 A;  5IWA T;  4U7Y A;  4NIQ A;  2ODU A;  3U8K A;  2BR7 A;  3ZKR A;  3CWZ B;  2HN1 A;  5L3D B;  2JQK A;  2JJ9 A;  4HFV A;  3OYX A;  4PW8 A;  3VRB A;  4QH1 A;  4MFR A;  4LMK A;  1QUU A;  3KFW X;  2ZM0 A;  3ZYL A;  3ESL A;  2RA1 A;  2ZM2 A;  4UV9 B;  5AFM B;  2K9A A;  3P4W A;  4DV4 T;  3CK6 A;  3L09 A;  2IUB A;  5KZU A;  2WN9 A;  2J1D G;  4I55 E;  4DV6 T;  2WP9 A;  5JDM A;  2BS3 A;  2JQ9 A;  3LBX B;  3C50 A;  4HTE A;  5EK4 A;  4X1K E;  2VUR A;  2ES0 A;  2CM0 A;  4PNI A;  1OED B;  4IDQ A;  3TLV A;  4IRE A;  1G8X A;  1WR0 A;  2IAK A;  1U4Q A;  1MND A;  3ANW A;  2XAF B;  1IAP A;  4TZ4 C;  3AAI A;  1R8I A;  1WR6 A;  4WBO A;  3ZPO A;  5HEJ A;  1I94 T;  3CQC B;  1XMO T;  4UM3 S;  4ADZ A;  2VKJ A;  3N5L A;  5HCJ A;  1KK7 A;  3TLS A;  3AE9 A;  4IL9 A;  1XZY A;  3PUY F;  2V7L A;  2AXD S;  3O1H A;  4LML A;  3W15 B;  2D2S A;  3PJA A;  3ETU A;  5J5F A;  3N9M A;  4HKA A;  3VR9 A;  3IA3 A;  3I9Y A;  4YJ3 E;  3T4M A;  3SWH A;  5JDH A;  4LF5 T;  1MIW A;  5J1G A;  4JI4 T;  2W8F A;  4AQF C;  3CML A;  2M67 A;  3KV6 A;  4KX6 A;  2C0S A;  1IBM T;  3ZMT B;  2UUB T;  2WZY A;  3MK7 C;  2JIW A;  4X5T A;  3U8N A;  4H63 V;  5FL1 A;  3IF8 B;  3K3N A;  3A7M A;  2E9X A;  5HEH A;  3WTJ A;  3ETV A;  2XQ5 A;  4YSX A;  2BS4 A;  4Q25 A;  5HEG A;  4XZC A;  3ZT5 A;  2JQH A;  5J5H A;  3RKG A;  3QB5 A;  3PTR B;  4ZS2 A;  3JAD A;  2X68 A;  3PUW F;  5LG3 A;  4DUY T;  1MMG A;  4F8H A;  3EVY A;  3CX6 B;  5HXH A;  5L3E B;  3UUX B;  3ZCI A;  1J5W A;  2NWB A;  5CO5 A;  4PJL A;  4DR3 T;  2CRB A;  4DV2 T;  4AKL A;  4EB6 E;  4HFI A;  5LGN B;  3WTL A;  2H7V C;  4F6R C;  5C8Y E;  3NVO A;  2PH9 A;  2IIU A;  2W2U A;  4E7Z A;  2X9W A;  4ILC A;  2JRK A;  3PDY A;  5J0Z A;  3AEB A;  2X9X A;  2M6B A;  4IDN A;  2WDQ A;  2EHO A;  4H9R C;  2QGS A;  5JR9 A;  3N9O A;  1X79 A;  4ANJ A;  3NRX A;  3A8Y C;  2XAH B;  4HFE A;  3AEC A;  3Q5W A;  3DJB A;  2MAW A;  2KWI B;  4EZH A;  4A98 A;  3OKQ A;  4IIJ E;  3RIF A;  4U2Y A;  4DID B;  3U8M A;  1WYB A;  4QX8 B;  4HFB A;  1Z8U A;  1YD8 G;  4ZI3 C;  3C79 A;  3CQX C;  3I0Q A;  3EAB A;  5FJV A;  5HXC A;  1E2A A;  2XZ5 A;  4GOU A;  4KHZ F;  2W61 A;  4FRR A;  2LE8 A;  3CX8 B;  2V6Y A;  1S35 A;  3PUA A;  2ACX A;  4XHE A;  2BYQ A;  4TX5 A;  3O9X A;  2B76 A;  2LLY A;  4IE0 A;  5CGM A;  4LFB T;  3JC6 C;  4QHO A;  3N2G E;  4PAG A;  4DMV A;  2WU5 A;  4AQG A;  2KXP B;  1Y01 A;  2BG9 A;  4YTM A;  4JI0 T;  3AXJ A;  4DV5 T;  3AE3 A;  4YSY A;  4UY2 A;  5L3G B;  2BZB A;  4H9P C;  3ZYM A;  1IZN B;  1ZOY A;  1NWM X;  3PUR A;  4LF9 T;  2E9X B;  1M62 A;  3QUJ A;  2WDV A;  5HXS A;  5LOV E;  3PU3 A;  2GK9 A;  1XDP A;  3AEA A;  2Q9Q A;  4HFH A;  4BJM A;  4GKK T;  3Q5E A;  5IHY A;  3OJA A;  4B5D A;  3KV4 A;  3HKE E;  3VR8 A;  1HG5 A;  5KDM C;  2Y6X A;  4PK6 A;  3RQW A;  5CA0 E;  5AQU B;  2XQ9 A;  2V7I A;  3WTK A;  4JI1 T;  4JEU B;  4Z91 A;  5KX5 E;  2CXD A;  5JTG A;  4LMJ A;  2W62 A;  4KUM B;  2XSB A;  2CBI A;  3UT5 E;  4DR2 T;  2QA7 A;  3KBU A;  2DNX A;  5AQT B;  3K3O A;  3P4S A;  2W67 A;  3K8P C;  1XDO A;  2LM9 A;  3NKZ A;  5ABH A;  1JNZ A;  5IUX A;  4IE6 A;  2XQ8 A;  4NPP A;  5L47 A;  3KVB A;  4EXT A;  2FJB A;  2E9X D;  5LMU T;  5HYA A;  4D01 A;  2WWV A;  5FYM A;  5HXR A;  3O1J A;  3UU8 A;  3SQ6 A;  2UXX B;  4O4H E;  3GUA A;  2XHE B;  4ZI2 C;  4YHH T;  3RQU A;  1YKE B;  2XQ6 A;  3C4X A;  5CJ5 A;  5AFJ A;  1D0Y A;  1T8B A;  5C2T A;  2C9T A;  3T1H T;  4FJO A;  2X0Y A;  3Q2M A;  2LHR A;  2LRK A;  2LEH A;  4H63 H;  4TNW A;  4UR9 A;  2VVS A;  4ISS A;  4CXY A;  1ZHC A;  5LXB A;  2YDS A;  1SE7 A;  3N9N A;  3RI5 A;  1D0X A;  3FZF B;  5AFL A;  4X66 T;  2JMH A;  1YQ3 A;  3UUN A;  1KNR A;  3KBT A;  5ABF B;  2XQA A;  2LOP A;  4ZJS A;  1I6Z A;  3SS1 A;  4A97 A;  4IE5 A;  3G06 A;  5JDN A;  4HEA A;  4H9N C;  4MAL A;  5FXV A;  5J5I A;  4CI1 B;  4DR1 T;  5LA6 E;  2EHO D;  4X65 T;  2JMK A;  3UU4 A;  3C4Z A;  4AQF A;  3EDU A;  3FZL B;  2ACZ A;  1WFD A;  2BG9 B;  4H9Q C;  4ZR6 A;  4B3S T;  3UUB A;  4IE4 A;  4NXN T;  2XQ4 A;  2VVN A;  3CX7 B;  4TV8 E;  1HNZ T;  5JRC A;  4EGW A;  4ZRU A;  1LVF A;  3A5X A;  1WYC A;  2WBL A;  3PUV F;  3JAF A;  4LFA T;  4AIS A;  2Y7Y A;  4FI5 A;  4AKI A;  4YJ2 E;  1O3X A;  4JYA T;  4ALX A;  2DCF A;  5E0O A;  3I9W A;  2LSY A;  1KF6 A;  1HFA A;  5AFK A;  1UX4 A;  3U78 A;  3PU8 A;  5AQK B;  3AA6 B;  1J5E T;  4PK4 A;  4TNV A;  2CLY B;  3GN5 B;  4OYJ A;  4AKH A;  1X9B A;  1UV6 A;  2IML A;  1CHU A;  3VRA A;  3FHN A;  1B7T A;  2VAS A;  2NW7 A;  5FY1 A;  4LFC T;  2BYS A;  1MMA A;  3UFG A;  2LOS A;  2V8S V;  3J7Y q;  4YHJ A;  3ZMZ B;  4X1I E;  3P4Q A;  3AED A;  2IDO B;  4IDZ A;  2WY2 A;  2XNT A;  3SH1 A;  2DI4 A;  2N1G A;  4PK5 A;  4UM3 P;  4DR5 T;  2Y8D A;  2WZI A;  1MMN A;  4KMC A;  5AFU L;  2Q9Q D;  4UXN B;  3PE0 A;  2DWK A;  4CQI A;  2PG8 A;  1Y64 B;  3C4W A;  3LDQ B;  4CXW A;  5BW2 A;  2V7J A;  2BKO A;  2XPK A;  4EEB A;  3AVR A;  3P50 A;  2HPJ A;  2X0H A;  2A72 A;  2KT9 A;  3KV5 A;  1UUS A;  1N33 T;  2KIN B;  4ZZC A;  4U2Z A;  4OYK A;  2QYW A;  3UUM A;  5F5W A;  3OPC A;  1ZP0 A;  4WYV A;  3ZLI A;  4E7S A;  3B5M A;  1J1J A;  2J62 A;  4XK9 A;  5FXZ A;  2YK0 A;  3T1Y T;  4BJN A;  1UW6 A;  3FZK B;  2V7K A;  3ZYK A;  3RYI E;  5M4Y A;  3GMI A;  3TLW A;  4A56 A;  2VKH A;  1FMV A;  3RYF E;  2NTX A;  4CXX A;  5FY0 A;  5LBQ B;  4HQP A;  2MYS A;  2VQF T;  1YKH B;  1U5P A;  2UXC T;  2XQY A;  3AAE B;  1IJ6 A;  1T98 A;  2I6H A;  4XAX B;  5LYJ E;  2H89 A;  5DQW A;  4YLH A;  3S4U A;  1H7C A;  2YU1 A;  3Q9D A;  3KIN B;  3AA7 B;  3N9L A;  2YDR A;  3IGQ A;  1OED C;  2C5I T;  2CCQ A;  1T7S A;  2QVA A;  4EZ1 A;  5FVL A;  4B3T T;  4QAB A;  1KNP A;  4GIW A;  5J5G A;  1UGO A;  2CMR A;  3AE6 A;  5JDF A;  5EK3 A;  1BR0 A;  2BVM A;  3RPU A;  1N36 T;  3B57 A;  4JUY A;  3ZT6 A;  2H7O A;  2HPL A;  2WS3 A;  3T8O A;  2WB5 A;  4JI6 T;  2XYS A;  1ZKE A;  4QKN A;  3LK3 B;  4MHC A;  4UVA B;  2X51 A;  3AEG A;  4CN6 A;  3EAM A;  4CI3 B;  2ZM8 A;  3FBZ A;  2C5K T;  1VOM A;  2NTY A;  4P0B A;  4N78 D;  2CWO A;  4QAA A;  4DV3 T;  3UU6 A;  1D1A A;  5KE4 A;  3AEE A;  4DV1 T; 
#chains in the Genus database with same CATH homology
 5AFJ A;  3UU3 A;  4ILC A;  4UY2 A;  4NZB A;  5TVC A;  4AFT A;  4TNV A;  5HEO A;  4LML A;  5J0Z A;  3U8K A;  2BR7 A;  2M6I A;  3ZKR A;  4QH4 A;  1UV6 A;  1I9B A;  2C9T A;  3U8J A;  2XNV A;  2PGZ A;  2UZ6 A;  2M6B A;  5J5F A;  4ILA A;  3U8L A;  2XZ6 A;  4IL4 A;  3SQ9 A;  3TLW A;  4TNW A;  2Y56 A;  2WNL A;  3WTO A;  4Z90 A;  4HFD A;  2BYS A;  3TLT A;  2YOE A;  4COF A;  5JME A;  4HFH A;  4QH1 A;  2KSR A;  5LXB A;  4LMK A;  3T4M A;  4B5D A;  4DBM A;  4HFE A;  4HQP A;  3RI5 A;  2BYN A;  3ZDH A;  4WV9 A;  5AFL A;  2W8F A;  4BQT A;  2MAW A;  2YKS A;  4ZK4 A;  2LKH A;  4A98 A;  5AFM B;  3RIA A;  3P4W A;  2XQA A;  2WZY A;  3SIO A;  3RIF A;  3RQW A;  2BYR A;  2WNJ A;  4X5T A;  2XQ9 A;  2Y58 A;  5AFM A;  5KZU A;  3U8M A;  4ZJS A;  3U8N A;  2WN9 A;  4UM1 A;  2XNT A;  3IGQ A;  3WTK A;  1OED C;  2BG9 C;  4HFB A;  4Z91 A;  4A97 A;  2BJ0 A;  2X00 A;  3SH1 A;  4LMJ A;  4EZ1 A;  5HEH A;  5J5I A;  3PMZ A;  4UXU A;  4UM3 P;  2XYT A;  3WTJ A;  4QH5 A;  4QAB A;  2LKG A;  2W8G A;  3C79 A;  5J5G A;  4AFG A;  5FJV A;  3WTH A;  2XQ3 A;  2XQ5 A;  2XNU A;  2YMD A;  4ZK1 A;  2XZ5 A;  4TWH A;  4ZJT A;  4ILB A;  5HEG A;  4AFH A;  3UU4 A;  2BR8 A;  4QAC A;  2BYP A;  2WNC A;  3LSV A;  2VL0 A;  5J5H A;  5BW2 A;  5BRX A;  3RHW A;  4FRR A;  5HEU A;  5AIN A;  3JAD A;  5SYO A;  5LG3 A;  1OED B;  2BG9 B;  3EHZ A;  3P50 A;  3TLV A;  5IUX A;  5L4E A;  2YME A;  4BFQ A;  4ZR6 A;  3UU5 A;  3UQ7 A;  4IRE A;  5BP0 A;  3UUB A;  4TWD A;  4F8H A;  2ZJU A;  1OED A;  2XYS A;  2XQ8 A;  4NPP A;  2XQ4 A;  5L47 A;  3EI0 A;  4XHE A;  2BYQ A;  2LM2 A;  5HCM A;  4ZRU A;  2X00 D;  4ZZC A;  5HEJ A;  5AFH A;  4ZZB A;  2LLY A;  3JAF A;  1UX2 A;  4PIR A;  2QC1 B;  3PEO A;  3WTI A;  4D01 A;  5CO5 A;  4TWF A;  2Y7Y A;  4UM3 S;  3JAE A;  3EAM A;  3UU8 A;  3TLU A;  5L4H A;  3SQ6 A;  3C84 A;  4UM3 A;  4HFC A;  3WIP A;  3GUA A;  4HFI A;  4ALX A;  3WTL A;  5HCJ A;  2Y54 A;  1OED E;  2BG9 E;  2Y57 A;  3RQU A;  3WTM A;  5AFN A;  2BG9 A;  2ZJV A;  4QAA A;  4XK9 A;  5AFK A;  3UU6 A;  2XQ7 A;  2PH9 A;  3ZDG A;  5CFB A;  3TLS A;  2XQ6 A;  5KE4 A;  2YN6 A;  4IL9 A;  3WTN A;  1UW6 A;  3UQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...