2BG9C

Refined structure of the nicotinic acetylcholine receptor at 4a resolution.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
369
structure length
369
Chain Sequence
VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISILRLRPELIWIPDIVLQNNNDGQYNVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEISMDLIIDPEAFTENGEWEIIHKPAKKNIYGDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLISFLAALAFYLPAESGEKMSTAICVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVVVNCGIVLNFHFRTPSTHSGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNRPPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined Structure of the Nicotinic Acetylcholine Receptor at 4A Resolution
pubmed doi rcsb
molecule tags Ion channel/receptor
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
total genus 83
structure length 369
sequence length 369
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
C PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2bg9C02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bg9C01
2LKHA 4LMKA 2XQ6A 1UW6A 5L4EA 2Y7YA 4LMJA 4UM3S 5J5HA 1OEDA 4TWDA 4Z90A 2BR8A 2XQ5A 2W8FA 5AFHA 4ZK4A 2XQ8A 3WTOA 4NZBA 4BFQA 4HFIA 2PH9A 5KE4A 4A97A 3EAMA 2WNCA 2YMDA 4IL9A 3C79A 3C84A 2Y54A 3U8LA 2LLYA 4HFEA 4COFA 4UXUA 3ZDGA 4IREA 2XQ3A 5HEHA 4ZZBA 4IL4A 1I9BA 2YN6A 3RQWA 2XNUA 1UX2A 4LMLA 3IGQA 3WIPA 3UU3A 5LG3A 2XNVA 5LXBA 3WTJA 5KZUA 4XK9A 3UQ7A 3TLVA 5J5FA 5AFNA 3RIFA 2BYRA 4D01A 5BW2A 4QH5A 4FRRA 2C9TA 4ZK1A 2BG9B 5CFBA 3SQ9A 3P4WA 4EZ1A 4QH1A 2ZJUA 2XQ4A 4HFHA 5AFMB 4QACA 3WTNA 3RHWA 2M6BA 3UU8A 4HQPA 2BG9E 3TLSA 3JADA 2X00D 2BJ0A 4HFBA 5HEGA 3ZKRA 5HEOA 2YMEA 5BRXA 4ILAA 3TLUA 1UV6A 4XHEA 2XQAA 3EI0A 5CO5A 5J5GA 5AFJA 2BG9C 4X5TA 3SH1A 4TWFA 4UM3A 5AFKA 2XQ9A 4ZZCA 3T4MA 4WV9A 2WNLA 3SIOA 4AFHA 2BYSA 5JMEA 2BYPA 3JAFA 2LKGA 4QH4A 5HCJA 3UU6A 2XYSA 2WNJA 4A98A 3PMZA 2MAWA 4AFTA 3RI5A 2PGZA 3U8NA 3PEOA 2LM2A 3U8JA 3JAEA 4ALXA 5TVCA 5AFLA 4AFGA 4TNVA 4BQTA 3UU5A 2XNTA 4UM3P 1OEDC 3EHZA 2X00A 5AFMA 5IUXA 4ILBA 5SYOA 2VL0A 2QC1B 2Y57A 2XZ6A 3WTKA 2YOEA 2W8GA 3TLTA 4ZR6A 5FJVA 5HCMA 1OEDB 1OEDE 2BG9A 2XQ7A 2WZYA 4UM1A 4DBMA 3LSVA 4TNWA 4TWHA 3UQ4A 3TLWA 3UU4A 3WTHA 5AINA 3P50A 5BP0A 2YKSA 3WTLA 5HEUA 2KSRA 4ZJSA 2UZ6A 3GUAA 3SQ6A 3WTIA 5J0ZA 4NPPA 2WN9A 3U8MA 2Y58A 3WTMA 2Y56A 2BYNA 3ZDHA 4QABA 4B5DA 4ZJTA 2BR7A 4ILCA 4Z91A 5J5IA 4ZRUA 2BYQA 3UUBA 5L4HA 2XZ5A 2ZJVA 3RQUA 4UY2A 5L47A 3RIAA 4QAAA 2M6IA 4PIRA 3U8KA 4HFDA 5HEJA 4HFCA 4F8HA 2XYTA
chains in the Genus database with same CATH superfamily
2V6XA 2VKJA 1HNWT 2IAKA 1LRZA 4IL9A 4IDPA 4B3RT 2VASA 2D0UA 1I9BA 3N2KE 4KHZF 4QXHB 4PJJA 3AE8A 4UVAB 2FUPA 4JI2T 4ZK1A 4MHCA 4JI7T 3QB5K 4A56A 4HQPA 1CUNA 2YDQA 3AEBA 1KEYA 5BRXA 3SH1A 2KMFA 2WWUA 1N33T 4DV2T 3Q5XA 3RI5A 4ZI3D 4I55E 1MNEA 3CWZB 5JDFA 4I43B 2SPCA 4H9SE 3ZLIA 5FJVA 2ZMAA 2CXFA 3EUHA 4LFAT 3QB5A 2WS3A 2YDRA 4OYJA 3E22E 1CHUA 5AQIB 4M1PA 2XSBA 1FMWA 2XAGB 4X1IE 2BYNA 2CWYA 3PUAA 3EDUA 4DBRA 4UY2A 3AXJB 1M62A 3IBPA 1LVFA 2ODUA 1UW6A 1KFYA 5L2LA 3I9YA 3K8PC 1B7TA 3RX6A 3Q5DA 5ADXL 2YU2A 4UIGA 3C4XA 4TN7B 4HWFA 3PUGA 1J5ET 4K0UA 3RRWA 2J47A 1M7KA 3L39A 3RC8A 3OYXA 5JDNA 3AE9A 2CCQA 2B1EA 3L09A 4DR6T 4CI1B 2BYRA 2E2AA 5BR8T 2ZJUA 4HFHA 4CZZB 2WDQA 2M6BA 5C3JA 4Z8XA 3ZMVB 2YEVC 1IBKT 5CJ5A 1MMNA 4CQIA 4DR3T 2BYSA 3PUQA 1YQ4A 2VVNA 4KMCA 2MAWA 3PU8A 3RRCA 3U8NA 1J5WA 3PEOA 1FJGT 2E9XA 2NR4A 2YINA 2H88A 3EHZA 4V1Av 4H9NC 2ACZA 2D2SA 4YSZA 3FZMB 5HXEA 1HG5A 3K3QC 5AQGB 2XQ7A 4FI5A 2LRKA 4DV6T 1KNZA 4NXMT 4U2ZA 1T98A 3K3NA 3LBXA 4ISTA 2IMLA 5EZYE 2A3DA 4X62T 2W66A 3LK42 3CVRA 3PU3A 3R6NA 5HXRA 4X65T 3N9NA 4XAXB 4COFA 3AE6A 3N9PA 3ZSSA 1UX2A 4JBWF 1EZ3A 3VRBA 4AKHA 1KNPA 2Z6EA 1U4QA 1ZOYA 4X64T 4JEHB 4I0UA 4BJMA 2D5UA 4DVDA 4IIJE 5LYJE 2CA5A 3TLSA 2LEHA 3FZFB 1W09A 2FJDA 5LJNA 3UTKA 4YTNA 3JAFA 2NTYA 2PGZA 2R6GF 5LA6E 5FKYA 1UGOA 4O8SA 2DLRA 4YFSA 5IUXA 4JI3T 3WTKA 2BG9A 4DBMA 4UELA 5J1GA 3HKCE 3IHRA 4OK0A 4OX9T 4P0AA 5C8YE 2GK9A 3ZDHA 4PFOA 5AFUL 5AQJB 2ZJVA 5CA1E 4QAAA 2DCFA 2X9XA 2UXBT 4GK0E 3J9X1 2E9XD 3FXEB 4KI0F 4UV9B 2ACXA 3AEEA 1VRBA 2UXDT 2X0LB 1ZEEA 3ZDGA 3JC6C 3FZKB 5CB4E 1D1BA 3WIPA 2DWGA 5HWYA 4H63V 3WTJA 2N9DA 3A7MA 2B76A 3H37A 4FRRA 3M65A 2C9TA 3KV6A 3ZT6A 2LE8A 5JRCA 4YY3T 3WTNA 2H89A 2WZIA 4AQFA 5BMVE 3N9MA 4O2AE 4U3CA 2BG9C 1W9RA 5LOVE 4JI1T 2KXPB 3NZPA 3U8JA 4EOZB 1FMVA 5LBQB 3ZMTB 2UUBT 3C51A 2WDRA 3X1DA 4ILBA 4AXPA 4UM1A 4MALA 4EEDA 4ZS2A 5L3CB 1VCTA 1D0YA 2Y58A 1IBLT 4BA9A 4ZJTA 3AE4A 4KX6A 2OA5A 2HHHT 4QXCB 2H7OA 4EGWA 3AE1A 1HX1B 3H3AA 3UFEA 2UXCT 2VWAA 4C90A 4Z90A 2WY2A 3C64A 3ONXA 5JDMA 4H9OC 1QLBA 5KE4A 2Y8DA 4IT4A 3JCFA 3MA9A 3KVAA 2X67A 5JTGA 4BAYB 5IYZE 4AQFC 5TAOA 2XM2A 3ZCJA 5ABHA 1S35A 5JR9A 3N5LA 1I94T 5JVDE 2BS4A 2HH7A 1YW0A 3DTOA 2V7IA 1T8BA 2KWHA 3J7Yq 2JQKA 2VURA 2ZM8A 4EZ1A 5H6RB 4DIDB 4TV9E 4WBNE 2V7KA 1UX4A 3TLUA 5LXTE 1DU2A 2KT9A 4XBFB 4ZI2C 4L0RA 2BYPA 4U33A 2XYSA 4UEMA 2CWOA 4LF4T 3O1IA 4ALXA 2JRKA 5A1LA 2CRBA 4UM3P 1Y01A 4U72A 4AQYT 2IW5B 3MK7C 2J1DG 3UU4A 5HEUA 3WTIA 2WN9A 5L3FB 3C4ZA 4CXWA 2OLTA 3BQKA 1XNRT 3UUBA 2JQ9A 3RQUA 5FVKA 3RPUA 2M6IA 4NXNT 2VK9A 1ZHCA 3P4QA 2QYWA 1HFAA 4YT0A 4AI6A 5HAXA 2CBIA 5AFHA 4IE6A 2C0SA 2HN2A 2W63A 3DJBA 5FY7A 3AA0B 3RQWA 3D0TA 1KNRA 5LP6E 5AFNA 3PTRB 1U5PA 4QH5A 3M3ZB 4U74A 2J62A 3SQ9A 3P4WA 4NUVA 1N36T 2F4VT 4FJOA 1MMAA 3AE7A 1I6ZA 2YMEA 2V7LA 3G06A 2K5BB 4CXYA 5AQMB 5AQVB 3KBUA 4WV9A 4QH4A 4ZI2D 1UX5A 4UF0A 1BR2A 1NAFA 2LJLA 4PK4A 1US7B 3UU5A 2CE7A 2IIUA 2JJ9A 5JDGA 4TUYE 2MBGA 3VKGA 2IC9A 4ZEYA 1D1AA 2EHOD 3WTLA 5HXSA 3MACA 3AE3A 4ERRA 3H3MA 3N9QA 2D0TA 2N2NA 4QWNB 3OVUA 2JMKA 4WW0A 2UU9T 2X51A 4DR2T 5L3DB 3I9WA 1MIYA 4UM3S 3LG7A 1WRDA 5ETWA 5J5HA 5EK4A 4EYYR 4TWDA 3OPCA 1UCUA 3FB2A 3RH3A 1W0BA 2XHEB 3KV9A 1Z8UA 4P09A 4IREA 3E08A 4DNDA 4LMLA 3AE2A 4IDQA 2XNVA 3ZN1B 2WBLA 2I59A 4OYKA 2DI4A 3N9OA 3R84B 4ZHQE 5AQFB 3PDYA 4JUYA 2CM0A 2LSJA 4QH1A 2V5DA 3RKOA 1ZV4X 2YDSA 4DMWA 1AJ3A 5HEOA 2IC6A 2WDVA 3K1SA 2W2UA 2UXNB 2CHOA 4UF0B 2IDOB 1MMGA 4X1YE 2WNJA 3AAAB 2MOZA 5H6QB 5LGTB 5AFLA 4IE7A 3PJAA 5LCYA 3A5XA 4QHOA 3FBLA 5SYOA 2VVSA 2WB5A 4HKAA 3TLWA 4AKLA 2XJ7A 3P50A 2YKSA 4H9QC 1IAPA 2FJAA 5M4YA 2BR7A 5J5IA 3AEGA 5AQLB 3ONJA 4YJ2E 3AECA 2CXLA 1NEKA 3GA8A 2AE9A 2HPJA 3KFWX 3A8YC 3UULA 4WZXA 5L3BB 4HFIA 2X9WA 4ASKA 2CLYB 3U8LA 3CPZA 5HEHA 3KINB 2V7JA 2RP4A 1XNQT 2BKNA 1Y64B 3TLVA 1W0AA 3GN5B 1G8XA 2Y48B 2KLQA 3ABVA 4ADZA 3WAKA 5FYMA 1UK5A 2XUEA 4MBQA 4C91A 2BG9E 2HN1A 3AEDA 3RYCE 4DUZT 3GN5A 3RYHE 2XQAA 5AFKA 1WYCA 2XQ9A 1KF6A 3P7IA 2WNLA 3ZPOA 4EYUA 2CXDA 2UXXB 2X66A 4CN4A 2Q9QC 1ZP0A 4AFGA 1XDOA 5ABFB 2K24A 3HR0A 5AFMA 3ZC1A 4HGAA 2NP9A 2W8GA 3KVBA 2LSYA 5AQOB 5IHYA 3SRZA 4P0BA 1N34T 2ES0A 3C4WA 4TWHA 3WTHA 4QX7B 1HNZT 2X68A 3T1HT 4NPPA 5LBMA 3U8MA 5HXHA 3WTMA 2QRXA 4G2AA 4ZRUA 5LHGB 2L3LA 3CIRA 3O1HA 2P9BA 5AQTB 2BS3A 5ABEA 3RGLA 3PUWF 2C5IT 2RPAA 1D0ZA 4TZ4C 5L4EA 4JI0T 2RA1A 1OEDA 1HF8A 4ZK4A 2EHOC 4PW8A 1E2AA 4A97A 5EK3A 3CX7B 4X1KE 1HCIA 3JC6D 1BR1A 4GYSA 4U7YA 3KV5A 5LG3A 2A72A 3K3OA 4QXBB 4DV7T 3ETVA 4HTEA 4XK9A 2JQQA 2H7VC 3RIFA 2WCAA 3WI3A 1S94A 5FL0A 3LK3B 4DMVA 2ZM2A 5KMGP 4PJNA 4DV3T 3ANWA 4EZHA 4TX5A 3UU8A 3ZKRA 4UXNB 2E9XB 5LXBA 3EI0A 1D0XA 2XAJB 3UU6A 1XMQT 2BS2A 4ANJA 2UUAT 4P1NA 4UV8B 3CQGB 2X00A 3KBTA 4ZOLE 4ISSA 4LF8T 2QC1B 4EIWA 3TLTA 2XTLA 5HYAA 5DQVA 5F5WA 3ESLA 3P4SA 1YKHB 2WQYA 1YXRA 5AQNB 2CLYC 4GKJT 4ILCA 4Z91A 5ABFA 1IJ5A 3SFDA 2XASB 4LFBT 5JDQA 3VU7H 3RIUC 2WM9A 2XYTA 5LJMA 2WMOA 2H3RA 3AVSA 3C50A 2Y7YA 4KUMB 2CBJA 2IHR1 1HR0T 2K3WA 3ZEFB 3VR9A 3C84A 3VKHA 5JRCB 5KZUA 4O4JE 2EHOB 5BW2A 4O2BE 3O4XE 1WYBA 4X66T 3CQXC 3NBXX 2W62A 5CFBA 4ZXLA 5LHHB 3AA1B 4QACA 5LGUB 4HN9A 3ETUA 2V26A 2LOPA 2G0UA 3ZYLA 2Q9QB 2JIWA 2LHNA 2CMRA 2IUBA 2CHNA 2LSKA 3HL6A 3EDVA 3U78A 3ZYKA 4UM3A 4ZI7E 2KWIB 1O3XA 2M67A 3KDSE 3Q9DA 5KX5E 1WR6A 5CA0E 1X79A 3WAJA 3PUZF 3JAEA 5TVCA 2E9XC 4TNVA 5F8PA 5FY0A 2W0GA 4IDNA 2BZBA 1MIWA 3QOFA 4NIQA 4GYRA 4GKKT 4PAGA 1HS7A 2XZ5A 5FNVE 5F3JA 4F8HA 2X9YA 3DP7A 2YK0A 1HG2A 5AQUB 4HWCA 4U2YA 4OFZA 5LGNB 3N2OA 4CN6A 5KXJA 4I4TE 2BR8A 2LSGA 3EAMA 3C79A 2MYSA 4HFEA 3V5UA 4O4HE 4UXUA 2KZ7B 4PNIA 5DJQC 3MXZA 2YN6A 5JDHA 3BK9A 4JI6T 3IGQA 5ABGA 2WMNA 2JPFA 2AXDS 4B3TT 4WYVA 2WP9A 3MKDA 4DBQA 4PFPA 2XZEA 2DWKA 4HWHA 3NZQA 3OBVE 3LJCA 2XQ4A 4LFCT 5HXCA 4IDOA 3JADA 4H9PC 5HEGA 3EVYA 1R8IA 1OXZA 3PURA 1N32T 4E7ZA 4JYAT 2V8SV 3ZMUB 5J5GA 5BP0A 4X5TA 3AAIA 3T4MA 4N78D 3IF8B 4AFHA 5JMEA 1X9BA 2NW9A 3RYIE 1KK7A 2W00A 4YSXA 3ZCIA 3LBXB 2NWBA 4O4IE 2VL0A 2WAUA 3NVOA 3I1AA 3SOLA 2BVLA 1OEDE 3KV4A 4XZCA 3UQ4A 3AVRA 5AQPB 2MPKA 2CPTA 5JR9C 1XDPA 3IA3A 4AISA 4B5DA 4EEBA 2Q9QD 2E5LT 3AEAA 2ZM6T 4HFCA 4ZI3C 1XZYA 1WFDA 4WNKA 3C98B 4YXDA 1VCSA 1IBMT 1J1JA 2JMHA 3HKDE 2YMDA 1XMOT 3QNUA 2BBJA 3RF1A 1YKEB 3V5SA 3ZSTA 4HWIB 5DQWA 4PJLA 4DV1T 2KNDA 2JQHA 2KINB 3AXJA 5FL1A 5AFMB 4F6RC 3RHWA 3OYZA 3BQLA 4JEUB 2W61A 2XY8B 4E7SA 4ILAA 2LT3A 4B3MT 2BKPA 4HFVA 2I0MA 4CI2B 2LSIA 3F31A 1E1HB 4JI4T 2LM2A 3F57A 3PUVF 5LMNT 2C5JA 4DO0A 4WBOA 3ZJ2A 4L5GA 2DNXA 2C5KT 3NWIA 4X20E 3GWHA 3LSVA 4TNWA 4EV6A 4YTMA 2VKDA 2VQET 3CKDA 2UZ6A 3T1YT 4DV0T 2YU1A 3B13A 4BJNA 2QA7A 5HWXA 5L47A 1IZNB 2QVAA 3AAEB 3SFEA 4QABA 4LMJA 4LF6T 5C2TA 4YHHT 3I0QA 5FP3A 2W8FA 5KDMC 5FXZA 2V6YA 3WTOA 4BFQA 4AIUA 3MZKB 4GIWA 2LLYA 1NWMX 5JH7E 2XQ3A 4IL4A 4YSYA 5L3EB 3ANWB 3O1JA 2XQYA 3UQ7A 4IE4A 4JI5T 2X0YA 4D01A 1T7SA 5DABA 2WWVA 4AKRB 4GK5E 3FZLB 1SE7A 3P4RA 4YJ3E 2XAHB 3S4UA 4DR4T 5AQSB 2PJQA 4PK6A 3AB3B 3ZN0B 5L3GB 1UV6A 4XHEA 1D1CA 2V6YB 5J2TE 4TWFA 4ZZCA 4CI3B 3ZMSB 3SIOA 2LKGA 5JR9B 5LHIB 2LOSA 3I0OA 1H7CA 3NRXA 4YHJA 1LVKA 1XWMA 4HE8A 3HA4A 2WU5A 4BQTA 2L9QA 4HWDA 3CMLA 2V1DB 4U31A 2XAQB 2YOEA 3NRYA 4ZR6A 1OEDB 3BQIA 2UUCT 4KHPT 2WZYA 1LKXA 5IWAT 2A9UA 4IE5A 5AINA 3RC3A 3SWHA 1GQEA 4TV8E 2FJBA 3ZC0A 5JQGE 3QC9A 3L3PA 4IE0A 1WR0A 5L4HA 3CQCB 2FBWA 3RLFF 1UUSA 3O9XA 1IJ6A 5GONE 5AQQB 2LHRA 2X9HA 4U7IA 5AQHB 4UVCB 2XQ8A 4NZBA 3ZMZB 4DR7T 2WNCA 3B5MA 2Y54A 2Q9QA 4YLHA 1FEWA 3FZHB 3AEFA 3UU3A 4EB6E 5J2UE 2E5VA 1HNXT 3UUMA 3ZT7A 2XPKA 4LF7T 1YQ3A 4H63H 3U3IA 5FXXA 3F2EA 4AKIA 1Z0PA 3UUNA 3LDQB 2OV9A 1MMDA 2L8KA 2NW8A 3PUYF 4NUUA 2QGSA 3HKEE 2LRLA 3PMZA 4AFTA 2DHRA 2E8IA 3VRAA 1OWAA 2XNTA 3UT5E 4DR1T 2Y57A 4YTPA 4MLKA 4PJMA 4IGUA 2NW7A 3PUSA 3UUXB 2J4GA 4LF5T 4ZJSA 3SQ6A 5FY1A 3CX6B 1JNZA 2VKHA 2Y56A 3PJAJ 4JLEA 4JI8T 1MNDA 2BYQA 3OTOT 4B3ST 3SS1A 3RIAA 1BR0A 1MIVA 3Q5WA 3QK6A 2BKOA 4PIRA 4H9RC 2LKHA 4IDZA 4LMKA 2XQ6A 5LMUT 2D9DA 2XQ5A 4HEAA 1VOMA 3HI2A 2BDEA 1WCRA 2X0HA 1QUUA 3T8OA 4OHFA 3Q5EA 2NTXA 3PE0A 3RIUA 4EZ4A 4QX8B 3W15B 3TKLB 2NOXA 2WZHA 3LK2B 3AA7B 4EXTA 5EK2A 5AQKB 5LG4A 3L8RA 2XSAA 4KP3C 2WSSV 4UR9A 1L0VA 4Q25A 3P4PA 2W67A 4K0KT 4IHJE 1ZKEA 2X00D 2BJ0A 4HFBA 4JV5T 2ZLYA 4QKNA 1HTJF 5AFJA 1NENA 2VL8A 2K9AA 3CX8B 1SUMB 3EABA 4A98A 4UVBB 3PV0F 1OEDC 3AA6B 2ZM0A 2N1GA 1FIOA 5LB7B 2XZ6A 3E0ZA 5HCMA 4ZS3A 4LF9T 4CN1A 4PK5A 1YD8G 3MJXA 4GOUA 4MFRA 1UURA 2KSRA 3GUAA 1SA0E 4AKGA 2FJEA 2WU2A 2VKOA 3RKGA 1QSDA 2ODVA 5AQRB 3RYFE 2PTFA 5CGMA 3ZJ1A 4G63A 3U8KA 1HX8A 4EAHA 4DV4T 4O4LE 3LFMA 2W4XA 3N9LA 3B57A 2PH9A 3FXDB 2I6HA 4ZZBA 1G73A 2XNUA 5JREA 5LNKA 2K48A 2HPLA 2V7MA 1E7PA 5J5FA 4B6XA 2CEAA 3FHNA 3VHLA 5JDLA 4I50E 4A5XA 2BG9B 4DUYT 3ONLC 2LM9A 3Q2MA 2Y6XA 2BVMA 3FBZA 2XAFB 3OKQA 5FXWA 4CXXA 5FXVA 2BBHA 3P8CD 4ILUA 5HCJA 2VB6A 3CK6A 2PG8A 4KBMB 5FMNA 1BR4A 3ZYMA 2VQFT 3OJAA 4AQGA 2PBIA 2PFVA 3N2GE 4DV5T 2MTQA 3QUJA 4J2CA 1WLXA 1T72A 5E0OA 3ZT5A 3UFGA 3NKZA 2DL1A 4DR5T 2EHOA 2XM1A 2V5CA 2A2FX 5J0ZA 3HKBE 4L9IA 5FVLA 3VR8A 1JNRA 1SHZC 3GMIA 1V9DA 3AE5A 3IEEA 4HFDA 5HEJA 3PUXF 5CO5A
chains in the Genus database with same CATH topology
2LKHA 4LMKA 2XQ6A 1UW6A 5L4EA 2Y7YA 4LMJA 4UM3S 5J5HA 1OEDA 4TWDA 4Z90A 2BR8A 2XQ5A 2W8FA 5AFHA 4ZK4A 2XQ8A 3WTOA 4NZBA 4BFQA 4HFIA 2PH9A 5KE4A 4A97A 3EAMA 2WNCA 2YMDA 4IL9A 3C79A 3C84A 2Y54A 3U8LA 2LLYA 4HFEA 4COFA 4UXUA 3ZDGA 4IREA 2XQ3A 5HEHA 4ZZBA 4IL4A 1I9BA 2YN6A 3RQWA 2XNUA 1UX2A 4LMLA 3IGQA 3WIPA 3UU3A 5LG3A 2XNVA 5LXBA 3WTJA 5KZUA 4XK9A 3UQ7A 3TLVA 5J5FA 5AFNA 3RIFA 2BYRA 4D01A 5BW2A 4QH5A 4FRRA 2C9TA 4ZK1A 2BG9B 5CFBA 3SQ9A 3P4WA 4EZ1A 4QH1A 2ZJUA 2XQ4A 4HFHA 5AFMB 4QACA 3WTNA 3RHWA 2M6BA 3UU8A 4HQPA 2BG9E 3TLSA 3JADA 2X00D 2BJ0A 4HFBA 5HEGA 3ZKRA 5HEOA 2YMEA 5BRXA 4ILAA 3TLUA 1UV6A 4XHEA 2XQAA 3EI0A 5CO5A 5J5GA 5AFJA 2BG9C 4X5TA 3SH1A 4TWFA 4UM3A 5AFKA 2XQ9A 4ZZCA 3T4MA 4WV9A 2WNLA 3SIOA 4AFHA 2BYSA 5JMEA 2BYPA 3JAFA 2LKGA 4QH4A 5HCJA 3UU6A 2XYSA 2WNJA 4A98A 3PMZA 2MAWA 4AFTA 3RI5A 2PGZA 3U8NA 3PEOA 2LM2A 3U8JA 3JAEA 4ALXA 5TVCA 5AFLA 4AFGA 4TNVA 4BQTA 3UU5A 2XNTA 4UM3P 1OEDC 3EHZA 2X00A 5AFMA 5IUXA 4ILBA 5SYOA 2VL0A 2QC1B 2Y57A 2XZ6A 3WTKA 2YOEA 2W8GA 3TLTA 4ZR6A 5FJVA 5HCMA 1OEDB 1OEDE 2BG9A 2XQ7A 2WZYA 4UM1A 4DBMA 3LSVA 4TNWA 4TWHA 3UQ4A 3TLWA 3UU4A 3WTHA 5AINA 3P50A 5BP0A 2YKSA 3WTLA 5HEUA 2KSRA 4ZJSA 2UZ6A 3GUAA 3SQ6A 3WTIA 5J0ZA 4NPPA 2WN9A 3U8MA 2Y58A 3WTMA 2Y56A 2BYNA 3ZDHA 4QABA 4B5DA 4ZJTA 2BR7A 4ILCA 4Z91A 5J5IA 4ZRUA 2BYQA 3UUBA 5L4HA 2XZ5A 2ZJVA 3RQUA 4UY2A 5L47A 3RIAA 4QAAA 2M6IA 4PIRA 3U8KA 4HFDA 5HEJA 4HFCA 4F8HA 2XYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKH A;  4LMK A;  2XQ6 A;  1UW6 A;  5L4E A;  2Y7Y A;  4LMJ A;  4UM3 S;  5J5H A;  1OED A;  4TWD A;  4Z90 A;  2BR8 A;  2XQ5 A;  2W8F A;  5AFH A;  4ZK4 A;  2XQ8 A;  3WTO A;  4NZB A;  4BFQ A;  4HFI A;  2PH9 A;  5KE4 A;  4A97 A;  3EAM A;  2WNC A;  2YMD A;  4IL9 A;  3C79 A;  3C84 A;  2Y54 A;  3U8L A;  2LLY A;  4HFE A;  4COF A;  4UXU A;  3ZDG A;  4IRE A;  2XQ3 A;  5HEH A;  4ZZB A;  4IL4 A;  1I9B A;  2YN6 A;  3RQW A;  2XNU A;  1UX2 A;  4LML A;  3IGQ A;  3WIP A;  3UU3 A;  5LG3 A;  2XNV A;  5LXB A;  3WTJ A;  5KZU A;  4XK9 A;  3UQ7 A;  3TLV A;  5J5F A;  5AFN A;  3RIF A;  2BYR A;  4D01 A;  5BW2 A;  4QH5 A;  4FRR A;  2C9T A;  4ZK1 A;  2BG9 B;  5CFB A;  3SQ9 A;  3P4W A;  4EZ1 A;  4QH1 A;  2ZJU A;  2XQ4 A;  4HFH A;  5AFM B;  4QAC A;  3WTN A;  3RHW A;  2M6B A;  3UU8 A;  4HQP A;  2BG9 E;  3TLS A;  3JAD A;  2X00 D;  2BJ0 A;  4HFB A;  5HEG A;  3ZKR A;  5HEO A;  2YME A;  5BRX A;  4ILA A;  3TLU A;  1UV6 A;  4XHE A;  2XQA A;  3EI0 A;  5CO5 A;  5J5G A;  5AFJ A;  2BG9 C;  4X5T A;  3SH1 A;  4TWF A;  4UM3 A;  5AFK A;  2XQ9 A;  4ZZC A;  3T4M A;  4WV9 A;  2WNL A;  3SIO A;  4AFH A;  2BYS A;  5JME A;  2BYP A;  3JAF A;  2LKG A;  4QH4 A;  5HCJ A;  3UU6 A;  2XYS A;  2WNJ A;  4A98 A;  3PMZ A;  2MAW A;  4AFT A;  3RI5 A;  2PGZ A;  3U8N A;  3PEO A;  2LM2 A;  3U8J A;  3JAE A;  4ALX A;  5TVC A;  5AFL A;  4AFG A;  4TNV A;  4BQT A;  3UU5 A;  2XNT A;  4UM3 P;  1OED C;  3EHZ A;  2X00 A;  5AFM A;  5IUX A;  4ILB A;  5SYO A;  2VL0 A;  2QC1 B;  2Y57 A;  2XZ6 A;  3WTK A;  2YOE A;  2W8G A;  3TLT A;  4ZR6 A;  5FJV A;  5HCM A;  1OED B;  1OED E;  2BG9 A;  2XQ7 A;  2WZY A;  4UM1 A;  4DBM A;  3LSV A;  4TNW A;  4TWH A;  3UQ4 A;  3TLW A;  3UU4 A;  3WTH A;  5AIN A;  3P50 A;  5BP0 A;  2YKS A;  3WTL A;  5HEU A;  2KSR A;  4ZJS A;  2UZ6 A;  3GUA A;  3SQ6 A;  3WTI A;  5J0Z A;  4NPP A;  2WN9 A;  3U8M A;  2Y58 A;  3WTM A;  2Y56 A;  2BYN A;  3ZDH A;  4QAB A;  4B5D A;  4ZJT A;  2BR7 A;  4ILC A;  4Z91 A;  5J5I A;  4ZRU A;  2BYQ A;  3UUB A;  5L4H A;  2XZ5 A;  2ZJV A;  3RQU A;  4UY2 A;  5L47 A;  3RIA A;  4QAA A;  2M6I A;  4PIR A;  3U8K A;  4HFD A;  5HEJ A;  4HFC A;  4F8H A;  2XYT A; 
#chains in the Genus database with same CATH topology
 2V6X A;  2VKJ A;  1HNW T;  2IAK A;  1LRZ A;  4IL9 A;  4IDP A;  4B3R T;  2VAS A;  2D0U A;  1I9B A;  3N2K E;  4KHZ F;  4QXH B;  4PJJ A;  3AE8 A;  4UVA B;  2FUP A;  4JI2 T;  4ZK1 A;  4MHC A;  4JI7 T;  3QB5 K;  4A56 A;  4HQP A;  1CUN A;  2YDQ A;  3AEB A;  1KEY A;  5BRX A;  3SH1 A;  2KMF A;  2WWU A;  1N33 T;  4DV2 T;  3Q5X A;  3RI5 A;  4ZI3 D;  4I55 E;  1MNE A;  3CWZ B;  5JDF A;  4I43 B;  2SPC A;  4H9S E;  3ZLI A;  5FJV A;  2ZMA A;  2CXF A;  3EUH A;  4LFA T;  3QB5 A;  2WS3 A;  2YDR A;  4OYJ A;  3E22 E;  1CHU A;  5AQI B;  4M1P A;  2XSB A;  1FMW A;  2XAG B;  4X1I E;  2BYN A;  2CWY A;  3PUA A;  3EDU A;  4DBR A;  4UY2 A;  3AXJ B;  1M62 A;  3IBP A;  1LVF A;  2ODU A;  1UW6 A;  1KFY A;  5L2L A;  3I9Y A;  3K8P C;  1B7T A;  3RX6 A;  3Q5D A;  5ADX L;  2YU2 A;  4UIG A;  3C4X A;  4TN7 B;  4HWF A;  3PUG A;  1J5E T;  4K0U A;  3RRW A;  2J47 A;  1M7K A;  3L39 A;  3RC8 A;  3OYX A;  5JDN A;  3AE9 A;  2CCQ A;  2B1E A;  3L09 A;  4DR6 T;  4CI1 B;  2BYR A;  2E2A A;  5BR8 T;  2ZJU A;  4HFH A;  4CZZ B;  2WDQ A;  2M6B A;  5C3J A;  4Z8X A;  3ZMV B;  2YEV C;  1IBK T;  5CJ5 A;  1MMN A;  4CQI A;  4DR3 T;  2BYS A;  3PUQ A;  1YQ4 A;  2VVN A;  4KMC A;  2MAW A;  3PU8 A;  3RRC A;  3U8N A;  1J5W A;  3PEO A;  1FJG T;  2E9X A;  2NR4 A;  2YIN A;  2H88 A;  3EHZ A;  4V1A v;  4H9N C;  2ACZ A;  2D2S A;  4YSZ A;  3FZM B;  5HXE A;  1HG5 A;  3K3Q C;  5AQG B;  2XQ7 A;  4FI5 A;  2LRK A;  4DV6 T;  1KNZ A;  4NXM T;  4U2Z A;  1T98 A;  3K3N A;  3LBX A;  4IST A;  2IML A;  5EZY E;  2A3D A;  4X62 T;  2W66 A;  3LK4 2;  3CVR A;  3PU3 A;  3R6N A;  5HXR A;  4X65 T;  3N9N A;  4XAX B;  4COF A;  3AE6 A;  3N9P A;  3ZSS A;  1UX2 A;  4JBW F;  1EZ3 A;  3VRB A;  4AKH A;  1KNP A;  2Z6E A;  1U4Q A;  1ZOY A;  4X64 T;  4JEH B;  4I0U A;  4BJM A;  2D5U A;  4DVD A;  4IIJ E;  5LYJ E;  2CA5 A;  3TLS A;  2LEH A;  3FZF B;  1W09 A;  2FJD A;  5LJN A;  3UTK A;  4YTN A;  3JAF A;  2NTY A;  2PGZ A;  2R6G F;  5LA6 E;  5FKY A;  1UGO A;  4O8S A;  2DLR A;  4YFS A;  5IUX A;  4JI3 T;  3WTK A;  2BG9 A;  4DBM A;  4UEL A;  5J1G A;  3HKC E;  3IHR A;  4OK0 A;  4OX9 T;  4P0A A;  5C8Y E;  2GK9 A;  3ZDH A;  4PFO A;  5AFU L;  5AQJ B;  2ZJV A;  5CA1 E;  4QAA A;  2DCF A;  2X9X A;  2UXB T;  4GK0 E;  3J9X 1;  2E9X D;  3FXE B;  4KI0 F;  4UV9 B;  2ACX A;  3AEE A;  1VRB A;  2UXD T;  2X0L B;  1ZEE A;  3ZDG A;  3JC6 C;  3FZK B;  5CB4 E;  1D1B A;  3WIP A;  2DWG A;  5HWY A;  4H63 V;  3WTJ A;  2N9D A;  3A7M A;  2B76 A;  3H37 A;  4FRR A;  3M65 A;  2C9T A;  3KV6 A;  3ZT6 A;  2LE8 A;  5JRC A;  4YY3 T;  3WTN A;  2H89 A;  2WZI A;  4AQF A;  5BMV E;  3N9M A;  4O2A E;  4U3C A;  2BG9 C;  1W9R A;  5LOV E;  4JI1 T;  2KXP B;  3NZP A;  3U8J A;  4EOZ B;  1FMV A;  5LBQ B;  3ZMT B;  2UUB T;  3C51 A;  2WDR A;  3X1D A;  4ILB A;  4AXP A;  4UM1 A;  4MAL A;  4EED A;  4ZS2 A;  5L3C B;  1VCT A;  1D0Y A;  2Y58 A;  1IBL T;  4BA9 A;  4ZJT A;  3AE4 A;  4KX6 A;  2OA5 A;  2HHH T;  4QXC B;  2H7O A;  4EGW A;  3AE1 A;  1HX1 B;  3H3A A;  3UFE A;  2UXC T;  2VWA A;  4C90 A;  4Z90 A;  2WY2 A;  3C64 A;  3ONX A;  5JDM A;  4H9O C;  1QLB A;  5KE4 A;  2Y8D A;  4IT4 A;  3JCF A;  3MA9 A;  3KVA A;  2X67 A;  5JTG A;  4BAY B;  5IYZ E;  4AQF C;  5TAO A;  2XM2 A;  3ZCJ A;  5ABH A;  1S35 A;  5JR9 A;  3N5L A;  1I94 T;  5JVD E;  2BS4 A;  2HH7 A;  1YW0 A;  3DTO A;  2V7I A;  1T8B A;  2KWH A;  3J7Y q;  2JQK A;  2VUR A;  2ZM8 A;  4EZ1 A;  5H6R B;  4DID B;  4TV9 E;  4WBN E;  2V7K A;  1UX4 A;  3TLU A;  5LXT E;  1DU2 A;  2KT9 A;  4XBF B;  4ZI2 C;  4L0R A;  2BYP A;  4U33 A;  2XYS A;  4UEM A;  2CWO A;  4LF4 T;  3O1I A;  4ALX A;  2JRK A;  5A1L A;  2CRB A;  4UM3 P;  1Y01 A;  4U72 A;  4AQY T;  2IW5 B;  3MK7 C;  2J1D G;  3UU4 A;  5HEU A;  3WTI A;  2WN9 A;  5L3F B;  3C4Z A;  4CXW A;  2OLT A;  3BQK A;  1XNR T;  3UUB A;  2JQ9 A;  3RQU A;  5FVK A;  3RPU A;  2M6I A;  4NXN T;  2VK9 A;  1ZHC A;  3P4Q A;  2QYW A;  1HFA A;  4YT0 A;  4AI6 A;  5HAX A;  2CBI A;  5AFH A;  4IE6 A;  2C0S A;  2HN2 A;  2W63 A;  3DJB A;  5FY7 A;  3AA0 B;  3RQW A;  3D0T A;  1KNR A;  5LP6 E;  5AFN A;  3PTR B;  1U5P A;  4QH5 A;  3M3Z B;  4U74 A;  2J62 A;  3SQ9 A;  3P4W A;  4NUV A;  1N36 T;  2F4V T;  4FJO A;  1MMA A;  3AE7 A;  1I6Z A;  2YME A;  2V7L A;  3G06 A;  2K5B B;  4CXY A;  5AQM B;  5AQV B;  3KBU A;  4WV9 A;  4QH4 A;  4ZI2 D;  1UX5 A;  4UF0 A;  1BR2 A;  1NAF A;  2LJL A;  4PK4 A;  1US7 B;  3UU5 A;  2CE7 A;  2IIU A;  2JJ9 A;  5JDG A;  4TUY E;  2MBG A;  3VKG A;  2IC9 A;  4ZEY A;  1D1A A;  2EHO D;  3WTL A;  5HXS A;  3MAC A;  3AE3 A;  4ERR A;  3H3M A;  3N9Q A;  2D0T A;  2N2N A;  4QWN B;  3OVU A;  2JMK A;  4WW0 A;  2UU9 T;  2X51 A;  4DR2 T;  5L3D B;  3I9W A;  1MIY A;  4UM3 S;  3LG7 A;  1WRD A;  5ETW A;  5J5H A;  5EK4 A;  4EYY R;  4TWD A;  3OPC A;  1UCU A;  3FB2 A;  3RH3 A;  1W0B A;  2XHE B;  3KV9 A;  1Z8U A;  4P09 A;  4IRE A;  3E08 A;  4DND A;  4LML A;  3AE2 A;  4IDQ A;  2XNV A;  3ZN1 B;  2WBL A;  2I59 A;  4OYK A;  2DI4 A;  3N9O A;  3R84 B;  4ZHQ E;  5AQF B;  3PDY A;  4JUY A;  2CM0 A;  2LSJ A;  4QH1 A;  2V5D A;  3RKO A;  1ZV4 X;  2YDS A;  4DMW A;  1AJ3 A;  5HEO A;  2IC6 A;  2WDV A;  3K1S A;  2W2U A;  2UXN B;  2CHO A;  4UF0 B;  2IDO B;  1MMG A;  4X1Y E;  2WNJ A;  3AAA B;  2MOZ A;  5H6Q B;  5LGT B;  5AFL A;  4IE7 A;  3PJA A;  5LCY A;  3A5X A;  4QHO A;  3FBL A;  5SYO A;  2VVS A;  2WB5 A;  4HKA A;  3TLW A;  4AKL A;  2XJ7 A;  3P50 A;  2YKS A;  4H9Q C;  1IAP A;  2FJA A;  5M4Y A;  2BR7 A;  5J5I A;  3AEG A;  5AQL B;  3ONJ A;  4YJ2 E;  3AEC A;  2CXL A;  1NEK A;  3GA8 A;  2AE9 A;  2HPJ A;  3KFW X;  3A8Y C;  3UUL A;  4WZX A;  5L3B B;  4HFI A;  2X9W A;  4ASK A;  2CLY B;  3U8L A;  3CPZ A;  5HEH A;  3KIN B;  2V7J A;  2RP4 A;  1XNQ T;  2BKN A;  1Y64 B;  3TLV A;  1W0A A;  3GN5 B;  1G8X A;  2Y48 B;  2KLQ A;  3ABV A;  4ADZ A;  3WAK A;  5FYM A;  1UK5 A;  2XUE A;  4MBQ A;  4C91 A;  2BG9 E;  2HN1 A;  3AED A;  3RYC E;  4DUZ T;  3GN5 A;  3RYH E;  2XQA A;  5AFK A;  1WYC A;  2XQ9 A;  1KF6 A;  3P7I A;  2WNL A;  3ZPO A;  4EYU A;  2CXD A;  2UXX B;  2X66 A;  4CN4 A;  2Q9Q C;  1ZP0 A;  4AFG A;  1XDO A;  5ABF B;  2K24 A;  3HR0 A;  5AFM A;  3ZC1 A;  4HGA A;  2NP9 A;  2W8G A;  3KVB A;  2LSY A;  5AQO B;  5IHY A;  3SRZ A;  4P0B A;  1N34 T;  2ES0 A;  3C4W A;  4TWH A;  3WTH A;  4QX7 B;  1HNZ T;  2X68 A;  3T1H T;  4NPP A;  5LBM A;  3U8M A;  5HXH A;  3WTM A;  2QRX A;  4G2A A;  4ZRU A;  5LHG B;  2L3L A;  3CIR A;  3O1H A;  2P9B A;  5AQT B;  2BS3 A;  5ABE A;  3RGL A;  3PUW F;  2C5I T;  2RPA A;  1D0Z A;  4TZ4 C;  5L4E A;  4JI0 T;  2RA1 A;  1OED A;  1HF8 A;  4ZK4 A;  2EHO C;  4PW8 A;  1E2A A;  4A97 A;  5EK3 A;  3CX7 B;  4X1K E;  1HCI A;  3JC6 D;  1BR1 A;  4GYS A;  4U7Y A;  3KV5 A;  5LG3 A;  2A72 A;  3K3O A;  4QXB B;  4DV7 T;  3ETV A;  4HTE A;  4XK9 A;  2JQQ A;  2H7V C;  3RIF A;  2WCA A;  3WI3 A;  1S94 A;  5FL0 A;  3LK3 B;  4DMV A;  2ZM2 A;  5KMG P;  4PJN A;  4DV3 T;  3ANW A;  4EZH A;  4TX5 A;  3UU8 A;  3ZKR A;  4UXN B;  2E9X B;  5LXB A;  3EI0 A;  1D0X A;  2XAJ B;  3UU6 A;  1XMQ T;  2BS2 A;  4ANJ A;  2UUA T;  4P1N A;  4UV8 B;  3CQG B;  2X00 A;  3KBT A;  4ZOL E;  4ISS A;  4LF8 T;  2QC1 B;  4EIW A;  3TLT A;  2XTL A;  5HYA A;  5DQV A;  5F5W A;  3ESL A;  3P4S A;  1YKH B;  2WQY A;  1YXR A;  5AQN B;  2CLY C;  4GKJ T;  4ILC A;  4Z91 A;  5ABF A;  1IJ5 A;  3SFD A;  2XAS B;  4LFB T;  5JDQ A;  3VU7 H;  3RIU C;  2WM9 A;  2XYT A;  5LJM A;  2WMO A;  2H3R A;  3AVS A;  3C50 A;  2Y7Y A;  4KUM B;  2CBJ A;  2IHR 1;  1HR0 T;  2K3W A;  3ZEF B;  3VR9 A;  3C84 A;  3VKH A;  5JRC B;  5KZU A;  4O4J E;  2EHO B;  5BW2 A;  4O2B E;  3O4X E;  1WYB A;  4X66 T;  3CQX C;  3NBX X;  2W62 A;  5CFB A;  4ZXL A;  5LHH B;  3AA1 B;  4QAC A;  5LGU B;  4HN9 A;  3ETU A;  2V26 A;  2LOP A;  2G0U A;  3ZYL A;  2Q9Q B;  2JIW A;  2LHN A;  2CMR A;  2IUB A;  2CHN A;  2LSK A;  3HL6 A;  3EDV A;  3U78 A;  3ZYK A;  4UM3 A;  4ZI7 E;  2KWI B;  1O3X A;  2M67 A;  3KDS E;  3Q9D A;  5KX5 E;  1WR6 A;  5CA0 E;  1X79 A;  3WAJ A;  3PUZ F;  3JAE A;  5TVC A;  2E9X C;  4TNV A;  5F8P A;  5FY0 A;  2W0G A;  4IDN A;  2BZB A;  1MIW A;  3QOF A;  4NIQ A;  4GYR A;  4GKK T;  4PAG A;  1HS7 A;  2XZ5 A;  5FNV E;  5F3J A;  4F8H A;  2X9Y A;  3DP7 A;  2YK0 A;  1HG2 A;  5AQU B;  4HWC A;  4U2Y A;  4OFZ A;  5LGN B;  3N2O A;  4CN6 A;  5KXJ A;  4I4T E;  2BR8 A;  2LSG A;  3EAM A;  3C79 A;  2MYS A;  4HFE A;  3V5U A;  4O4H E;  4UXU A;  2KZ7 B;  4PNI A;  5DJQ C;  3MXZ A;  2YN6 A;  5JDH A;  3BK9 A;  4JI6 T;  3IGQ A;  5ABG A;  2WMN A;  2JPF A;  2AXD S;  4B3T T;  4WYV A;  2WP9 A;  3MKD A;  4DBQ A;  4PFP A;  2XZE A;  2DWK A;  4HWH A;  3NZQ A;  3OBV E;  3LJC A;  2XQ4 A;  4LFC T;  5HXC A;  4IDO A;  3JAD A;  4H9P C;  5HEG A;  3EVY A;  1R8I A;  1OXZ A;  3PUR A;  1N32 T;  4E7Z A;  4JYA T;  2V8S V;  3ZMU B;  5J5G A;  5BP0 A;  4X5T A;  3AAI A;  3T4M A;  4N78 D;  3IF8 B;  4AFH A;  5JME A;  1X9B A;  2NW9 A;  3RYI E;  1KK7 A;  2W00 A;  4YSX A;  3ZCI A;  3LBX B;  2NWB A;  4O4I E;  2VL0 A;  2WAU A;  3NVO A;  3I1A A;  3SOL A;  2BVL A;  1OED E;  3KV4 A;  4XZC A;  3UQ4 A;  3AVR A;  5AQP B;  2MPK A;  2CPT A;  5JR9 C;  1XDP A;  3IA3 A;  4AIS A;  4B5D A;  4EEB A;  2Q9Q D;  2E5L T;  3AEA A;  2ZM6 T;  4HFC A;  4ZI3 C;  1XZY A;  1WFD A;  4WNK A;  3C98 B;  4YXD A;  1VCS A;  1IBM T;  1J1J A;  2JMH A;  3HKD E;  2YMD A;  1XMO T;  3QNU A;  2BBJ A;  3RF1 A;  1YKE B;  3V5S A;  3ZST A;  4HWI B;  5DQW A;  4PJL A;  4DV1 T;  2KND A;  2JQH A;  2KIN B;  3AXJ A;  5FL1 A;  5AFM B;  4F6R C;  3RHW A;  3OYZ A;  3BQL A;  4JEU B;  2W61 A;  2XY8 B;  4E7S A;  4ILA A;  2LT3 A;  4B3M T;  2BKP A;  4HFV A;  2I0M A;  4CI2 B;  2LSI A;  3F31 A;  1E1H B;  4JI4 T;  2LM2 A;  3F57 A;  3PUV F;  5LMN T;  2C5J A;  4DO0 A;  4WBO A;  3ZJ2 A;  4L5G A;  2DNX A;  2C5K T;  3NWI A;  4X20 E;  3GWH A;  3LSV A;  4TNW A;  4EV6 A;  4YTM A;  2VKD A;  2VQE T;  3CKD A;  2UZ6 A;  3T1Y T;  4DV0 T;  2YU1 A;  3B13 A;  4BJN A;  2QA7 A;  5HWX A;  5L47 A;  1IZN B;  2QVA A;  3AAE B;  3SFE A;  4QAB A;  4LMJ A;  4LF6 T;  5C2T A;  4YHH T;  3I0Q A;  5FP3 A;  2W8F A;  5KDM C;  5FXZ A;  2V6Y A;  3WTO A;  4BFQ A;  4AIU A;  3MZK B;  4GIW A;  2LLY A;  1NWM X;  5JH7 E;  2XQ3 A;  4IL4 A;  4YSY A;  5L3E B;  3ANW B;  3O1J A;  2XQY A;  3UQ7 A;  4IE4 A;  4JI5 T;  2X0Y A;  4D01 A;  1T7S A;  5DAB A;  2WWV A;  4AKR B;  4GK5 E;  3FZL B;  1SE7 A;  3P4R A;  4YJ3 E;  2XAH B;  3S4U A;  4DR4 T;  5AQS B;  2PJQ A;  4PK6 A;  3AB3 B;  3ZN0 B;  5L3G B;  1UV6 A;  4XHE A;  1D1C A;  2V6Y B;  5J2T E;  4TWF A;  4ZZC A;  4CI3 B;  3ZMS B;  3SIO A;  2LKG A;  5JR9 B;  5LHI B;  2LOS A;  3I0O A;  1H7C A;  3NRX A;  4YHJ A;  1LVK A;  1XWM A;  4HE8 A;  3HA4 A;  2WU5 A;  4BQT A;  2L9Q A;  4HWD A;  3CML A;  2V1D B;  4U31 A;  2XAQ B;  2YOE A;  3NRY A;  4ZR6 A;  1OED B;  3BQI A;  2UUC T;  4KHP T;  2WZY A;  1LKX A;  5IWA T;  2A9U A;  4IE5 A;  5AIN A;  3RC3 A;  3SWH A;  1GQE A;  4TV8 E;  2FJB A;  3ZC0 A;  5JQG E;  3QC9 A;  3L3P A;  4IE0 A;  1WR0 A;  5L4H A;  3CQC B;  2FBW A;  3RLF F;  1UUS A;  3O9X A;  1IJ6 A;  5GON E;  5AQQ B;  2LHR A;  2X9H A;  4U7I A;  5AQH B;  4UVC B;  2XQ8 A;  4NZB A;  3ZMZ B;  4DR7 T;  2WNC A;  3B5M A;  2Y54 A;  2Q9Q A;  4YLH A;  1FEW A;  3FZH B;  3AEF A;  3UU3 A;  4EB6 E;  5J2U E;  2E5V A;  1HNX T;  3UUM A;  3ZT7 A;  2XPK A;  4LF7 T;  1YQ3 A;  4H63 H;  3U3I A;  5FXX A;  3F2E A;  4AKI A;  1Z0P A;  3UUN A;  3LDQ B;  2OV9 A;  1MMD A;  2L8K A;  2NW8 A;  3PUY F;  4NUU A;  2QGS A;  3HKE E;  2LRL A;  3PMZ A;  4AFT A;  2DHR A;  2E8I A;  3VRA A;  1OWA A;  2XNT A;  3UT5 E;  4DR1 T;  2Y57 A;  4YTP A;  4MLK A;  4PJM A;  4IGU A;  2NW7 A;  3PUS A;  3UUX B;  2J4G A;  4LF5 T;  4ZJS A;  3SQ6 A;  5FY1 A;  3CX6 B;  1JNZ A;  2VKH A;  2Y56 A;  3PJA J;  4JLE A;  4JI8 T;  1MND A;  2BYQ A;  3OTO T;  4B3S T;  3SS1 A;  3RIA A;  1BR0 A;  1MIV A;  3Q5W A;  3QK6 A;  2BKO A;  4PIR A;  4H9R C;  2LKH A;  4IDZ A;  4LMK A;  2XQ6 A;  5LMU T;  2D9D A;  2XQ5 A;  4HEA A;  1VOM A;  3HI2 A;  2BDE A;  1WCR A;  2X0H A;  1QUU A;  3T8O A;  4OHF A;  3Q5E A;  2NTX A;  3PE0 A;  3RIU A;  4EZ4 A;  4QX8 B;  3W15 B;  3TKL B;  2NOX A;  2WZH A;  3LK2 B;  3AA7 B;  4EXT A;  5EK2 A;  5AQK B;  5LG4 A;  3L8R A;  2XSA A;  4KP3 C;  2WSS V;  4UR9 A;  1L0V A;  4Q25 A;  3P4P A;  2W67 A;  4K0K T;  4IHJ E;  1ZKE A;  2X00 D;  2BJ0 A;  4HFB A;  4JV5 T;  2ZLY A;  4QKN A;  1HTJ F;  5AFJ A;  1NEN A;  2VL8 A;  2K9A A;  3CX8 B;  1SUM B;  3EAB A;  4A98 A;  4UVB B;  3PV0 F;  1OED C;  3AA6 B;  2ZM0 A;  2N1G A;  1FIO A;  5LB7 B;  2XZ6 A;  3E0Z A;  5HCM A;  4ZS3 A;  4LF9 T;  4CN1 A;  4PK5 A;  1YD8 G;  3MJX A;  4GOU A;  4MFR A;  1UUR A;  2KSR A;  3GUA A;  1SA0 E;  4AKG A;  2FJE A;  2WU2 A;  2VKO A;  3RKG A;  1QSD A;  2ODV A;  5AQR B;  3RYF E;  2PTF A;  5CGM A;  3ZJ1 A;  4G63 A;  3U8K A;  1HX8 A;  4EAH A;  4DV4 T;  4O4L E;  3LFM A;  2W4X A;  3N9L A;  3B57 A;  2PH9 A;  3FXD B;  2I6H A;  4ZZB A;  1G73 A;  2XNU A;  5JRE A;  5LNK A;  2K48 A;  2HPL A;  2V7M A;  1E7P A;  5J5F A;  4B6X A;  2CEA A;  3FHN A;  3VHL A;  5JDL A;  4I50 E;  4A5X A;  2BG9 B;  4DUY T;  3ONL C;  2LM9 A;  3Q2M A;  2Y6X A;  2BVM A;  3FBZ A;  2XAF B;  3OKQ A;  5FXW A;  4CXX A;  5FXV A;  2BBH A;  3P8C D;  4ILU A;  5HCJ A;  2VB6 A;  3CK6 A;  2PG8 A;  4KBM B;  5FMN A;  1BR4 A;  3ZYM A;  2VQF T;  3OJA A;  4AQG A;  2PBI A;  2PFV A;  3N2G E;  4DV5 T;  2MTQ A;  3QUJ A;  4J2C A;  1WLX A;  1T72 A;  5E0O A;  3ZT5 A;  3UFG A;  3NKZ A;  2DL1 A;  4DR5 T;  2EHO A;  2XM1 A;  2V5C A;  2A2F X;  5J0Z A;  3HKB E;  4L9I A;  5FVL A;  3VR8 A;  1JNR A;  1SHZ C;  3GMI A;  1V9D A;  3AE5 A;  3IEE A;  4HFD A;  5HEJ A;  3PUX F;  5CO5 A; 
#chains in the Genus database with same CATH homology
 2LKH A;  4LMK A;  2XQ6 A;  1UW6 A;  5L4E A;  2Y7Y A;  4LMJ A;  4UM3 S;  5J5H A;  1OED A;  4TWD A;  4Z90 A;  2BR8 A;  2XQ5 A;  2W8F A;  5AFH A;  4ZK4 A;  2XQ8 A;  3WTO A;  4NZB A;  4BFQ A;  4HFI A;  2PH9 A;  5KE4 A;  4A97 A;  3EAM A;  2WNC A;  2YMD A;  4IL9 A;  3C79 A;  3C84 A;  2Y54 A;  3U8L A;  2LLY A;  4HFE A;  4COF A;  4UXU A;  3ZDG A;  4IRE A;  2XQ3 A;  5HEH A;  4ZZB A;  4IL4 A;  1I9B A;  2YN6 A;  3RQW A;  2XNU A;  1UX2 A;  4LML A;  3IGQ A;  3WIP A;  3UU3 A;  5LG3 A;  2XNV A;  5LXB A;  3WTJ A;  5KZU A;  4XK9 A;  3UQ7 A;  3TLV A;  5J5F A;  5AFN A;  3RIF A;  2BYR A;  4D01 A;  5BW2 A;  4QH5 A;  4FRR A;  2C9T A;  4ZK1 A;  2BG9 B;  5CFB A;  3SQ9 A;  3P4W A;  4EZ1 A;  4QH1 A;  2ZJU A;  2XQ4 A;  4HFH A;  5AFM B;  4QAC A;  3WTN A;  3RHW A;  2M6B A;  3UU8 A;  4HQP A;  2BG9 E;  3TLS A;  3JAD A;  2X00 D;  2BJ0 A;  4HFB A;  5HEG A;  3ZKR A;  5HEO A;  2YME A;  5BRX A;  4ILA A;  3TLU A;  1UV6 A;  4XHE A;  2XQA A;  3EI0 A;  5CO5 A;  5J5G A;  5AFJ A;  2BG9 C;  4X5T A;  3SH1 A;  4TWF A;  4UM3 A;  5AFK A;  2XQ9 A;  4ZZC A;  3T4M A;  4WV9 A;  2WNL A;  3SIO A;  4AFH A;  2BYS A;  5JME A;  2BYP A;  3JAF A;  2LKG A;  4QH4 A;  5HCJ A;  3UU6 A;  2XYS A;  2WNJ A;  4A98 A;  3PMZ A;  2MAW A;  4AFT A;  3RI5 A;  2PGZ A;  3U8N A;  3PEO A;  2LM2 A;  3U8J A;  3JAE A;  4ALX A;  5TVC A;  5AFL A;  4AFG A;  4TNV A;  4BQT A;  3UU5 A;  2XNT A;  4UM3 P;  1OED C;  3EHZ A;  2X00 A;  5AFM A;  5IUX A;  4ILB A;  5SYO A;  2VL0 A;  2QC1 B;  2Y57 A;  2XZ6 A;  3WTK A;  2YOE A;  2W8G A;  3TLT A;  4ZR6 A;  5FJV A;  5HCM A;  1OED B;  1OED E;  2BG9 A;  2XQ7 A;  2WZY A;  4UM1 A;  4DBM A;  3LSV A;  4TNW A;  4TWH A;  3UQ4 A;  3TLW A;  3UU4 A;  3WTH A;  5AIN A;  3P50 A;  5BP0 A;  2YKS A;  3WTL A;  5HEU A;  2KSR A;  4ZJS A;  2UZ6 A;  3GUA A;  3SQ6 A;  3WTI A;  5J0Z A;  4NPP A;  2WN9 A;  3U8M A;  2Y58 A;  3WTM A;  2Y56 A;  2BYN A;  3ZDH A;  4QAB A;  4B5D A;  4ZJT A;  2BR7 A;  4ILC A;  4Z91 A;  5J5I A;  4ZRU A;  2BYQ A;  3UUB A;  5L4H A;  2XZ5 A;  2ZJV A;  3RQU A;  4UY2 A;  5L47 A;  3RIA A;  4QAA A;  2M6I A;  4PIR A;  3U8K A;  4HFD A;  5HEJ A;  4HFC A;  4F8H A;  2XYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...