2BG9C

Refined structure of the nicotinic acetylcholine receptor at 4a resolution.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
369
structure length
369
Chain Sequence
b'VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTTNVWMDHAWYDHRLTWNASEYSDISILRLRPELIWIPDIVLQNNNDGQYNVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEISMDLIIDPEAFTENGEWEIIHKPAKKNIYGDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLISFLAALAFYLPAESGEKMSTAICVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVVVNCGIVLNFHFRTPSTHSGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNRPPAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Refined Structure of the Nicotinic Acetylcholine Receptor at 4A Resolution
pubmed doi rcsb
molecule tags Ion channel/receptor
total genus 83
structure length 369
sequence length 369
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
C PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2bg9C02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bg9C01
3T4MA 4HFBA 3P50A 1I9BA 4TWHA 4B5DA 4F8HA 3U8JA 2YMEA 2MAWA 5SYOA 2KSRA 3PMZA 4QH1A 4LMJA 4UM3S 4ZK1A 2BYSA 1UX2A 4NPPA 4QAAA 3SH1A 4BFQA 2LKHA 4ZZCA 2QC1B 3P4WA 2Y56A 5J0ZA 5KZUA 4TWDA 4HFHA 4QH5A 1OEDC 3U8LA 5J5GA 2M6IA 2BG9E 4ILCA 2YN6A 4HFIA 4LMKA 1UW6A 4PIRA 5CFBA 4ZJSA 5AFMA 5AFKA 4HFEA 5L47A 5IUXA 3WIPA 2XNVA 4DBMA 4XK9A 5HEOA 5HEJA 3UQ7A 4ALXA 3EI0A 5AFHA 2BG9B 5AFJA 2BG9A 2YMDA 2BYQA 3ZKRA 4QH4A 4TWFA 2PH9A 3SQ9A 5AFLA 3WTNA 4TNVA 5J5IA 2YKSA 2XZ5A 3TLUA 2XQ5A 3RIFA 2Y57A 3U8MA 4XHEA 4ZK4A 1OEDB 4ILBA 2WNJA 3UU3A 4FRRA 3SIOA 3GUAA 2WNLA 5FJVA 3SQ6A 3UU8A 5TVCA 5HEUA 4AFGA 3TLWA 5J5HA 4ZRUA 4UXUA 5HEHA 3UQ4A 4ZR6A 4HFDA 2VL0A 3UU5A 3EAMA 3ZDHA 3TLSA 5KE4A 2XQ7A 4UY2A 2PGZA 4COFA 3IGQA 1OEDE 4AFHA 2XQ9A 3JAEA 2C9TA 4HFCA 3RQWA 2XYTA 2XQ4A 4ZZBA 3UUBA 2X00D 3RI5A 2LKGA 3LSVA 2Y7YA 3U8NA 2LM2A 5L4HA 5L4EA 3C79A 3WTOA 3RQUA 1OEDA 2BYPA 4A98A 3U8KA 4WV9A 4ZJTA 4D01A 4IREA 3WTHA 4X5TA 2Y54A 4UM1A 3UU4A 2XNTA 3WTLA 5JMEA 2W8FA 2ZJUA 2XNUA 3TLVA 5LG3A 2BR8A 5AINA 4AFTA 1UV6A 2XQAA 3WTIA 3UU6A 2BYNA 2XQ3A 2BR7A 2BYRA 3PEOA 3WTMA 5CO5A 4HQPA 5HCMA 4ILAA 2LLYA 4TNWA 4LMLA 5BP0A 4IL9A 2BG9C 2XYSA 5HEGA 2YOEA 2WN9A 2X00A 5BW2A 5LXBA 2ZJVA 5AFNA 2M6BA 4UM3P 3EHZA 3JAFA 4QACA 5HCJA 4QABA 4UM3A 4A97A 3WTJA 4Z90A 3TLTA 5AFMB 3C84A 2XQ6A 2WNCA 4EZ1A 2UZ6A 3WTKA 5J5FA 4IL4A 5BRXA 4Z91A 2W8GA 3RIAA 3RHWA 2BJ0A 4NZBA 4BQTA 3JADA 2XQ8A 2WZYA 2XZ6A 2Y58A 3ZDGA
chains in the Genus database with same CATH superfamily
3RKOA 2V7MA 3LK42 4EOZB 3U8JA 3CX7B 3ONXA 2PJQA 4JI6T 4QXBB 3E08A 4EYUA 5EZYE 3Q2MA 2VKOA 1XDPA 3EI0A 4JI2T 3HKEE 3CQCB 3AE1A 1O3XA 2KNDA 4GKKT 1BR0A 4I4TE 3F31A 3VR9A 3B5MA 2BS2A 4HWDA 3FZHB 2W4XA 5KE4A 2BBJA 3AE2A 4AIUA 3RQWA 1Z8UA 2X00D 1IJ6A 2LM2A 1J5ET 2KMFA 5L4EA 4L9IA 4D01A 2NTYA 4HWHA 3H3AA 1GQEA 3RGLA 2UUAT 4DV7T 2XNUA 2EHOD 3GN5A 2JPFA 2BYRA 4OK0A 4CN4A 3WAJA 2VKDA 2XYSA 1IAPA 2LSIA 4UV9B 5LXBA 2I6HA 3L8RA 3AEFA 2P9BA 5AQOB 2J1DG 2WCAA 4JI4T 4BQTA 4ZI7E 3ZLIA 4EZHA 3ZDGA 2Y58A 3ZC0A 3K3QC 2J47A 5FXXA 4QH1A 2BDEA 4B3ST 4QAAA 2Y56A 4ZS3A 4TWDA 4LFBT 1Z0PA 4OYKA 3CPZA 5AFLA 4UXNB 3ZCJA 4TNVA 2YKSA 4JI1T 3RIFA 5FXVA 4B3RT 1G8XA 4JEHB 3UFGA 3K3OA 4YTMA 4EV6A 1BR1A 4YFSA 4UF0B 2CA5A 5HEHA 4I43B 2UXXB 1WCRA 5LGUB 2XQ7A 3IGQA 3AE4A 3ZMSB 1WYCA 2Y7YA 4A5XA 4MBQA 3RF1A 5JMEA 2BKPA 3N2KE 1MMDA 1M62A 5KX5E 5JRCB 4GYRA 1MMNA 4LMLA 5JDMA 2BG9C 3FZKB 3PUXF 5HEGA 3ANWA 3Q5DA 2X00A 2WU5A 1HFAA 1B7TA 5HXEA 2YDSA 1QLBA 4EZ1A 2WNCA 2YK0A 3C4ZA 2EHOA 3VHLA 3IBPA 1YKHB 2XUEA 4Q25A 4CZZB 4DIDB 3D0TA 4IDZA 1I9BA 4MALA 3P4RA 2YMEA 2YEVC 3AECA 1JNZA 4X64T 4JUYA 3NRYA 4PJNA 2MTQA 3HI2A 1KFYA 4O8SA 2CHOA 4X20E 4DBMA 4UIGA 5HEOA 4HFVA 4IE0A 2X9WA 4H9NC 2DCFA 2XM2A 4EB6E 4PJJA 3LDQB 3DTOA 2XQ5A 3SRZA 4ERRA 2OLTA 1LRZA 3FZMB 4O4HE 2WNLA 2E2AA 3EDUA 2E8IA 2Q9QD 5HEUA 1J5WA 2A2FX 2C0SA 4O2AE 4IDNA 2UXNB 3IA3A 4UY2A 2PGZA 4H63H 3PURA 3T1HT 3P4QA 3P4PA 1SA0E 3N9MA 4DUZT 5C3JA 3JC6D 4O2BE 4CI3B 4PNIA 2W8FA 3RIUA 3AAAB 4WBOA 1HG2A 2PG8A 3UU6A 2BR7A 3HR0A 3L09A 3RYHE 5GONE 2DWGA 2W62A 2WQYA 2CXDA 4PK4A 3KV9A 4DBRA 1OWAA 4CN6A 4FI5A 4CXXA 3ZT5A 2XQ6A 3C84A 4HTEA 3WTKA 4ANJA 1I94T 2WWVA 1MNDA 4QKNA 3T4MA 2CXFA 4U3CA 4ZZCA 2H3RA 5AQUB 2NW8A 3AE5A 5LHGB 2K24A 5DABA 4CI1B 2NP9A 5AFMA 2LSYA 5HYAA 3C50A 3C98B 2JRKA 5AFHA 1VOMA 3CMLA 1UUSA 1N33T 3SQ9A 2QGSA 2VASA 4PK6A 3SIOA 5JR9B 5M4YA 2X9HA 4ZRUA 4GIWA 1HS7A 2QA7A 5EK2A 4YJ2E 4M1PA 5KMGP 1LVFA 5KDMC 1N32T 3W15B 2N1GA 3PUZF 3U8NA 5CJ5A 3C79A 2BYPA 2Q9QA 4TUYE 3N9LA 3AXJA 5JQGE 4GYSA 2XZEA 1HX8A 2XHEB 3C51A 4DVDA 3FZFB 2LE8A 1HTJF 2IDOB 3A5XA 4OX9T 1XNQT 4EIWA 3P4SA 1W0AA 2D0TA 3CQXC 2M6BA 3I1AA 2E5VA 4I55E 5LJMA 3ABVA 5KXJA 3JCFA 4E7SA 3L39A 4AQFA 1HF8A 4JYAT 2BBHA 1S35A 5LGTB 4UM3S 4BFQA 2BVLA 2B1EA 4P1NA 1FMWA 4ISSA 4H9SE 2XAJB 5JDHA 2WU2A 5HXCA 3FZLB 2WY2A 5F5WA 1Y64B 3UUMA 4EEBA 1SE7A 1MMAA 3MZKB 2PH9A 5C2TA 3LBXA 2J62A 2WNJA 2CM0A 3ZSSA 3UUNA 3P7IA 2MPKA 3QB5A 2WMNA 3PJAJ 4IE6A 3UQ4A 4ZR6A 5FP3A 2VL0A 2K5BB 2PBIA 1FEWA 4ZI2D 2QRXA 5AQJB 5ABFA 3FHNA 4HWFA 2C9TA 4AKHA 1X79A 2Y6XA 4DNDA 3RI5A 2V7LA 1N36T 2W2UA 5CB4E 4A98A 1D1AA 2PTFA 4KP3C 2V7KA 2YU1A 3HKBE 2KWIB 2VVSA 2V7IA 5AQMB 2ZJUA 3B13A 3AEDA 1FMVA 2XQAA 1MIVA 5LYJE 4ILAA 3ZYKA 2E9XB 2LOSA 2XSBA 3FB2A 4XAXB 1W0BA 3RX6A 2X0YA 4C91A 3RPUA 2BKNA 4JEUB 3SS1A 5J2UE 1FIOA 3J7Yq 3RYIE 3RHWA 1NWMX 4CXWA 1KNZA 5CGMA 4ZI3D 5DQVA 3ZEFB 2CWOA 2VB6A 5L3CB 4FJOA 3H37A 4X1KE 3SH1A 2OV9A 4ZOLE 4KHZF 5EK4A 3R84B 3TKLB 5AFKA 3CX6B 1BR4A 2CMRA 5IUXA 2V1DB 1IBLT 3IEEA 5AQKB 5AQVB 2BG9B 3LK2B 2BYQA 2VVNA 5LGNB 3ZT7A 3KINB 4EXTA 5E0OA 4ASKA 2W0GA 5CA1E 3KV5A 3GN5B 2FJEA 3H3MA 5AQRB 3UU5A 3EAMA 3MK7C 3TLSA 2JJ9A 1OEDE 3PV0F 5LB7B 2UXDT 2BS4A 4ZZBA 3LSVA 2CXLA 4JLEA 4U33A 3ZJ1A 3AA7B 1WYBA 5BR8T 1XDOA 4UVAB 2AXDS 3E0ZA 3N9PA 4YY3T 4HQPA 5HCMA 3KBTA 2Z6EA 2LHRA 3NZPA 4KMCA 4WZXA 1XWMA 4IGUA 4UM3A 2LSJA 5LJNA 2UZ6A 2R6GF 2XAGB 5DQWA 4IDQA 4YSYA 4KUMB 4PAGA 3ZMVB 2KSRA 1T98A 4GK0E 5J0ZA 4L5GA 4AISA 2YN6A 5L47A 3UULA 2QYWA 1UK5A 1IBMT 3RYCE 2HN2A 5AQPB 5HXRA 3OYZA 2JMKA 5JDQA 3ZKRA 2WWUA 2PFVA 1W09A 5IYZE 2ODUA 3RC8A 2Y57A 2XAQB 3Q9DA 4HGAA 2IHR1 4KI0F 2LT3A 1NAFA 4UVCB 2CEAA 3LK3B 3MA9A 5TAOA 1ZV4X 4DV2T 4F6RC 3FXDB 3PUVF 4C90A 4DR5T 2V26A 2W66A 1D1CA 3MXZA 5AQLB 4TX5A 4L0RA 2E9XC 3PU3A 4NUVA 2XASB 3GA8A 4ZXLA 5F8PA 4WV9A 5J2TE 1SUMB 2JQ9A 3NWIA 2MOZA 4PJLA 4DMVA 2CBIA 3TLVA 5JDGA 1KNPA 1D0YA 3QB5K 2UXBT 3QK6A 4CQIA 3PUGA 3NVOA 3AEAA 3O1IA 3ZCIA 2CWYA 2WN9A 3UFEA 3JAFA 3CX8B 4HKAA 2KXPB 4OFZA 2NTXA 1UX4A 4AQGA 5AQSB 1T7SA 3P50A 4OYJA 3OKQA 3CWZB 3ZYMA 5JH7E 1S94A 4X1IE 2ZM8A 2QC1B 2IC9A 4J2CA 3DJBA 5HXSA 4PIRA 1UW6A 3F2EA 4LF6T 4I0UA 4IDOA 4DBQA 2ZM2A 4JI0T 3VRAA 2HH7A 1NENA 4PFOA 3U8MA 4DMWA 5EK3A 4ZHQE 4LF4T 3EDVA 4N78D 4DV0T 4YSXA 4EEDA 1U4QA 4UF0A 5FYMA 3KV4A 5FY1A 4IHJE 2L8KA 2QVAA 2XQ9A 5FMNA 3LFMA 2XM1A 1LKXA 1OEDA 2V6XA 5AQIB 4JV5T 2KT9A 5LG3A 2JIWA 5CA0E 3PEOA 5CO5A 3ZSTA 5JRCA 4TNWA 5BP0A 1ZEEA 2YOEA 2IC6A 3Q5WA 4DR1T 4UM3P 1OXZA 3IHRA 4QACA 3WTJA 4YT0A 3AE6A 5AFMB 1MIWA 2WZIA 2V6YB 2CE7A 3ZN1B 4DR6T 3ETUA 2MYSA 2LRLA 2HPLA 2A72A 4QXHB 4TWHA 4B5DA 2FBWA 4X66T 5L3EB 4IIJE 2L9QA 4WYVA 3AE3A 5DJQC 5L3BB 1DU2A 4DUYT 4NIQA 4JI8T 3U8LA 4IE4A 2XNVA 3UQ7A 5AFJA 1YD8G 4XZCA 4EZ4A 3WTNA 1UCUA 5HXHA 4FRRA 2ZM0A 3AE7A 4KX6A 1HCIA 2E5LT 4HFDA 4AKGA 2EHOC 4IE7A 4NXNT 1MMGA 4HN9A 4AFHA 4O4LE 3RYFE 4KBMB 2V5CA 2LKGA 3EABA 2ACXA 1BR2A 1ZOYA 4ZJTA 4IREA 2DWKA 4YHJA 5JVDE 2IUBA 3WTIA 2VWAA 4IL9A 4AKLA 2I59A 2CCQA 4QWNB 3EHZA 2N9DA 5HCJA 2JQHA 2YU2A 3X1DA 3TLTA 3AA0B 2VKHA 3L3PA 5BRXA 2FUPA 1NEKA 4LF5T 2WM9A 2X9XA 5IWAT 2MAWA 5SYOA 4V1Av 5J1GA 2N2NA 5KZUA 2WAUA 3PUYF 3AE8A 2W67A 2BG9E 4HFIA 4UELA 4HFEA 3RRCA 2YINA 3RIUC 4ALXA 2VL8A 2SPCA 5IHYA 4AXPA 3LG7A 2LM9A 2NR4A 2ZLYA 4ILBA 5FJVA 4H63V 4CXYA 1D1BA 2X68A 5JR9A 2WDVA 2XAHB 5LNKA 1WRDA 4LF8T 4IE5A 3O4XE 2DLRA 4WBNE 3ZMUB 3UUXB 4OHFA 1D0ZA 4G2AA 4HFCA 2E9XD 2XTLA 2XYTA 1T8BA 2K9AA 4AKIA 3RQUA 3U8KA 5FVLA 5AQHB 2Y54A 3CIRA 4AI6A 3RC3A 3F57A 4GK5E 2X67A 2LRKA 3WTMA 4NUUA 2XQ3A 3SWHA 2A9UA 1HNZT 3QC9A 3NKZA 2H7OA 2G0UA 2NWBA 4LF9T 3O9XA 1M7KA 5ETWA 2W63A 2WB5A 5LA6E 4YHHT 2ZMAA 1E7PA 4DV1T 2WZYA 4HE8A 4JBWF 4HFBA 2WS3A 4F8HA 1Y01A 4X65T 1HG5A 3P4WA 3HA4A 3Q5EA 4HFHA 2GK9A 5FXWA 5J5GA 2Q9QC 4MFRA 3C4WA 2V5DA 2LJLA 2LSGA 3VRBA 2XZ5A 3OJAA 4HWIB 4XHEA 4U72A 4DV3T 1SHZC 2XY8B 3SQ6A 3UU8A 2W00A 3JC6C 3TLWA 1YXRA 2L3LA 4UXUA 4DR4T 3S4UA 3T8OA 2CBJA 2JMHA 2WDQA 5ABHA 2WZHA 3BQIA 3KDSE 4O4IE 3AVSA 1U5PA 4O4JE 4TN7B 3VR8A 3ZN0B 4XBFB 2IAKA 3N2OA 4U74A 2D2SA 4B3TT 3AEGA 3MACA 1KNRA 1XZYA 3QNUA 2BYNA 4IDPA 1J1JA 2Y8DA 4PK5A 4X1YE 2BZBA 2E9XA 4DV5T 3WI3A 5BW2A 2X51A 2D0UA 2B76A 4HWCA 2DHRA 4Z91A 3AA1B 2JQKA 4YLHA 2XQ8A 4TZ4C 4Z8XA 3M65A 3A7MA 2NOXA 2UXCT 1YKEB 4P0BA 2HN1A 4ZEYA 1UX2A 1WR6A 2RP4A 1XNRT 3AB3B 3DP7A 3PJAA 5FVKA 5L3FB 3N5LA 3PDYA 3GWHA 1US7B 4E7ZA 1WR0A 2BG9A 4TWFA 4ILUA 4NXMT 3BQLA 3HL6A 1XMOT 5TVCA 4AFGA 4UV8B 2V8SV 5H6QB 2K48A 3PUQA 3ZDHA 2OA5A 4BJNA 4PJMA 1HR0T 5LBQB 4PFPA 4P0AA 3ZJ2A 3UTKA 5LCYA 1AJ3A 4EYYR 4MLKA 1ZP0A 4X5TA 3ZC1A 4ZS2A 3VU7H 3ESLA 3OBVE 1N34T 2LHNA 3I0OA 5L3GB 5FXZA 3KV6A 3N9NA 2MBGA 3I0QA 3ANWB 1WFDA 1MNEA 5AQFB 4A56A 2D9DA 1XMQT 4MHCA 4JI3T 1KK7A 3NBXX 4Z90A 5LXTE 1QUUA 5C8YE 2K3WA 3PTRB 4GOUA 2EHOB 4CI2B 5AQGB 3SFEA 3VKHA 3RIAA 3ONJA 1ZHCA 3IF8B 1E1HB 5JTGA 1FJGT 3N9OA 2VKJA 1HX1B 4LF7T 4U7YA 3OTOT 5ABEA 4QHOA 3V5UA 5AQQB 4B6XA 5FL0A 1D0XA 2DL1A 4XK9A 3U78A 4H9OC 4ZI2C 3BQKA 3E22E 5ADXL 4EAHA 4YSZA 5J5IA 3QOFA 3ZMZB 4U2ZA 1OEDB 4DV6T 2DNXA 3EVYA 2V7JA 2X0LB 2UU9T 2HHHT 3K3NA 2IW5B 1JNRA 4ADZA 3FBZA 2H7VC 2XAFB 2H88A 3MKDA 2D5UA 1VRBA 2IIUA 5L2LA 3JAEA 4TV9E 4H9RC 3G06A 3V5SA 2LOPA 2CRBA 3R6NA 4CN1A 4DO0A 3UU4A 2XNTA 3WTLA 3K1SA 4GKJT 1KEYA 3FXEB 2BR8A 5AINA 4AFTA 4EGWA 4G63A 2LLYA 4TV8E 4ZI3C 2UUBT 5LHIB 5FY0A 4DV4T 5LOVE 3EUHA 2BJ0A 3JADA 2JQQA 3UT5E 4QX8B 2DI4A 3P8CD 5LG4A 2WBLA 2A3DA 2BS3A 3O1HA 4QH5A 2M6IA 4ZJSA 2XQYA 5CFBA 2YDQA 4B3MT 4UEMA 3MJXA 4HEAA 1CHUA 5HEJA 4DR2T 2C5JA 2X9YA 2Y48B 2H89A 3TLUA 4ZK4A 2CHNA 2FJDA 3PUSA 3N2GE 5J5HA 3PUAA 2FJAA 3M3ZB 2CLYB 1UGOA 3AVRA 3OVUA 3C4XA 3ONLC 4COFA 3B57A 3VKGA 1UURA 4JI5T 3KBUA 5LHHB 3ZT6A 3CVRA 2IMLA 2Q9QB 2X66A 2RA1A 2WMOA 4BA9A 2LEHA 5FL1A 3AXJB 1HNXT 2NW9A 2WP9A 3AEBA 2KZ7B 1X9BA 1IBKT 1YQ4A 3RLFF 2KLQA 2VQFT 2CPTA 4U2YA 3NRXA 3BK9A 3KFWX 1HNWT 2ZJVA 5AFNA 2XSAA 1R8IA 4A97A 1I6ZA 3N9QA 2UUCT 3J9X1 4BJMA 4IL4A 2V6YA 2W8GA 1IJ5A 5HWXA 2ODVA 3RRWA 4NZBA 3O1JA 5JREA 2ZM6T 3QUJA 3PMZA 2VK9A 5BMVE 4ZK1A 5JDNA 4I50E 2BYSA 2LKHA 4ISTA 3A8YC 1KF6A 1V9DA 3ZYLA 1OEDC 2J4GA 4LMKA 4U31A 3CK6A 3WIPA 3Q5XA 1YW0A 4X62T 2YMDA 4QH4A 2WDRA 3LBXB 4DR7T 5LMNT 2ES0A 4K0UA 4U7IA 3KVAA 1T72A 4BAYB 3RH3A 2XJ7A 2WSSV 2KWHA 3I9YA 4YXDA 2M67A 1EZ3A 5HWYA 5AQNB 1QSDA 5ABFB 5JDFA 1H7CA 2XPKA 3GMIA 3RKGA 3UUBA 5LMUT 1IZNB 4AKRB 3PE0A 3WTOA 3WTHA 4UM1A 5H6RB 1G73A 5F3JA 4PW8A 2I0MA 3C64A 4YTPA 5JDLA 4UVBB 1UV6A 2F4VT 3K8PC 2AE9A 2HPJA 2RPAA 3T1YT 4WNKA 2KINB 5L3DB 4YTNA 3WAKA 1VCSA 3ZPOA 3PUWF 3AE9A 2W61A 4LMJA 5LP6E 4NPPA 1UX5A 5FKYA 1ZKEA 2BKOA 2LSKA 5LBMA 1WLXA 2VQET 4ILCA 3ETVA 3I9WA 1MIYA 1W9RA 3PU8A 4AQYT 1E2AA 2CLYC 3NZQA 4WW0A 2YDRA 3UU3A 2C5KT 3GUAA 3AEEA 2FJBA 4K0KT 4YJ3E 4KHPT 2ACZA 1L0VA 3KVBA 2X0HA 4QXCB 3AAIA 4LFAT 3OPCA 3CQGB 2VURA 3ZMTB 1LVKA 5AFUL 3HKCE 2XQ4A 1YQ3A 3OYXA 3LJCA 3U3IA 1CUNA 5L4HA 4AQFC 3CKDA 4IT4A 1VCTA 2C5IT 4P09A 4QX7B 3SFDA 5FNVE 4DR3T 3AA6B 4H9QC 4QABA 5FY7A 3HKDE 4LFCT 3SOLA 4H9PC 4JI7T 5A1LA 2BVMA 5HAXA 5AQTB 5J5FA 4UR9A 5JR9C 3FBLA 5ABGA 3AAEB 2NW7A 2XZ6A
chains in the Genus database with same CATH topology
3T4MA 4HFBA 3P50A 1I9BA 4TWHA 4B5DA 4F8HA 3U8JA 2YMEA 2MAWA 5SYOA 2KSRA 3PMZA 4QH1A 4LMJA 4UM3S 4ZK1A 2BYSA 1UX2A 4NPPA 4QAAA 3SH1A 4BFQA 2LKHA 4ZZCA 2QC1B 3P4WA 2Y56A 5J0ZA 5KZUA 4TWDA 4HFHA 4QH5A 1OEDC 3U8LA 5J5GA 2M6IA 2BG9E 4ILCA 2YN6A 4HFIA 4LMKA 1UW6A 4PIRA 5CFBA 4ZJSA 5AFMA 5AFKA 4HFEA 5L47A 5IUXA 3WIPA 2XNVA 4DBMA 4XK9A 5HEOA 5HEJA 3UQ7A 4ALXA 3EI0A 5AFHA 2BG9B 5AFJA 2BG9A 2YMDA 2BYQA 3ZKRA 4QH4A 4TWFA 2PH9A 3SQ9A 5AFLA 3WTNA 4TNVA 5J5IA 2YKSA 2XZ5A 3TLUA 2XQ5A 3RIFA 2Y57A 3U8MA 4XHEA 4ZK4A 1OEDB 4ILBA 2WNJA 3UU3A 4FRRA 3SIOA 3GUAA 2WNLA 5FJVA 3SQ6A 3UU8A 5TVCA 5HEUA 4AFGA 3TLWA 5J5HA 4ZRUA 4UXUA 5HEHA 3UQ4A 4ZR6A 4HFDA 2VL0A 3UU5A 3EAMA 3ZDHA 3TLSA 5KE4A 2XQ7A 4UY2A 2PGZA 4COFA 3IGQA 1OEDE 4AFHA 2XQ9A 3JAEA 2C9TA 4HFCA 3RQWA 2XYTA 2XQ4A 4ZZBA 3UUBA 2X00D 3RI5A 2LKGA 3LSVA 2Y7YA 3U8NA 2LM2A 5L4HA 5L4EA 3C79A 3WTOA 3RQUA 1OEDA 2BYPA 4A98A 3U8KA 4WV9A 4ZJTA 4D01A 4IREA 3WTHA 4X5TA 2Y54A 4UM1A 3UU4A 2XNTA 3WTLA 5JMEA 2W8FA 2ZJUA 2XNUA 3TLVA 5LG3A 2BR8A 5AINA 4AFTA 1UV6A 2XQAA 3WTIA 3UU6A 2BYNA 2XQ3A 2BR7A 2BYRA 3PEOA 3WTMA 5CO5A 4HQPA 5HCMA 4ILAA 2LLYA 4TNWA 4LMLA 5BP0A 4IL9A 2BG9C 2XYSA 5HEGA 2YOEA 2WN9A 2X00A 5BW2A 5LXBA 2ZJVA 5AFNA 2M6BA 4UM3P 3EHZA 3JAFA 4QACA 5HCJA 4QABA 4UM3A 4A97A 3WTJA 4Z90A 3TLTA 5AFMB 3C84A 2XQ6A 2WNCA 4EZ1A 2UZ6A 3WTKA 5J5FA 4IL4A 5BRXA 4Z91A 2W8GA 3RIAA 3RHWA 2BJ0A 4NZBA 4BQTA 3JADA 2XQ8A 2WZYA 2XZ6A 2Y58A 3ZDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4M A;  4HFB A;  3P50 A;  1I9B A;  4TWH A;  4B5D A;  4F8H A;  3U8J A;  2YME A;  2MAW A;  5SYO A;  2KSR A;  3PMZ A;  4QH1 A;  4LMJ A;  4UM3 S;  4ZK1 A;  2BYS A;  1UX2 A;  4NPP A;  4QAA A;  3SH1 A;  4BFQ A;  2LKH A;  4ZZC A;  2QC1 B;  3P4W A;  2Y56 A;  5J0Z A;  5KZU A;  4TWD A;  4HFH A;  4QH5 A;  1OED C;  3U8L A;  5J5G A;  2M6I A;  2BG9 E;  4ILC A;  2YN6 A;  4HFI A;  4LMK A;  1UW6 A;  4PIR A;  5CFB A;  4ZJS A;  5AFM A;  5AFK A;  4HFE A;  5L47 A;  5IUX A;  3WIP A;  2XNV A;  4DBM A;  4XK9 A;  5HEO A;  5HEJ A;  3UQ7 A;  4ALX A;  3EI0 A;  5AFH A;  2BG9 B;  5AFJ A;  2BG9 A;  2YMD A;  2BYQ A;  3ZKR A;  4QH4 A;  4TWF A;  2PH9 A;  3SQ9 A;  5AFL A;  3WTN A;  4TNV A;  5J5I A;  2YKS A;  2XZ5 A;  3TLU A;  2XQ5 A;  3RIF A;  2Y57 A;  3U8M A;  4XHE A;  4ZK4 A;  1OED B;  4ILB A;  2WNJ A;  3UU3 A;  4FRR A;  3SIO A;  3GUA A;  2WNL A;  5FJV A;  3SQ6 A;  3UU8 A;  5TVC A;  5HEU A;  4AFG A;  3TLW A;  5J5H A;  4ZRU A;  4UXU A;  5HEH A;  3UQ4 A;  4ZR6 A;  4HFD A;  2VL0 A;  3UU5 A;  3EAM A;  3ZDH A;  3TLS A;  5KE4 A;  2XQ7 A;  4UY2 A;  2PGZ A;  4COF A;  3IGQ A;  1OED E;  4AFH A;  2XQ9 A;  3JAE A;  2C9T A;  4HFC A;  3RQW A;  2XYT A;  2XQ4 A;  4ZZB A;  3UUB A;  2X00 D;  3RI5 A;  2LKG A;  3LSV A;  2Y7Y A;  3U8N A;  2LM2 A;  5L4H A;  5L4E A;  3C79 A;  3WTO A;  3RQU A;  1OED A;  2BYP A;  4A98 A;  3U8K A;  4WV9 A;  4ZJT A;  4D01 A;  4IRE A;  3WTH A;  4X5T A;  2Y54 A;  4UM1 A;  3UU4 A;  2XNT A;  3WTL A;  5JME A;  2W8F A;  2ZJU A;  2XNU A;  3TLV A;  5LG3 A;  2BR8 A;  5AIN A;  4AFT A;  1UV6 A;  2XQA A;  3WTI A;  3UU6 A;  2BYN A;  2XQ3 A;  2BR7 A;  2BYR A;  3PEO A;  3WTM A;  5CO5 A;  4HQP A;  5HCM A;  4ILA A;  2LLY A;  4TNW A;  4LML A;  5BP0 A;  4IL9 A;  2BG9 C;  2XYS A;  5HEG A;  2YOE A;  2WN9 A;  2X00 A;  5BW2 A;  5LXB A;  2ZJV A;  5AFN A;  2M6B A;  4UM3 P;  3EHZ A;  3JAF A;  4QAC A;  5HCJ A;  4QAB A;  4UM3 A;  4A97 A;  3WTJ A;  4Z90 A;  3TLT A;  5AFM B;  3C84 A;  2XQ6 A;  2WNC A;  4EZ1 A;  2UZ6 A;  3WTK A;  5J5F A;  4IL4 A;  5BRX A;  4Z91 A;  2W8G A;  3RIA A;  3RHW A;  2BJ0 A;  4NZB A;  4BQT A;  3JAD A;  2XQ8 A;  2WZY A;  2XZ6 A;  2Y58 A;  3ZDG A; 
#chains in the Genus database with same CATH topology
 3RKO A;  2V7M A;  3LK4 2;  4EOZ B;  3U8J A;  3CX7 B;  3ONX A;  2PJQ A;  4JI6 T;  4QXB B;  3E08 A;  4EYU A;  5EZY E;  3Q2M A;  2VKO A;  1XDP A;  3EI0 A;  4JI2 T;  3HKE E;  3CQC B;  3AE1 A;  1O3X A;  2KND A;  4GKK T;  1BR0 A;  4I4T E;  3F31 A;  3VR9 A;  3B5M A;  2BS2 A;  4HWD A;  3FZH B;  2W4X A;  5KE4 A;  2BBJ A;  3AE2 A;  4AIU A;  3RQW A;  1Z8U A;  2X00 D;  1IJ6 A;  2LM2 A;  1J5E T;  2KMF A;  5L4E A;  4L9I A;  4D01 A;  2NTY A;  4HWH A;  3H3A A;  1GQE A;  3RGL A;  2UUA T;  4DV7 T;  2XNU A;  2EHO D;  3GN5 A;  2JPF A;  2BYR A;  4OK0 A;  4CN4 A;  3WAJ A;  2VKD A;  2XYS A;  1IAP A;  2LSI A;  4UV9 B;  5LXB A;  2I6H A;  3L8R A;  3AEF A;  2P9B A;  5AQO B;  2J1D G;  2WCA A;  4JI4 T;  4BQT A;  4ZI7 E;  3ZLI A;  4EZH A;  3ZDG A;  2Y58 A;  3ZC0 A;  3K3Q C;  2J47 A;  5FXX A;  4QH1 A;  2BDE A;  4B3S T;  4QAA A;  2Y56 A;  4ZS3 A;  4TWD A;  4LFB T;  1Z0P A;  4OYK A;  3CPZ A;  5AFL A;  4UXN B;  3ZCJ A;  4TNV A;  2YKS A;  4JI1 T;  3RIF A;  5FXV A;  4B3R T;  1G8X A;  4JEH B;  3UFG A;  3K3O A;  4YTM A;  4EV6 A;  1BR1 A;  4YFS A;  4UF0 B;  2CA5 A;  5HEH A;  4I43 B;  2UXX B;  1WCR A;  5LGU B;  2XQ7 A;  3IGQ A;  3AE4 A;  3ZMS B;  1WYC A;  2Y7Y A;  4A5X A;  4MBQ A;  3RF1 A;  5JME A;  2BKP A;  3N2K E;  1MMD A;  1M62 A;  5KX5 E;  5JRC B;  4GYR A;  1MMN A;  4LML A;  5JDM A;  2BG9 C;  3FZK B;  3PUX F;  5HEG A;  3ANW A;  3Q5D A;  2X00 A;  2WU5 A;  1HFA A;  1B7T A;  5HXE A;  2YDS A;  1QLB A;  4EZ1 A;  2WNC A;  2YK0 A;  3C4Z A;  2EHO A;  3VHL A;  3IBP A;  1YKH B;  2XUE A;  4Q25 A;  4CZZ B;  4DID B;  3D0T A;  4IDZ A;  1I9B A;  4MAL A;  3P4R A;  2YME A;  2YEV C;  3AEC A;  1JNZ A;  4X64 T;  4JUY A;  3NRY A;  4PJN A;  2MTQ A;  3HI2 A;  1KFY A;  4O8S A;  2CHO A;  4X20 E;  4DBM A;  4UIG A;  5HEO A;  4HFV A;  4IE0 A;  2X9W A;  4H9N C;  2DCF A;  2XM2 A;  4EB6 E;  4PJJ A;  3LDQ B;  3DTO A;  2XQ5 A;  3SRZ A;  4ERR A;  2OLT A;  1LRZ A;  3FZM B;  4O4H E;  2WNL A;  2E2A A;  3EDU A;  2E8I A;  2Q9Q D;  5HEU A;  1J5W A;  2A2F X;  2C0S A;  4O2A E;  4IDN A;  2UXN B;  3IA3 A;  4UY2 A;  2PGZ A;  4H63 H;  3PUR A;  3T1H T;  3P4Q A;  3P4P A;  1SA0 E;  3N9M A;  4DUZ T;  5C3J A;  3JC6 D;  4O2B E;  4CI3 B;  4PNI A;  2W8F A;  3RIU A;  3AAA B;  4WBO A;  1HG2 A;  2PG8 A;  3UU6 A;  2BR7 A;  3HR0 A;  3L09 A;  3RYH E;  5GON E;  2DWG A;  2W62 A;  2WQY A;  2CXD A;  4PK4 A;  3KV9 A;  4DBR A;  1OWA A;  4CN6 A;  4FI5 A;  4CXX A;  3ZT5 A;  2XQ6 A;  3C84 A;  4HTE A;  3WTK A;  4ANJ A;  1I94 T;  2WWV A;  1MND A;  4QKN A;  3T4M A;  2CXF A;  4U3C A;  4ZZC A;  2H3R A;  5AQU B;  2NW8 A;  3AE5 A;  5LHG B;  2K24 A;  5DAB A;  4CI1 B;  2NP9 A;  5AFM A;  2LSY A;  5HYA A;  3C50 A;  3C98 B;  2JRK A;  5AFH A;  1VOM A;  3CML A;  1UUS A;  1N33 T;  3SQ9 A;  2QGS A;  2VAS A;  4PK6 A;  3SIO A;  5JR9 B;  5M4Y A;  2X9H A;  4ZRU A;  4GIW A;  1HS7 A;  2QA7 A;  5EK2 A;  4YJ2 E;  4M1P A;  5KMG P;  1LVF A;  5KDM C;  1N32 T;  3W15 B;  2N1G A;  3PUZ F;  3U8N A;  5CJ5 A;  3C79 A;  2BYP A;  2Q9Q A;  4TUY E;  3N9L A;  3AXJ A;  5JQG E;  4GYS A;  2XZE A;  1HX8 A;  2XHE B;  3C51 A;  4DVD A;  3FZF B;  2LE8 A;  1HTJ F;  2IDO B;  3A5X A;  4OX9 T;  1XNQ T;  4EIW A;  3P4S A;  1W0A A;  2D0T A;  3CQX C;  2M6B A;  3I1A A;  2E5V A;  4I55 E;  5LJM A;  3ABV A;  5KXJ A;  3JCF A;  4E7S A;  3L39 A;  4AQF A;  1HF8 A;  4JYA T;  2BBH A;  1S35 A;  5LGT B;  4UM3 S;  4BFQ A;  2BVL A;  2B1E A;  4P1N A;  1FMW A;  4ISS A;  4H9S E;  2XAJ B;  5JDH A;  2WU2 A;  5HXC A;  3FZL B;  2WY2 A;  5F5W A;  1Y64 B;  3UUM A;  4EEB A;  1SE7 A;  1MMA A;  3MZK B;  2PH9 A;  5C2T A;  3LBX A;  2J62 A;  2WNJ A;  2CM0 A;  3ZSS A;  3UUN A;  3P7I A;  2MPK A;  3QB5 A;  2WMN A;  3PJA J;  4IE6 A;  3UQ4 A;  4ZR6 A;  5FP3 A;  2VL0 A;  2K5B B;  2PBI A;  1FEW A;  4ZI2 D;  2QRX A;  5AQJ B;  5ABF A;  3FHN A;  4HWF A;  2C9T A;  4AKH A;  1X79 A;  2Y6X A;  4DND A;  3RI5 A;  2V7L A;  1N36 T;  2W2U A;  5CB4 E;  4A98 A;  1D1A A;  2PTF A;  4KP3 C;  2V7K A;  2YU1 A;  3HKB E;  2KWI B;  2VVS A;  2V7I A;  5AQM B;  2ZJU A;  3B13 A;  3AED A;  1FMV A;  2XQA A;  1MIV A;  5LYJ E;  4ILA A;  3ZYK A;  2E9X B;  2LOS A;  2XSB A;  3FB2 A;  4XAX B;  1W0B A;  3RX6 A;  2X0Y A;  4C91 A;  3RPU A;  2BKN A;  4JEU B;  3SS1 A;  5J2U E;  1FIO A;  3J7Y q;  3RYI E;  3RHW A;  1NWM X;  4CXW A;  1KNZ A;  5CGM A;  4ZI3 D;  5DQV A;  3ZEF B;  2CWO A;  2VB6 A;  5L3C B;  4FJO A;  3H37 A;  4X1K E;  3SH1 A;  2OV9 A;  4ZOL E;  4KHZ F;  5EK4 A;  3R84 B;  3TKL B;  5AFK A;  3CX6 B;  1BR4 A;  2CMR A;  5IUX A;  2V1D B;  1IBL T;  3IEE A;  5AQK B;  5AQV B;  2BG9 B;  3LK2 B;  2BYQ A;  2VVN A;  5LGN B;  3ZT7 A;  3KIN B;  4EXT A;  5E0O A;  4ASK A;  2W0G A;  5CA1 E;  3KV5 A;  3GN5 B;  2FJE A;  3H3M A;  5AQR B;  3UU5 A;  3EAM A;  3MK7 C;  3TLS A;  2JJ9 A;  1OED E;  3PV0 F;  5LB7 B;  2UXD T;  2BS4 A;  4ZZB A;  3LSV A;  2CXL A;  4JLE A;  4U33 A;  3ZJ1 A;  3AA7 B;  1WYB A;  5BR8 T;  1XDO A;  4UVA B;  2AXD S;  3E0Z A;  3N9P A;  4YY3 T;  4HQP A;  5HCM A;  3KBT A;  2Z6E A;  2LHR A;  3NZP A;  4KMC A;  4WZX A;  1XWM A;  4IGU A;  4UM3 A;  2LSJ A;  5LJN A;  2UZ6 A;  2R6G F;  2XAG B;  5DQW A;  4IDQ A;  4YSY A;  4KUM B;  4PAG A;  3ZMV B;  2KSR A;  1T98 A;  4GK0 E;  5J0Z A;  4L5G A;  4AIS A;  2YN6 A;  5L47 A;  3UUL A;  2QYW A;  1UK5 A;  1IBM T;  3RYC E;  2HN2 A;  5AQP B;  5HXR A;  3OYZ A;  2JMK A;  5JDQ A;  3ZKR A;  2WWU A;  2PFV A;  1W09 A;  5IYZ E;  2ODU A;  3RC8 A;  2Y57 A;  2XAQ B;  3Q9D A;  4HGA A;  2IHR 1;  4KI0 F;  2LT3 A;  1NAF A;  4UVC B;  2CEA A;  3LK3 B;  3MA9 A;  5TAO A;  1ZV4 X;  4DV2 T;  4F6R C;  3FXD B;  3PUV F;  4C90 A;  4DR5 T;  2V26 A;  2W66 A;  1D1C A;  3MXZ A;  5AQL B;  4TX5 A;  4L0R A;  2E9X C;  3PU3 A;  4NUV A;  2XAS B;  3GA8 A;  4ZXL A;  5F8P A;  4WV9 A;  5J2T E;  1SUM B;  2JQ9 A;  3NWI A;  2MOZ A;  4PJL A;  4DMV A;  2CBI A;  3TLV A;  5JDG A;  1KNP A;  1D0Y A;  3QB5 K;  2UXB T;  3QK6 A;  4CQI A;  3PUG A;  3NVO A;  3AEA A;  3O1I A;  3ZCI A;  2CWY A;  2WN9 A;  3UFE A;  3JAF A;  3CX8 B;  4HKA A;  2KXP B;  4OFZ A;  2NTX A;  1UX4 A;  4AQG A;  5AQS B;  1T7S A;  3P50 A;  4OYJ A;  3OKQ A;  3CWZ B;  3ZYM A;  5JH7 E;  1S94 A;  4X1I E;  2ZM8 A;  2QC1 B;  2IC9 A;  4J2C A;  3DJB A;  5HXS A;  4PIR A;  1UW6 A;  3F2E A;  4LF6 T;  4I0U A;  4IDO A;  4DBQ A;  2ZM2 A;  4JI0 T;  3VRA A;  2HH7 A;  1NEN A;  4PFO A;  3U8M A;  4DMW A;  5EK3 A;  4ZHQ E;  4LF4 T;  3EDV A;  4N78 D;  4DV0 T;  4YSX A;  4EED A;  1U4Q A;  4UF0 A;  5FYM A;  3KV4 A;  5FY1 A;  4IHJ E;  2L8K A;  2QVA A;  2XQ9 A;  5FMN A;  3LFM A;  2XM1 A;  1LKX A;  1OED A;  2V6X A;  5AQI B;  4JV5 T;  2KT9 A;  5LG3 A;  2JIW A;  5CA0 E;  3PEO A;  5CO5 A;  3ZST A;  5JRC A;  4TNW A;  5BP0 A;  1ZEE A;  2YOE A;  2IC6 A;  3Q5W A;  4DR1 T;  4UM3 P;  1OXZ A;  3IHR A;  4QAC A;  3WTJ A;  4YT0 A;  3AE6 A;  5AFM B;  1MIW A;  2WZI A;  2V6Y B;  2CE7 A;  3ZN1 B;  4DR6 T;  3ETU A;  2MYS A;  2LRL A;  2HPL A;  2A72 A;  4QXH B;  4TWH A;  4B5D A;  2FBW A;  4X66 T;  5L3E B;  4IIJ E;  2L9Q A;  4WYV A;  3AE3 A;  5DJQ C;  5L3B B;  1DU2 A;  4DUY T;  4NIQ A;  4JI8 T;  3U8L A;  4IE4 A;  2XNV A;  3UQ7 A;  5AFJ A;  1YD8 G;  4XZC A;  4EZ4 A;  3WTN A;  1UCU A;  5HXH A;  4FRR A;  2ZM0 A;  3AE7 A;  4KX6 A;  1HCI A;  2E5L T;  4HFD A;  4AKG A;  2EHO C;  4IE7 A;  4NXN T;  1MMG A;  4HN9 A;  4AFH A;  4O4L E;  3RYF E;  4KBM B;  2V5C A;  2LKG A;  3EAB A;  2ACX A;  1BR2 A;  1ZOY A;  4ZJT A;  4IRE A;  2DWK A;  4YHJ A;  5JVD E;  2IUB A;  3WTI A;  2VWA A;  4IL9 A;  4AKL A;  2I59 A;  2CCQ A;  4QWN B;  3EHZ A;  2N9D A;  5HCJ A;  2JQH A;  2YU2 A;  3X1D A;  3TLT A;  3AA0 B;  2VKH A;  3L3P A;  5BRX A;  2FUP A;  1NEK A;  4LF5 T;  2WM9 A;  2X9X A;  5IWA T;  2MAW A;  5SYO A;  4V1A v;  5J1G A;  2N2N A;  5KZU A;  2WAU A;  3PUY F;  3AE8 A;  2W67 A;  2BG9 E;  4HFI A;  4UEL A;  4HFE A;  3RRC A;  2YIN A;  3RIU C;  4ALX A;  2VL8 A;  2SPC A;  5IHY A;  4AXP A;  3LG7 A;  2LM9 A;  2NR4 A;  2ZLY A;  4ILB A;  5FJV A;  4H63 V;  4CXY A;  1D1B A;  2X68 A;  5JR9 A;  2WDV A;  2XAH B;  5LNK A;  1WRD A;  4LF8 T;  4IE5 A;  3O4X E;  2DLR A;  4WBN E;  3ZMU B;  3UUX B;  4OHF A;  1D0Z A;  4G2A A;  4HFC A;  2E9X D;  2XTL A;  2XYT A;  1T8B A;  2K9A A;  4AKI A;  3RQU A;  3U8K A;  5FVL A;  5AQH B;  2Y54 A;  3CIR A;  4AI6 A;  3RC3 A;  3F57 A;  4GK5 E;  2X67 A;  2LRK A;  3WTM A;  4NUU A;  2XQ3 A;  3SWH A;  2A9U A;  1HNZ T;  3QC9 A;  3NKZ A;  2H7O A;  2G0U A;  2NWB A;  4LF9 T;  3O9X A;  1M7K A;  5ETW A;  2W63 A;  2WB5 A;  5LA6 E;  4YHH T;  2ZMA A;  1E7P A;  4DV1 T;  2WZY A;  4HE8 A;  4JBW F;  4HFB A;  2WS3 A;  4F8H A;  1Y01 A;  4X65 T;  1HG5 A;  3P4W A;  3HA4 A;  3Q5E A;  4HFH A;  2GK9 A;  5FXW A;  5J5G A;  2Q9Q C;  4MFR A;  3C4W A;  2V5D A;  2LJL A;  2LSG A;  3VRB A;  2XZ5 A;  3OJA A;  4HWI B;  4XHE A;  4U72 A;  4DV3 T;  1SHZ C;  2XY8 B;  3SQ6 A;  3UU8 A;  2W00 A;  3JC6 C;  3TLW A;  1YXR A;  2L3L A;  4UXU A;  4DR4 T;  3S4U A;  3T8O A;  2CBJ A;  2JMH A;  2WDQ A;  5ABH A;  2WZH A;  3BQI A;  3KDS E;  4O4I E;  3AVS A;  1U5P A;  4O4J E;  4TN7 B;  3VR8 A;  3ZN0 B;  4XBF B;  2IAK A;  3N2O A;  4U74 A;  2D2S A;  4B3T T;  3AEG A;  3MAC A;  1KNR A;  1XZY A;  3QNU A;  2BYN A;  4IDP A;  1J1J A;  2Y8D A;  4PK5 A;  4X1Y E;  2BZB A;  2E9X A;  4DV5 T;  3WI3 A;  5BW2 A;  2X51 A;  2D0U A;  2B76 A;  4HWC A;  2DHR A;  4Z91 A;  3AA1 B;  2JQK A;  4YLH A;  2XQ8 A;  4TZ4 C;  4Z8X A;  3M65 A;  3A7M A;  2NOX A;  2UXC T;  1YKE B;  4P0B A;  2HN1 A;  4ZEY A;  1UX2 A;  1WR6 A;  2RP4 A;  1XNR T;  3AB3 B;  3DP7 A;  3PJA A;  5FVK A;  5L3F B;  3N5L A;  3PDY A;  3GWH A;  1US7 B;  4E7Z A;  1WR0 A;  2BG9 A;  4TWF A;  4ILU A;  4NXM T;  3BQL A;  3HL6 A;  1XMO T;  5TVC A;  4AFG A;  4UV8 B;  2V8S V;  5H6Q B;  2K48 A;  3PUQ A;  3ZDH A;  2OA5 A;  4BJN A;  4PJM A;  1HR0 T;  5LBQ B;  4PFP A;  4P0A A;  3ZJ2 A;  3UTK A;  5LCY A;  1AJ3 A;  4EYY R;  4MLK A;  1ZP0 A;  4X5T A;  3ZC1 A;  4ZS2 A;  3VU7 H;  3ESL A;  3OBV E;  1N34 T;  2LHN A;  3I0O A;  5L3G B;  5FXZ A;  3KV6 A;  3N9N A;  2MBG A;  3I0Q A;  3ANW B;  1WFD A;  1MNE A;  5AQF B;  4A56 A;  2D9D A;  1XMQ T;  4MHC A;  4JI3 T;  1KK7 A;  3NBX X;  4Z90 A;  5LXT E;  1QUU A;  5C8Y E;  2K3W A;  3PTR B;  4GOU A;  2EHO B;  4CI2 B;  5AQG B;  3SFE A;  3VKH A;  3RIA A;  3ONJ A;  1ZHC A;  3IF8 B;  1E1H B;  5JTG A;  1FJG T;  3N9O A;  2VKJ A;  1HX1 B;  4LF7 T;  4U7Y A;  3OTO T;  5ABE A;  4QHO A;  3V5U A;  5AQQ B;  4B6X A;  5FL0 A;  1D0X A;  2DL1 A;  4XK9 A;  3U78 A;  4H9O C;  4ZI2 C;  3BQK A;  3E22 E;  5ADX L;  4EAH A;  4YSZ A;  5J5I A;  3QOF A;  3ZMZ B;  4U2Z A;  1OED B;  4DV6 T;  2DNX A;  3EVY A;  2V7J A;  2X0L B;  2UU9 T;  2HHH T;  3K3N A;  2IW5 B;  1JNR A;  4ADZ A;  3FBZ A;  2H7V C;  2XAF B;  2H88 A;  3MKD A;  2D5U A;  1VRB A;  2IIU A;  5L2L A;  3JAE A;  4TV9 E;  4H9R C;  3G06 A;  3V5S A;  2LOP A;  2CRB A;  3R6N A;  4CN1 A;  4DO0 A;  3UU4 A;  2XNT A;  3WTL A;  3K1S A;  4GKJ T;  1KEY A;  3FXE B;  2BR8 A;  5AIN A;  4AFT A;  4EGW A;  4G63 A;  2LLY A;  4TV8 E;  4ZI3 C;  2UUB T;  5LHI B;  5FY0 A;  4DV4 T;  5LOV E;  3EUH A;  2BJ0 A;  3JAD A;  2JQQ A;  3UT5 E;  4QX8 B;  2DI4 A;  3P8C D;  5LG4 A;  2WBL A;  2A3D A;  2BS3 A;  3O1H A;  4QH5 A;  2M6I A;  4ZJS A;  2XQY A;  5CFB A;  2YDQ A;  4B3M T;  4UEM A;  3MJX A;  4HEA A;  1CHU A;  5HEJ A;  4DR2 T;  2C5J A;  2X9Y A;  2Y48 B;  2H89 A;  3TLU A;  4ZK4 A;  2CHN A;  2FJD A;  3PUS A;  3N2G E;  5J5H A;  3PUA A;  2FJA A;  3M3Z B;  2CLY B;  1UGO A;  3AVR A;  3OVU A;  3C4X A;  3ONL C;  4COF A;  3B57 A;  3VKG A;  1UUR A;  4JI5 T;  3KBU A;  5LHH B;  3ZT6 A;  3CVR A;  2IML A;  2Q9Q B;  2X66 A;  2RA1 A;  2WMO A;  4BA9 A;  2LEH A;  5FL1 A;  3AXJ B;  1HNX T;  2NW9 A;  2WP9 A;  3AEB A;  2KZ7 B;  1X9B A;  1IBK T;  1YQ4 A;  3RLF F;  2KLQ A;  2VQF T;  2CPT A;  4U2Y A;  3NRX A;  3BK9 A;  3KFW X;  1HNW T;  2ZJV A;  5AFN A;  2XSA A;  1R8I A;  4A97 A;  1I6Z A;  3N9Q A;  2UUC T;  3J9X 1;  4BJM A;  4IL4 A;  2V6Y A;  2W8G A;  1IJ5 A;  5HWX A;  2ODV A;  3RRW A;  4NZB A;  3O1J A;  5JRE A;  2ZM6 T;  3QUJ A;  3PMZ A;  2VK9 A;  5BMV E;  4ZK1 A;  5JDN A;  4I50 E;  2BYS A;  2LKH A;  4IST A;  3A8Y C;  1KF6 A;  1V9D A;  3ZYL A;  1OED C;  2J4G A;  4LMK A;  4U31 A;  3CK6 A;  3WIP A;  3Q5X A;  1YW0 A;  4X62 T;  2YMD A;  4QH4 A;  2WDR A;  3LBX B;  4DR7 T;  5LMN T;  2ES0 A;  4K0U A;  4U7I A;  3KVA A;  1T72 A;  4BAY B;  3RH3 A;  2XJ7 A;  2WSS V;  2KWH A;  3I9Y A;  4YXD A;  2M67 A;  1EZ3 A;  5HWY A;  5AQN B;  1QSD A;  5ABF B;  5JDF A;  1H7C A;  2XPK A;  3GMI A;  3RKG A;  3UUB A;  5LMU T;  1IZN B;  4AKR B;  3PE0 A;  3WTO A;  3WTH A;  4UM1 A;  5H6R B;  1G73 A;  5F3J A;  4PW8 A;  2I0M A;  3C64 A;  4YTP A;  5JDL A;  4UVB B;  1UV6 A;  2F4V T;  3K8P C;  2AE9 A;  2HPJ A;  2RPA A;  3T1Y T;  4WNK A;  2KIN B;  5L3D B;  4YTN A;  3WAK A;  1VCS A;  3ZPO A;  3PUW F;  3AE9 A;  2W61 A;  4LMJ A;  5LP6 E;  4NPP A;  1UX5 A;  5FKY A;  1ZKE A;  2BKO A;  2LSK A;  5LBM A;  1WLX A;  2VQE T;  4ILC A;  3ETV A;  3I9W A;  1MIY A;  1W9R A;  3PU8 A;  4AQY T;  1E2A A;  2CLY C;  3NZQ A;  4WW0 A;  2YDR A;  3UU3 A;  2C5K T;  3GUA A;  3AEE A;  2FJB A;  4K0K T;  4YJ3 E;  4KHP T;  2ACZ A;  1L0V A;  3KVB A;  2X0H A;  4QXC B;  3AAI A;  4LFA T;  3OPC A;  3CQG B;  2VUR A;  3ZMT B;  1LVK A;  5AFU L;  3HKC E;  2XQ4 A;  1YQ3 A;  3OYX A;  3LJC A;  3U3I A;  1CUN A;  5L4H A;  4AQF C;  3CKD A;  4IT4 A;  1VCT A;  2C5I T;  4P09 A;  4QX7 B;  3SFD A;  5FNV E;  4DR3 T;  3AA6 B;  4H9Q C;  4QAB A;  5FY7 A;  3HKD E;  4LFC T;  3SOL A;  4H9P C;  4JI7 T;  5A1L A;  2BVM A;  5HAX A;  5AQT B;  5J5F A;  4UR9 A;  5JR9 C;  3FBL A;  5ABG A;  3AAE B;  2NW7 A;  2XZ6 A; 
#chains in the Genus database with same CATH homology
 3T4M A;  4HFB A;  3P50 A;  1I9B A;  4TWH A;  4B5D A;  4F8H A;  3U8J A;  2YME A;  2MAW A;  5SYO A;  2KSR A;  3PMZ A;  4QH1 A;  4LMJ A;  4UM3 S;  4ZK1 A;  2BYS A;  1UX2 A;  4NPP A;  4QAA A;  3SH1 A;  4BFQ A;  2LKH A;  4ZZC A;  2QC1 B;  3P4W A;  2Y56 A;  5J0Z A;  5KZU A;  4TWD A;  4HFH A;  4QH5 A;  1OED C;  3U8L A;  5J5G A;  2M6I A;  2BG9 E;  4ILC A;  2YN6 A;  4HFI A;  4LMK A;  1UW6 A;  4PIR A;  5CFB A;  4ZJS A;  5AFM A;  5AFK A;  4HFE A;  5L47 A;  5IUX A;  3WIP A;  2XNV A;  4DBM A;  4XK9 A;  5HEO A;  5HEJ A;  3UQ7 A;  4ALX A;  3EI0 A;  5AFH A;  2BG9 B;  5AFJ A;  2BG9 A;  2YMD A;  2BYQ A;  3ZKR A;  4QH4 A;  4TWF A;  2PH9 A;  3SQ9 A;  5AFL A;  3WTN A;  4TNV A;  5J5I A;  2YKS A;  2XZ5 A;  3TLU A;  2XQ5 A;  3RIF A;  2Y57 A;  3U8M A;  4XHE A;  4ZK4 A;  1OED B;  4ILB A;  2WNJ A;  3UU3 A;  4FRR A;  3SIO A;  3GUA A;  2WNL A;  5FJV A;  3SQ6 A;  3UU8 A;  5TVC A;  5HEU A;  4AFG A;  3TLW A;  5J5H A;  4ZRU A;  4UXU A;  5HEH A;  3UQ4 A;  4ZR6 A;  4HFD A;  2VL0 A;  3UU5 A;  3EAM A;  3ZDH A;  3TLS A;  5KE4 A;  2XQ7 A;  4UY2 A;  2PGZ A;  4COF A;  3IGQ A;  1OED E;  4AFH A;  2XQ9 A;  3JAE A;  2C9T A;  4HFC A;  3RQW A;  2XYT A;  2XQ4 A;  4ZZB A;  3UUB A;  2X00 D;  3RI5 A;  2LKG A;  3LSV A;  2Y7Y A;  3U8N A;  2LM2 A;  5L4H A;  5L4E A;  3C79 A;  3WTO A;  3RQU A;  1OED A;  2BYP A;  4A98 A;  3U8K A;  4WV9 A;  4ZJT A;  4D01 A;  4IRE A;  3WTH A;  4X5T A;  2Y54 A;  4UM1 A;  3UU4 A;  2XNT A;  3WTL A;  5JME A;  2W8F A;  2ZJU A;  2XNU A;  3TLV A;  5LG3 A;  2BR8 A;  5AIN A;  4AFT A;  1UV6 A;  2XQA A;  3WTI A;  3UU6 A;  2BYN A;  2XQ3 A;  2BR7 A;  2BYR A;  3PEO A;  3WTM A;  5CO5 A;  4HQP A;  5HCM A;  4ILA A;  2LLY A;  4TNW A;  4LML A;  5BP0 A;  4IL9 A;  2BG9 C;  2XYS A;  5HEG A;  2YOE A;  2WN9 A;  2X00 A;  5BW2 A;  5LXB A;  2ZJV A;  5AFN A;  2M6B A;  4UM3 P;  3EHZ A;  3JAF A;  4QAC A;  5HCJ A;  4QAB A;  4UM3 A;  4A97 A;  3WTJ A;  4Z90 A;  3TLT A;  5AFM B;  3C84 A;  2XQ6 A;  2WNC A;  4EZ1 A;  2UZ6 A;  3WTK A;  5J5F A;  4IL4 A;  5BRX A;  4Z91 A;  2W8G A;  3RIA A;  3RHW A;  2BJ0 A;  4NZB A;  4BQT A;  3JAD A;  2XQ8 A;  2WZY A;  2XZ6 A;  2Y58 A;  3ZDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...