5KZUA

Crystal structure of an acetylcholine binding protein from aplysia californica (ac-achbp) in complex with click chemistry compound 9-[[1-[8-methyl-8-(2-phenylethyl)-8-azoniabicyclo[3.2.1]octan-3-yl]triazol-4-yl]methyl]carbazole
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
208
structure length
207
Chain Sequence
KLHSQANLMRLKSDLFNRPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein
molecule keywords Soluble acetylcholine receptor
publication title Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) in complex with click chemistry compound 9-[[1-[8-methyl-8-(2-phenylethyl)-8-azoniabicyclo[3.2.1]octan-3-yl]triazol-4-yl]methyl]carbazole
rcsb
source organism Aplysia californica
total genus 49
structure length 207
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5kzuA00
4HFBA 4AFTA 4BFQA 3WTHA 4UM3S 4ZJSA 3TLWA 5J5IA 4QABA 2BYPA 2WN9A 4AFHA 5AFMB 1I9BA 3UQ7A 3P50A 3PMZA 3TLVA 4XK9A 2XQ7A 3U8KA 3C79A 2XNTA 2C9TA 4IL9A 3SH1A 4ZK4A 5AFLA 5BW2A 4ZZCA 2VL0A 2YMEA 2YMDA 3WTOA 5HEOA 3U8LA 3ZDHA 5HCMA 4ZJTA 2X00D 4HFIA 2Y57A 2BG9A 4ZR6A 2YKSA 3JADA 4D01A 4EZ1A 5BP0A 5IUXA 4PIRA 3EAMA 4Z91A 2XQ3A 4IREA 2YOEA 4HFHA 4UM1A 3RIAA 5AINA 3ZKRA 2Y58A 3RQUA 4QAAA 3SQ6A 2XZ5A 3GUAA 3TLSA 4AFGA 2WZYA 4COFA 5AFJA 4UXUA 5AFHA 4HFDA 2BYNA 5KZUA 1UW6A 4BQTA 5L47A 4ZZBA 5HEGA 2ZJUA 2BJ0A 3C84A 3TLTA 5AFKA 4LMLA 4A97A 5HEJA 3SIOA 4UM3A 1UV6A 5TVCA 2XQ9A 5CO5A 4HFEA 3SQ9A 3ZDGA 4FRRA 2XZ6A 4F8HA 5J5FA 2PH9A 4ZK1A 2XQ8A 4TWHA 4ZRUA 4ILCA 5HEHA 2XQ6A 2BR8A 4TWDA 5AFMA 5LG3A 2BYQA 2Y56A 2BG9E 2Y54A 3U8JA 3WTNA 3UU4A 2BYSA 3UU6A 5AFNA 2XQ4A 4ILBA 3UQ4A 3RHWA 3WTKA 3LSVA 4QACA 3U8MA 2BYRA 3EHZA 4NZBA 3UU5A 4ILAA 4HQPA 4LMJA 3WTMA 2XQAA 2BR7A 3TLUA 2UZ6A 3U8NA 2XYSA 3JAEA 3PEOA 4UY2A 4Z90A 3WTIA 3EI0A 3UUBA 4A98A 2WNJA 5L4EA 5J0ZA 4X5TA 4XHEA 5SYOA 3WTJA 2PGZA 4QH5A 5J5GA 3RIFA 3WTLA 5KE4A 1UX2A 2XNUA 5CFBA 4ALXA 2XNVA 4NPPA 2WNLA 2XQ5A 3UU3A 3IGQA 5LXBA 2ZJVA 2WNCA 4DBMA 2W8GA 2BG9C 3WIPA 3P4WA 2QC1B 2W8FA 5FJVA 5BRXA 5JMEA 2Y7YA 4IL4A 5HCJA 4QH1A 5HEUA 3RQWA 4TNVA 4UM3P 4LMKA 2YN6A 4TWFA 3JAFA 2XYTA 4B5DA 4TNWA 3UU8A 4WV9A 2BG9B 5L4HA 2X00A 5J5HA 3RI5A 3T4MA 4HFCA 4QH4A
chains in the Genus database with same CATH superfamily
4HFBA 4AFTA 4BFQA 3WTHA 4UM3S 4ZJSA 3TLWA 5J5IA 4QABA 2BYPA 2WN9A 4AFHA 5AFMB 1I9BA 3UQ7A 3P50A 3PMZA 3TLVA 4XK9A 2XQ7A 3U8KA 3C79A 2XNTA 2C9TA 4IL9A 3SH1A 4ZK4A 5AFLA 5BW2A 4ZZCA 2VL0A 2YMEA 2YMDA 3WTOA 5HEOA 3U8LA 3ZDHA 5HCMA 4ZJTA 2X00D 4HFIA 2Y57A 2BG9A 4ZR6A 2YKSA 3JADA 4D01A 4EZ1A 5BP0A 5IUXA 4PIRA 3EAMA 4Z91A 2XQ3A 4IREA 2YOEA 4HFHA 4UM1A 3RIAA 5AINA 3ZKRA 2Y58A 3RQUA 4QAAA 3SQ6A 2XZ5A 3GUAA 3TLSA 4AFGA 2WZYA 4COFA 5AFJA 4UXUA 5AFHA 4HFDA 2BYNA 5KZUA 1UW6A 4BQTA 5L47A 4ZZBA 5HEGA 2ZJUA 2BJ0A 3C84A 3TLTA 5AFKA 4LMLA 4A97A 5HEJA 3SIOA 4UM3A 1UV6A 5TVCA 2XQ9A 5CO5A 4HFEA 3SQ9A 3ZDGA 4FRRA 2XZ6A 4F8HA 5J5FA 2PH9A 4ZK1A 2XQ8A 4TWHA 4ZRUA 4ILCA 5HEHA 2XQ6A 2BR8A 4TWDA 5AFMA 5LG3A 2BYQA 2Y56A 2BG9E 2Y54A 3U8JA 3WTNA 3UU4A 2BYSA 3UU6A 5AFNA 2XQ4A 4ILBA 3UQ4A 3RHWA 3WTKA 3LSVA 4QACA 3U8MA 2BYRA 3EHZA 4NZBA 3UU5A 4ILAA 4HQPA 4LMJA 3WTMA 2XQAA 2BR7A 3TLUA 2UZ6A 3U8NA 2XYSA 3JAEA 3PEOA 4UY2A 4Z90A 3WTIA 3EI0A 3UUBA 4A98A 2WNJA 5L4EA 5J0ZA 4X5TA 4XHEA 5SYOA 3WTJA 2PGZA 4QH5A 5J5GA 3RIFA 3WTLA 5KE4A 1UX2A 2XNUA 5CFBA 4ALXA 2XNVA 4NPPA 2WNLA 2XQ5A 3UU3A 3IGQA 5LXBA 2ZJVA 2WNCA 4DBMA 2W8GA 2BG9C 3WIPA 3P4WA 2QC1B 2W8FA 5FJVA 5BRXA 5JMEA 2Y7YA 4IL4A 5HCJA 4QH1A 5HEUA 3RQWA 4TNVA 4UM3P 4LMKA 2YN6A 4TWFA 3JAFA 2XYTA 4B5DA 4TNWA 3UU8A 4WV9A 2BG9B 5L4HA 2X00A 5J5HA 3RI5A 3T4MA 4HFCA 4QH4A
chains in the Genus database with same CATH topology
4HFBA 4AFTA 4BFQA 3WTHA 4UM3S 4ZJSA 3TLWA 5J5IA 4QABA 2BYPA 2WN9A 4AFHA 5AFMB 1I9BA 3UQ7A 3P50A 3PMZA 3TLVA 4XK9A 2XQ7A 3U8KA 3C79A 2XNTA 2C9TA 4IL9A 3SH1A 4ZK4A 5AFLA 5BW2A 4ZZCA 2VL0A 2YMEA 2YMDA 3WTOA 5HEOA 3U8LA 3ZDHA 5HCMA 4ZJTA 2X00D 4HFIA 2Y57A 2BG9A 4ZR6A 2YKSA 3JADA 4D01A 4EZ1A 5BP0A 5IUXA 4PIRA 3EAMA 4Z91A 2XQ3A 4IREA 2YOEA 4HFHA 4UM1A 3RIAA 5AINA 3ZKRA 2Y58A 3RQUA 4QAAA 3SQ6A 2XZ5A 3GUAA 3TLSA 4AFGA 2WZYA 4COFA 5AFJA 4UXUA 5AFHA 4HFDA 2BYNA 5KZUA 1UW6A 4BQTA 5L47A 4ZZBA 5HEGA 2ZJUA 2BJ0A 3C84A 3TLTA 5AFKA 4LMLA 4A97A 5HEJA 3SIOA 4UM3A 1UV6A 5TVCA 2XQ9A 5CO5A 4HFEA 3SQ9A 3ZDGA 4FRRA 2XZ6A 4F8HA 5J5FA 2PH9A 4ZK1A 2XQ8A 4TWHA 4ZRUA 4ILCA 5HEHA 2XQ6A 2BR8A 4TWDA 5AFMA 5LG3A 2BYQA 2Y56A 2BG9E 2Y54A 3U8JA 3WTNA 3UU4A 2BYSA 3UU6A 5AFNA 2XQ4A 4ILBA 3UQ4A 3RHWA 3WTKA 3LSVA 4QACA 3U8MA 2BYRA 3EHZA 4NZBA 3UU5A 4ILAA 4HQPA 4LMJA 3WTMA 2XQAA 2BR7A 3TLUA 2UZ6A 3U8NA 2XYSA 3JAEA 3PEOA 4UY2A 4Z90A 3WTIA 3EI0A 3UUBA 4A98A 2WNJA 5L4EA 5J0ZA 4X5TA 4XHEA 5SYOA 3WTJA 2PGZA 4QH5A 5J5GA 3RIFA 3WTLA 5KE4A 1UX2A 2XNUA 5CFBA 4ALXA 2XNVA 4NPPA 2WNLA 2XQ5A 3UU3A 3IGQA 5LXBA 2ZJVA 2WNCA 4DBMA 2W8GA 2BG9C 3WIPA 3P4WA 2QC1B 2W8FA 5FJVA 5BRXA 5JMEA 2Y7YA 4IL4A 5HCJA 4QH1A 5HEUA 3RQWA 4TNVA 4UM3P 4LMKA 2YN6A 4TWFA 3JAFA 2XYTA 4B5DA 4TNWA 3UU8A 4WV9A 2BG9B 5L4HA 2X00A 5J5HA 3RI5A 3T4MA 4HFCA 4QH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFB A;  4AFT A;  4BFQ A;  3WTH A;  4UM3 S;  4ZJS A;  3TLW A;  5J5I A;  4QAB A;  2BYP A;  2WN9 A;  4AFH A;  5AFM B;  1I9B A;  3UQ7 A;  3P50 A;  3PMZ A;  3TLV A;  4XK9 A;  2XQ7 A;  3U8K A;  3C79 A;  2XNT A;  2C9T A;  4IL9 A;  3SH1 A;  4ZK4 A;  5AFL A;  5BW2 A;  4ZZC A;  2VL0 A;  2YME A;  2YMD A;  3WTO A;  5HEO A;  3U8L A;  3ZDH A;  5HCM A;  4ZJT A;  2X00 D;  4HFI A;  2Y57 A;  2BG9 A;  4ZR6 A;  2YKS A;  3JAD A;  4D01 A;  4EZ1 A;  5BP0 A;  5IUX A;  4PIR A;  3EAM A;  4Z91 A;  2XQ3 A;  4IRE A;  2YOE A;  4HFH A;  4UM1 A;  3RIA A;  5AIN A;  3ZKR A;  2Y58 A;  3RQU A;  4QAA A;  3SQ6 A;  2XZ5 A;  3GUA A;  3TLS A;  4AFG A;  2WZY A;  4COF A;  5AFJ A;  4UXU A;  5AFH A;  4HFD A;  2BYN A;  5KZU A;  1UW6 A;  4BQT A;  5L47 A;  4ZZB A;  5HEG A;  2ZJU A;  2BJ0 A;  3C84 A;  3TLT A;  5AFK A;  4LML A;  4A97 A;  5HEJ A;  3SIO A;  4UM3 A;  1UV6 A;  5TVC A;  2XQ9 A;  5CO5 A;  4HFE A;  3SQ9 A;  3ZDG A;  4FRR A;  2XZ6 A;  4F8H A;  5J5F A;  2PH9 A;  4ZK1 A;  2XQ8 A;  4TWH A;  4ZRU A;  4ILC A;  5HEH A;  2XQ6 A;  2BR8 A;  4TWD A;  5AFM A;  5LG3 A;  2BYQ A;  2Y56 A;  2BG9 E;  2Y54 A;  3U8J A;  3WTN A;  3UU4 A;  2BYS A;  3UU6 A;  5AFN A;  2XQ4 A;  4ILB A;  3UQ4 A;  3RHW A;  3WTK A;  3LSV A;  4QAC A;  3U8M A;  2BYR A;  3EHZ A;  4NZB A;  3UU5 A;  4ILA A;  4HQP A;  4LMJ A;  3WTM A;  2XQA A;  2BR7 A;  3TLU A;  2UZ6 A;  3U8N A;  2XYS A;  3JAE A;  3PEO A;  4UY2 A;  4Z90 A;  3WTI A;  3EI0 A;  3UUB A;  4A98 A;  2WNJ A;  5L4E A;  5J0Z A;  4X5T A;  4XHE A;  5SYO A;  3WTJ A;  2PGZ A;  4QH5 A;  5J5G A;  3RIF A;  3WTL A;  5KE4 A;  1UX2 A;  2XNU A;  5CFB A;  4ALX A;  2XNV A;  4NPP A;  2WNL A;  2XQ5 A;  3UU3 A;  3IGQ A;  5LXB A;  2ZJV A;  2WNC A;  4DBM A;  2W8G A;  2BG9 C;  3WIP A;  3P4W A;  2QC1 B;  2W8F A;  5FJV A;  5BRX A;  5JME A;  2Y7Y A;  4IL4 A;  5HCJ A;  4QH1 A;  5HEU A;  3RQW A;  4TNV A;  4UM3 P;  4LMK A;  2YN6 A;  4TWF A;  3JAF A;  2XYT A;  4B5D A;  4TNW A;  3UU8 A;  4WV9 A;  2BG9 B;  5L4H A;  2X00 A;  5J5H A;  3RI5 A;  3T4M A;  4HFC A;  4QH4 A; 
#chains in the Genus database with same CATH topology
 4HFB A;  4AFT A;  4BFQ A;  3WTH A;  4UM3 S;  4ZJS A;  3TLW A;  5J5I A;  4QAB A;  2BYP A;  2WN9 A;  4AFH A;  5AFM B;  1I9B A;  3UQ7 A;  3P50 A;  3PMZ A;  3TLV A;  4XK9 A;  2XQ7 A;  3U8K A;  3C79 A;  2XNT A;  2C9T A;  4IL9 A;  3SH1 A;  4ZK4 A;  5AFL A;  5BW2 A;  4ZZC A;  2VL0 A;  2YME A;  2YMD A;  3WTO A;  5HEO A;  3U8L A;  3ZDH A;  5HCM A;  4ZJT A;  2X00 D;  4HFI A;  2Y57 A;  2BG9 A;  4ZR6 A;  2YKS A;  3JAD A;  4D01 A;  4EZ1 A;  5BP0 A;  5IUX A;  4PIR A;  3EAM A;  4Z91 A;  2XQ3 A;  4IRE A;  2YOE A;  4HFH A;  4UM1 A;  3RIA A;  5AIN A;  3ZKR A;  2Y58 A;  3RQU A;  4QAA A;  3SQ6 A;  2XZ5 A;  3GUA A;  3TLS A;  4AFG A;  2WZY A;  4COF A;  5AFJ A;  4UXU A;  5AFH A;  4HFD A;  2BYN A;  5KZU A;  1UW6 A;  4BQT A;  5L47 A;  4ZZB A;  5HEG A;  2ZJU A;  2BJ0 A;  3C84 A;  3TLT A;  5AFK A;  4LML A;  4A97 A;  5HEJ A;  3SIO A;  4UM3 A;  1UV6 A;  5TVC A;  2XQ9 A;  5CO5 A;  4HFE A;  3SQ9 A;  3ZDG A;  4FRR A;  2XZ6 A;  4F8H A;  5J5F A;  2PH9 A;  4ZK1 A;  2XQ8 A;  4TWH A;  4ZRU A;  4ILC A;  5HEH A;  2XQ6 A;  2BR8 A;  4TWD A;  5AFM A;  5LG3 A;  2BYQ A;  2Y56 A;  2BG9 E;  2Y54 A;  3U8J A;  3WTN A;  3UU4 A;  2BYS A;  3UU6 A;  5AFN A;  2XQ4 A;  4ILB A;  3UQ4 A;  3RHW A;  3WTK A;  3LSV A;  4QAC A;  3U8M A;  2BYR A;  3EHZ A;  4NZB A;  3UU5 A;  4ILA A;  4HQP A;  4LMJ A;  3WTM A;  2XQA A;  2BR7 A;  3TLU A;  2UZ6 A;  3U8N A;  2XYS A;  3JAE A;  3PEO A;  4UY2 A;  4Z90 A;  3WTI A;  3EI0 A;  3UUB A;  4A98 A;  2WNJ A;  5L4E A;  5J0Z A;  4X5T A;  4XHE A;  5SYO A;  3WTJ A;  2PGZ A;  4QH5 A;  5J5G A;  3RIF A;  3WTL A;  5KE4 A;  1UX2 A;  2XNU A;  5CFB A;  4ALX A;  2XNV A;  4NPP A;  2WNL A;  2XQ5 A;  3UU3 A;  3IGQ A;  5LXB A;  2ZJV A;  2WNC A;  4DBM A;  2W8G A;  2BG9 C;  3WIP A;  3P4W A;  2QC1 B;  2W8F A;  5FJV A;  5BRX A;  5JME A;  2Y7Y A;  4IL4 A;  5HCJ A;  4QH1 A;  5HEU A;  3RQW A;  4TNV A;  4UM3 P;  4LMK A;  2YN6 A;  4TWF A;  3JAF A;  2XYT A;  4B5D A;  4TNW A;  3UU8 A;  4WV9 A;  2BG9 B;  5L4H A;  2X00 A;  5J5H A;  3RI5 A;  3T4M A;  4HFC A;  4QH4 A; 
#chains in the Genus database with same CATH homology
 4HFB A;  4AFT A;  4BFQ A;  3WTH A;  4UM3 S;  4ZJS A;  3TLW A;  5J5I A;  4QAB A;  2BYP A;  2WN9 A;  4AFH A;  5AFM B;  1I9B A;  3UQ7 A;  3P50 A;  3PMZ A;  3TLV A;  4XK9 A;  2XQ7 A;  3U8K A;  3C79 A;  2XNT A;  2C9T A;  4IL9 A;  3SH1 A;  4ZK4 A;  5AFL A;  5BW2 A;  4ZZC A;  2VL0 A;  2YME A;  2YMD A;  3WTO A;  5HEO A;  3U8L A;  3ZDH A;  5HCM A;  4ZJT A;  2X00 D;  4HFI A;  2Y57 A;  2BG9 A;  4ZR6 A;  2YKS A;  3JAD A;  4D01 A;  4EZ1 A;  5BP0 A;  5IUX A;  4PIR A;  3EAM A;  4Z91 A;  2XQ3 A;  4IRE A;  2YOE A;  4HFH A;  4UM1 A;  3RIA A;  5AIN A;  3ZKR A;  2Y58 A;  3RQU A;  4QAA A;  3SQ6 A;  2XZ5 A;  3GUA A;  3TLS A;  4AFG A;  2WZY A;  4COF A;  5AFJ A;  4UXU A;  5AFH A;  4HFD A;  2BYN A;  5KZU A;  1UW6 A;  4BQT A;  5L47 A;  4ZZB A;  5HEG A;  2ZJU A;  2BJ0 A;  3C84 A;  3TLT A;  5AFK A;  4LML A;  4A97 A;  5HEJ A;  3SIO A;  4UM3 A;  1UV6 A;  5TVC A;  2XQ9 A;  5CO5 A;  4HFE A;  3SQ9 A;  3ZDG A;  4FRR A;  2XZ6 A;  4F8H A;  5J5F A;  2PH9 A;  4ZK1 A;  2XQ8 A;  4TWH A;  4ZRU A;  4ILC A;  5HEH A;  2XQ6 A;  2BR8 A;  4TWD A;  5AFM A;  5LG3 A;  2BYQ A;  2Y56 A;  2BG9 E;  2Y54 A;  3U8J A;  3WTN A;  3UU4 A;  2BYS A;  3UU6 A;  5AFN A;  2XQ4 A;  4ILB A;  3UQ4 A;  3RHW A;  3WTK A;  3LSV A;  4QAC A;  3U8M A;  2BYR A;  3EHZ A;  4NZB A;  3UU5 A;  4ILA A;  4HQP A;  4LMJ A;  3WTM A;  2XQA A;  2BR7 A;  3TLU A;  2UZ6 A;  3U8N A;  2XYS A;  3JAE A;  3PEO A;  4UY2 A;  4Z90 A;  3WTI A;  3EI0 A;  3UUB A;  4A98 A;  2WNJ A;  5L4E A;  5J0Z A;  4X5T A;  4XHE A;  5SYO A;  3WTJ A;  2PGZ A;  4QH5 A;  5J5G A;  3RIF A;  3WTL A;  5KE4 A;  1UX2 A;  2XNU A;  5CFB A;  4ALX A;  2XNV A;  4NPP A;  2WNL A;  2XQ5 A;  3UU3 A;  3IGQ A;  5LXB A;  2ZJV A;  2WNC A;  4DBM A;  2W8G A;  2BG9 C;  3WIP A;  3P4W A;  2QC1 B;  2W8F A;  5FJV A;  5BRX A;  5JME A;  2Y7Y A;  4IL4 A;  5HCJ A;  4QH1 A;  5HEU A;  3RQW A;  4TNV A;  4UM3 P;  4LMK A;  2YN6 A;  4TWF A;  3JAF A;  2XYT A;  4B5D A;  4TNW A;  3UU8 A;  4WV9 A;  2BG9 B;  5L4H A;  2X00 A;  5J5H A;  3RI5 A;  3T4M A;  4HFC A;  4QH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...