5KZUA

Crystal structure of an acetylcholine binding protein from aplysia californica (ac-achbp) in complex with click chemistry compound 9-[[1-[8-methyl-8-(2-phenylethyl)-8-azoniabicyclo[3.2.1]octan-3-yl]triazol-4-yl]methyl]carbazole
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
208
structure length
207
Chain Sequence
KLHSQANLMRLKSDLFNRPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) in complex with click chemistry compound 9-[[1-[8-methyl-8-(2-phenylethyl)-8-azoniabicyclo[3.2.1]octan-3-yl]triazol-4-yl]methyl]carbazole
rcsb
source organism Aplysia californica
molecule tags Acetylcholine-binding protein
total genus 49
structure length 207
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5kzuA00
3LSVA 4AFHA 3PEOA 5AFMA 5AFNA 4XHEA 3UU5A 2BYPA 4NZBA 4UY2A 4LMJA 3UUBA 3T4MA 4D01A 3WTJA 4A98A 2PH9A 3RHWA 2XNVA 4UM3A 3SQ9A 3UU6A 5J5GA 2XQ9A 4Z91A 2XQ7A 5SYOA 5J5IA 2BG9C 2XZ5A 4LMKA 4IL9A 4COFA 3TLVA 4QABA 2XQ6A 2C9TA 2ZJVA 4ILBA 3EHZA 2XNUA 5AINA 2Y58A 5HCJA 4A97A 2YKSA 4FRRA 5J5HA 3ZDHA 2BG9A 1UV6A 3WTLA 4ZZBA 2XNTA 4Z90A 5KE4A 5J5FA 2UZ6A 2BR7A 2W8FA 4ZRUA 4TWFA 2WNLA 2WNCA 4UM1A 5FJVA 2QC1B 5HEUA 1I9BA 3P4WA 3ZDGA 4ZK4A 2WNJA 5BP0A 2BR8A 3U8LA 5KZUA 3GUAA 4BQTA 2BG9B 1UX2A 2BYQA 3C79A 4HFCA 4QH1A 2Y7YA 3WTHA 4BFQA 4TWDA 3WTOA 3TLUA 4UM3P 2X00A 3TLTA 5HEOA 4IL4A 4DBMA 4XK9A 5HCMA 4HQPA 3RIAA 2WN9A 3JAFA 4IREA 2XZ6A 4TNVA 5LG3A 3EAMA 4HFIA 3UQ4A 3WTIA 4ILAA 4TWHA 2BYNA 3JADA 4EZ1A 2VL0A 2XQ3A 4ZK1A 3WIPA 3UQ7A 4ALXA 4QH5A 5J0ZA 3RI5A 4ZZCA 3PMZA 2PGZA 4ZJSA 4TNWA 3TLSA 2WZYA 4F8HA 4UM3S 4X5TA 5CO5A 2XQAA 2BG9E 4QAAA 1UW6A 2Y54A 4ZJTA 5AFLA 4HFHA 3JAEA 3WTKA 3ZKRA 3RQWA 5L4EA 2XQ4A 2YN6A 4HFEA 4QACA 2X00D 2BYRA 3SIOA 5IUXA 5L4HA 5L47A 4AFTA 3RQUA 4HFBA 4NPPA 3EI0A 2XYTA 5CFBA 5AFHA 4LMLA 4PIRA 3SH1A 3TLWA 3U8JA 5HEHA 3C84A 5HEJA 4QH4A 4WV9A 4ZR6A 4HFDA 3U8NA 2XQ8A 2BJ0A 3U8MA 3UU4A 2W8GA 5JMEA 2YMDA 3U8KA 2Y56A 2YOEA 4AFGA 2XQ5A 5BW2A 2YMEA 5AFMB 4UXUA 2BYSA 2ZJUA 3UU3A 2Y57A 3SQ6A 3RIFA 5LXBA 2XYSA 5AFKA 5HEGA 3WTNA 3UU8A 4ILCA 3WTMA 3IGQA 5AFJA 3P50A 4B5DA 5BRXA 5TVCA
chains in the Genus database with same CATH superfamily
3LSVA 4AFHA 3PEOA 5AFMA 5AFNA 4XHEA 3UU5A 2BYPA 4NZBA 4UY2A 4LMJA 3UUBA 3T4MA 4D01A 3WTJA 4A98A 2PH9A 3RHWA 2XNVA 4UM3A 3SQ9A 3UU6A 5J5GA 2XQ9A 4Z91A 2XQ7A 5SYOA 5J5IA 2BG9C 2XZ5A 4LMKA 4IL9A 4COFA 3TLVA 4QABA 2XQ6A 2C9TA 2ZJVA 4ILBA 3EHZA 2XNUA 5AINA 2Y58A 5HCJA 4A97A 2YKSA 4FRRA 5J5HA 3ZDHA 2BG9A 1UV6A 3WTLA 4ZZBA 2XNTA 4Z90A 5KE4A 5J5FA 2UZ6A 2BR7A 2W8FA 4ZRUA 4TWFA 2WNLA 2WNCA 4UM1A 5FJVA 2QC1B 5HEUA 1I9BA 3P4WA 3ZDGA 4ZK4A 2WNJA 5BP0A 2BR8A 3U8LA 5KZUA 3GUAA 4BQTA 2BG9B 1UX2A 2BYQA 3C79A 4HFCA 4QH1A 2Y7YA 3WTHA 4BFQA 4TWDA 3WTOA 3TLUA 4UM3P 2X00A 3TLTA 5HEOA 4IL4A 4DBMA 4XK9A 5HCMA 4HQPA 3RIAA 2WN9A 3JAFA 4IREA 2XZ6A 4TNVA 5LG3A 3EAMA 4HFIA 3UQ4A 3WTIA 4ILAA 4TWHA 2BYNA 3JADA 4EZ1A 2VL0A 2XQ3A 4ZK1A 3WIPA 3UQ7A 4ALXA 4QH5A 5J0ZA 3RI5A 4ZZCA 3PMZA 2PGZA 4ZJSA 4TNWA 3TLSA 2WZYA 4F8HA 4UM3S 4X5TA 5CO5A 2XQAA 2BG9E 4QAAA 1UW6A 2Y54A 4ZJTA 5AFLA 4HFHA 3JAEA 3WTKA 3ZKRA 3RQWA 5L4EA 2XQ4A 2YN6A 4HFEA 4QACA 2X00D 2BYRA 3SIOA 5IUXA 5L4HA 5L47A 4AFTA 3RQUA 4HFBA 4NPPA 3EI0A 2XYTA 5CFBA 5AFHA 4LMLA 4PIRA 3SH1A 3TLWA 3U8JA 5HEHA 3C84A 5HEJA 4QH4A 4WV9A 4ZR6A 4HFDA 3U8NA 2XQ8A 2BJ0A 3U8MA 3UU4A 2W8GA 5JMEA 2YMDA 3U8KA 2Y56A 2YOEA 4AFGA 2XQ5A 5BW2A 2YMEA 5AFMB 4UXUA 2BYSA 2ZJUA 3UU3A 2Y57A 3SQ6A 3RIFA 5LXBA 2XYSA 5AFKA 5HEGA 3WTNA 3UU8A 4ILCA 3WTMA 3IGQA 5AFJA 3P50A 4B5DA 5BRXA 5TVCA
chains in the Genus database with same CATH topology
3LSVA 4AFHA 3PEOA 5AFMA 5AFNA 4XHEA 3UU5A 2BYPA 4NZBA 4UY2A 4LMJA 3UUBA 3T4MA 4D01A 3WTJA 4A98A 2PH9A 3RHWA 2XNVA 4UM3A 3SQ9A 3UU6A 5J5GA 2XQ9A 4Z91A 2XQ7A 5SYOA 5J5IA 2BG9C 2XZ5A 4LMKA 4IL9A 4COFA 3TLVA 4QABA 2XQ6A 2C9TA 2ZJVA 4ILBA 3EHZA 2XNUA 5AINA 2Y58A 5HCJA 4A97A 2YKSA 4FRRA 5J5HA 3ZDHA 2BG9A 1UV6A 3WTLA 4ZZBA 2XNTA 4Z90A 5KE4A 5J5FA 2UZ6A 2BR7A 2W8FA 4ZRUA 4TWFA 2WNLA 2WNCA 4UM1A 5FJVA 2QC1B 5HEUA 1I9BA 3P4WA 3ZDGA 4ZK4A 2WNJA 5BP0A 2BR8A 3U8LA 5KZUA 3GUAA 4BQTA 2BG9B 1UX2A 2BYQA 3C79A 4HFCA 4QH1A 2Y7YA 3WTHA 4BFQA 4TWDA 3WTOA 3TLUA 4UM3P 2X00A 3TLTA 5HEOA 4IL4A 4DBMA 4XK9A 5HCMA 4HQPA 3RIAA 2WN9A 3JAFA 4IREA 2XZ6A 4TNVA 5LG3A 3EAMA 4HFIA 3UQ4A 3WTIA 4ILAA 4TWHA 2BYNA 3JADA 4EZ1A 2VL0A 2XQ3A 4ZK1A 3WIPA 3UQ7A 4ALXA 4QH5A 5J0ZA 3RI5A 4ZZCA 3PMZA 2PGZA 4ZJSA 4TNWA 3TLSA 2WZYA 4F8HA 4UM3S 4X5TA 5CO5A 2XQAA 2BG9E 4QAAA 1UW6A 2Y54A 4ZJTA 5AFLA 4HFHA 3JAEA 3WTKA 3ZKRA 3RQWA 5L4EA 2XQ4A 2YN6A 4HFEA 4QACA 2X00D 2BYRA 3SIOA 5IUXA 5L4HA 5L47A 4AFTA 3RQUA 4HFBA 4NPPA 3EI0A 2XYTA 5CFBA 5AFHA 4LMLA 4PIRA 3SH1A 3TLWA 3U8JA 5HEHA 3C84A 5HEJA 4QH4A 4WV9A 4ZR6A 4HFDA 3U8NA 2XQ8A 2BJ0A 3U8MA 3UU4A 2W8GA 5JMEA 2YMDA 3U8KA 2Y56A 2YOEA 4AFGA 2XQ5A 5BW2A 2YMEA 5AFMB 4UXUA 2BYSA 2ZJUA 3UU3A 2Y57A 3SQ6A 3RIFA 5LXBA 2XYSA 5AFKA 5HEGA 3WTNA 3UU8A 4ILCA 3WTMA 3IGQA 5AFJA 3P50A 4B5DA 5BRXA 5TVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LSV A;  4AFH A;  3PEO A;  5AFM A;  5AFN A;  4XHE A;  3UU5 A;  2BYP A;  4NZB A;  4UY2 A;  4LMJ A;  3UUB A;  3T4M A;  4D01 A;  3WTJ A;  4A98 A;  2PH9 A;  3RHW A;  2XNV A;  4UM3 A;  3SQ9 A;  3UU6 A;  5J5G A;  2XQ9 A;  4Z91 A;  2XQ7 A;  5SYO A;  5J5I A;  2BG9 C;  2XZ5 A;  4LMK A;  4IL9 A;  4COF A;  3TLV A;  4QAB A;  2XQ6 A;  2C9T A;  2ZJV A;  4ILB A;  3EHZ A;  2XNU A;  5AIN A;  2Y58 A;  5HCJ A;  4A97 A;  2YKS A;  4FRR A;  5J5H A;  3ZDH A;  2BG9 A;  1UV6 A;  3WTL A;  4ZZB A;  2XNT A;  4Z90 A;  5KE4 A;  5J5F A;  2UZ6 A;  2BR7 A;  2W8F A;  4ZRU A;  4TWF A;  2WNL A;  2WNC A;  4UM1 A;  5FJV A;  2QC1 B;  5HEU A;  1I9B A;  3P4W A;  3ZDG A;  4ZK4 A;  2WNJ A;  5BP0 A;  2BR8 A;  3U8L A;  5KZU A;  3GUA A;  4BQT A;  2BG9 B;  1UX2 A;  2BYQ A;  3C79 A;  4HFC A;  4QH1 A;  2Y7Y A;  3WTH A;  4BFQ A;  4TWD A;  3WTO A;  3TLU A;  4UM3 P;  2X00 A;  3TLT A;  5HEO A;  4IL4 A;  4DBM A;  4XK9 A;  5HCM A;  4HQP A;  3RIA A;  2WN9 A;  3JAF A;  4IRE A;  2XZ6 A;  4TNV A;  5LG3 A;  3EAM A;  4HFI A;  3UQ4 A;  3WTI A;  4ILA A;  4TWH A;  2BYN A;  3JAD A;  4EZ1 A;  2VL0 A;  2XQ3 A;  4ZK1 A;  3WIP A;  3UQ7 A;  4ALX A;  4QH5 A;  5J0Z A;  3RI5 A;  4ZZC A;  3PMZ A;  2PGZ A;  4ZJS A;  4TNW A;  3TLS A;  2WZY A;  4F8H A;  4UM3 S;  4X5T A;  5CO5 A;  2XQA A;  2BG9 E;  4QAA A;  1UW6 A;  2Y54 A;  4ZJT A;  5AFL A;  4HFH A;  3JAE A;  3WTK A;  3ZKR A;  3RQW A;  5L4E A;  2XQ4 A;  2YN6 A;  4HFE A;  4QAC A;  2X00 D;  2BYR A;  3SIO A;  5IUX A;  5L4H A;  5L47 A;  4AFT A;  3RQU A;  4HFB A;  4NPP A;  3EI0 A;  2XYT A;  5CFB A;  5AFH A;  4LML A;  4PIR A;  3SH1 A;  3TLW A;  3U8J A;  5HEH A;  3C84 A;  5HEJ A;  4QH4 A;  4WV9 A;  4ZR6 A;  4HFD A;  3U8N A;  2XQ8 A;  2BJ0 A;  3U8M A;  3UU4 A;  2W8G A;  5JME A;  2YMD A;  3U8K A;  2Y56 A;  2YOE A;  4AFG A;  2XQ5 A;  5BW2 A;  2YME A;  5AFM B;  4UXU A;  2BYS A;  2ZJU A;  3UU3 A;  2Y57 A;  3SQ6 A;  3RIF A;  5LXB A;  2XYS A;  5AFK A;  5HEG A;  3WTN A;  3UU8 A;  4ILC A;  3WTM A;  3IGQ A;  5AFJ A;  3P50 A;  4B5D A;  5BRX A;  5TVC A; 
#chains in the Genus database with same CATH topology
 3LSV A;  4AFH A;  3PEO A;  5AFM A;  5AFN A;  4XHE A;  3UU5 A;  2BYP A;  4NZB A;  4UY2 A;  4LMJ A;  3UUB A;  3T4M A;  4D01 A;  3WTJ A;  4A98 A;  2PH9 A;  3RHW A;  2XNV A;  4UM3 A;  3SQ9 A;  3UU6 A;  5J5G A;  2XQ9 A;  4Z91 A;  2XQ7 A;  5SYO A;  5J5I A;  2BG9 C;  2XZ5 A;  4LMK A;  4IL9 A;  4COF A;  3TLV A;  4QAB A;  2XQ6 A;  2C9T A;  2ZJV A;  4ILB A;  3EHZ A;  2XNU A;  5AIN A;  2Y58 A;  5HCJ A;  4A97 A;  2YKS A;  4FRR A;  5J5H A;  3ZDH A;  2BG9 A;  1UV6 A;  3WTL A;  4ZZB A;  2XNT A;  4Z90 A;  5KE4 A;  5J5F A;  2UZ6 A;  2BR7 A;  2W8F A;  4ZRU A;  4TWF A;  2WNL A;  2WNC A;  4UM1 A;  5FJV A;  2QC1 B;  5HEU A;  1I9B A;  3P4W A;  3ZDG A;  4ZK4 A;  2WNJ A;  5BP0 A;  2BR8 A;  3U8L A;  5KZU A;  3GUA A;  4BQT A;  2BG9 B;  1UX2 A;  2BYQ A;  3C79 A;  4HFC A;  4QH1 A;  2Y7Y A;  3WTH A;  4BFQ A;  4TWD A;  3WTO A;  3TLU A;  4UM3 P;  2X00 A;  3TLT A;  5HEO A;  4IL4 A;  4DBM A;  4XK9 A;  5HCM A;  4HQP A;  3RIA A;  2WN9 A;  3JAF A;  4IRE A;  2XZ6 A;  4TNV A;  5LG3 A;  3EAM A;  4HFI A;  3UQ4 A;  3WTI A;  4ILA A;  4TWH A;  2BYN A;  3JAD A;  4EZ1 A;  2VL0 A;  2XQ3 A;  4ZK1 A;  3WIP A;  3UQ7 A;  4ALX A;  4QH5 A;  5J0Z A;  3RI5 A;  4ZZC A;  3PMZ A;  2PGZ A;  4ZJS A;  4TNW A;  3TLS A;  2WZY A;  4F8H A;  4UM3 S;  4X5T A;  5CO5 A;  2XQA A;  2BG9 E;  4QAA A;  1UW6 A;  2Y54 A;  4ZJT A;  5AFL A;  4HFH A;  3JAE A;  3WTK A;  3ZKR A;  3RQW A;  5L4E A;  2XQ4 A;  2YN6 A;  4HFE A;  4QAC A;  2X00 D;  2BYR A;  3SIO A;  5IUX A;  5L4H A;  5L47 A;  4AFT A;  3RQU A;  4HFB A;  4NPP A;  3EI0 A;  2XYT A;  5CFB A;  5AFH A;  4LML A;  4PIR A;  3SH1 A;  3TLW A;  3U8J A;  5HEH A;  3C84 A;  5HEJ A;  4QH4 A;  4WV9 A;  4ZR6 A;  4HFD A;  3U8N A;  2XQ8 A;  2BJ0 A;  3U8M A;  3UU4 A;  2W8G A;  5JME A;  2YMD A;  3U8K A;  2Y56 A;  2YOE A;  4AFG A;  2XQ5 A;  5BW2 A;  2YME A;  5AFM B;  4UXU A;  2BYS A;  2ZJU A;  3UU3 A;  2Y57 A;  3SQ6 A;  3RIF A;  5LXB A;  2XYS A;  5AFK A;  5HEG A;  3WTN A;  3UU8 A;  4ILC A;  3WTM A;  3IGQ A;  5AFJ A;  3P50 A;  4B5D A;  5BRX A;  5TVC A; 
#chains in the Genus database with same CATH homology
 3LSV A;  4AFH A;  3PEO A;  5AFM A;  5AFN A;  4XHE A;  3UU5 A;  2BYP A;  4NZB A;  4UY2 A;  4LMJ A;  3UUB A;  3T4M A;  4D01 A;  3WTJ A;  4A98 A;  2PH9 A;  3RHW A;  2XNV A;  4UM3 A;  3SQ9 A;  3UU6 A;  5J5G A;  2XQ9 A;  4Z91 A;  2XQ7 A;  5SYO A;  5J5I A;  2BG9 C;  2XZ5 A;  4LMK A;  4IL9 A;  4COF A;  3TLV A;  4QAB A;  2XQ6 A;  2C9T A;  2ZJV A;  4ILB A;  3EHZ A;  2XNU A;  5AIN A;  2Y58 A;  5HCJ A;  4A97 A;  2YKS A;  4FRR A;  5J5H A;  3ZDH A;  2BG9 A;  1UV6 A;  3WTL A;  4ZZB A;  2XNT A;  4Z90 A;  5KE4 A;  5J5F A;  2UZ6 A;  2BR7 A;  2W8F A;  4ZRU A;  4TWF A;  2WNL A;  2WNC A;  4UM1 A;  5FJV A;  2QC1 B;  5HEU A;  1I9B A;  3P4W A;  3ZDG A;  4ZK4 A;  2WNJ A;  5BP0 A;  2BR8 A;  3U8L A;  5KZU A;  3GUA A;  4BQT A;  2BG9 B;  1UX2 A;  2BYQ A;  3C79 A;  4HFC A;  4QH1 A;  2Y7Y A;  3WTH A;  4BFQ A;  4TWD A;  3WTO A;  3TLU A;  4UM3 P;  2X00 A;  3TLT A;  5HEO A;  4IL4 A;  4DBM A;  4XK9 A;  5HCM A;  4HQP A;  3RIA A;  2WN9 A;  3JAF A;  4IRE A;  2XZ6 A;  4TNV A;  5LG3 A;  3EAM A;  4HFI A;  3UQ4 A;  3WTI A;  4ILA A;  4TWH A;  2BYN A;  3JAD A;  4EZ1 A;  2VL0 A;  2XQ3 A;  4ZK1 A;  3WIP A;  3UQ7 A;  4ALX A;  4QH5 A;  5J0Z A;  3RI5 A;  4ZZC A;  3PMZ A;  2PGZ A;  4ZJS A;  4TNW A;  3TLS A;  2WZY A;  4F8H A;  4UM3 S;  4X5T A;  5CO5 A;  2XQA A;  2BG9 E;  4QAA A;  1UW6 A;  2Y54 A;  4ZJT A;  5AFL A;  4HFH A;  3JAE A;  3WTK A;  3ZKR A;  3RQW A;  5L4E A;  2XQ4 A;  2YN6 A;  4HFE A;  4QAC A;  2X00 D;  2BYR A;  3SIO A;  5IUX A;  5L4H A;  5L47 A;  4AFT A;  3RQU A;  4HFB A;  4NPP A;  3EI0 A;  2XYT A;  5CFB A;  5AFH A;  4LML A;  4PIR A;  3SH1 A;  3TLW A;  3U8J A;  5HEH A;  3C84 A;  5HEJ A;  4QH4 A;  4WV9 A;  4ZR6 A;  4HFD A;  3U8N A;  2XQ8 A;  2BJ0 A;  3U8M A;  3UU4 A;  2W8G A;  5JME A;  2YMD A;  3U8K A;  2Y56 A;  2YOE A;  4AFG A;  2XQ5 A;  5BW2 A;  2YME A;  5AFM B;  4UXU A;  2BYS A;  2ZJU A;  3UU3 A;  2Y57 A;  3SQ6 A;  3RIF A;  5LXB A;  2XYS A;  5AFK A;  5HEG A;  3WTN A;  3UU8 A;  4ILC A;  3WTM A;  3IGQ A;  5AFJ A;  3P50 A;  4B5D A;  5BRX A;  5TVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...