5J5HA

X-ray structure of acetylcholine binding protein (achbp) in complex with 6-(2-methoxyphenyl)-n4,n4-bis[(pyridin-2-yl)methyl]pyrimidine-2,4-diamine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
209
structure length
204
Chain Sequence
b'DDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Substituted 2-Aminopyrimidines Selective for alpha 7-Nicotinic Acetylcholine Receptor Activation and Association with Acetylcholine Binding Proteins.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein
total genus 51
structure length 204
sequence length 209
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j5hA00
3PMZA 5AFMB 4ZZCA 5AFKA 4TNWA 5AFNA 2Y54A 2QC1B 2BG9B 2WZYA 3EAMA 4COFA 2BR7A 2X00A 4ALXA 4XHEA 5J0ZA 3IGQA 4HFEA 5J5GA 4ZJSA 3UU6A 4ILCA 2YMDA 3UU5A 2Y57A 2WN9A 2XYSA 3ZKRA 2C9TA 5JMEA 5LXBA 4ILBA 4AFTA 3JADA 4IL4A 3UQ7A 5AFMA 3RIFA 5HEGA 3TLSA 4HFHA 3EHZA 2W8GA 2PGZA 4UY2A 3UQ4A 5J5IA 4UM3S 3P50A 2BG9A 5CO5A 4HFCA 3WTHA 4PIRA 4ILAA 3TLVA 4LMLA 2WNLA 4UXUA 4QABA 4UM1A 2XQ6A 3UUBA 5HEHA 4F8HA 2XQAA 5LG3A 2PH9A 2X00D 5L4EA 1UV6A 4NZBA 4QH5A 2XNTA 4NPPA 3SQ9A 3U8NA 5BW2A 5HCMA 3C79A 3RI5A 3RIAA 2XNUA 2BG9C 2ZJUA 3U8JA 3ZDGA 3C84A 4IREA 2VL0A 2BYPA 3WTKA 4D01A 2BYRA 3GUAA 4QH4A 3LSVA 5BP0A 1UX2A 4HFIA 5CFBA 3U8MA 3SIOA 2WNCA 5L4HA 3SQ6A 3P4WA 2XZ6A 5HCJA 5L47A 4HFDA 3ZDHA 4DBMA 5J5HA 1UW6A 4QH1A 5J5FA 2XQ3A 3SH1A 2WNJA 4B5DA 4LMJA 5IUXA 1I9BA 5SYOA 2XQ9A 5KZUA 3WTNA 4ZK1A 4X5TA 5AFJA 3WTMA 4AFGA 2XQ8A 3WIPA 4ZR6A 3PEOA 5AFHA 2XYTA 3TLUA 2BR8A 2BJ0A 4AFHA 4LMKA 2XNVA 4A97A 5HEUA 5AINA 4BQTA 3RQWA 3RHWA 5KE4A 2XZ5A 2BYSA 3TLWA 2YMEA 2YOEA 3RQUA 3T4MA 2Y56A 4WV9A 3TLTA 2YN6A 2XQ7A 3EI0A 4TNVA 4UM3A 3UU8A 5AFLA 4Z90A 4ZZBA 2Y58A 5BRXA 2BG9E 2Y7YA 4HFBA 5FJVA 3U8KA 4TWFA 2BYNA 3WTJA 3WTIA 4BFQA 2W8FA 3UU4A 4UM3P 4HQPA 4A98A 2ZJVA 2XQ5A 5TVCA 3JAFA 3JAEA 3WTLA 3WTOA 4QAAA 4TWHA 4IL9A 4QACA 3UU3A 4EZ1A 5HEJA 2UZ6A 4ZJTA 5HEOA 3U8LA 4XK9A 2BYQA 2XQ4A 4FRRA 4Z91A 4ZK4A 4TWDA 2YKSA 4ZRUA
chains in the Genus database with same CATH superfamily
3PMZA 5AFMB 4ZZCA 5AFKA 4TNWA 5AFNA 2Y54A 2QC1B 2BG9B 2WZYA 3EAMA 4COFA 2BR7A 2X00A 4ALXA 4XHEA 5J0ZA 3IGQA 4HFEA 5J5GA 4ZJSA 3UU6A 4ILCA 2YMDA 3UU5A 2Y57A 2WN9A 2XYSA 3ZKRA 2C9TA 5JMEA 5LXBA 4ILBA 4AFTA 3JADA 4IL4A 3UQ7A 5AFMA 3RIFA 5HEGA 3TLSA 4HFHA 3EHZA 2W8GA 2PGZA 4UY2A 3UQ4A 5J5IA 4UM3S 3P50A 2BG9A 5CO5A 4HFCA 3WTHA 4PIRA 4ILAA 3TLVA 4LMLA 2WNLA 4UXUA 4QABA 4UM1A 2XQ6A 3UUBA 5HEHA 4F8HA 2XQAA 5LG3A 2PH9A 2X00D 5L4EA 1UV6A 4NZBA 4QH5A 2XNTA 4NPPA 3SQ9A 3U8NA 5BW2A 5HCMA 3C79A 3RI5A 3RIAA 2XNUA 2BG9C 2ZJUA 3U8JA 3ZDGA 3C84A 4IREA 2VL0A 2BYPA 3WTKA 4D01A 2BYRA 3GUAA 4QH4A 3LSVA 5BP0A 1UX2A 4HFIA 5CFBA 3U8MA 3SIOA 2WNCA 5L4HA 3SQ6A 3P4WA 2XZ6A 5HCJA 5L47A 4HFDA 3ZDHA 4DBMA 5J5HA 1UW6A 4QH1A 5J5FA 2XQ3A 3SH1A 2WNJA 4B5DA 4LMJA 5IUXA 1I9BA 5SYOA 2XQ9A 5KZUA 3WTNA 4ZK1A 4X5TA 5AFJA 3WTMA 4AFGA 2XQ8A 3WIPA 4ZR6A 3PEOA 5AFHA 2XYTA 3TLUA 2BR8A 2BJ0A 4AFHA 4LMKA 2XNVA 4A97A 5HEUA 5AINA 4BQTA 3RQWA 3RHWA 5KE4A 2XZ5A 2BYSA 3TLWA 2YMEA 2YOEA 3RQUA 3T4MA 2Y56A 4WV9A 3TLTA 2YN6A 2XQ7A 3EI0A 4TNVA 4UM3A 3UU8A 5AFLA 4Z90A 4ZZBA 2Y58A 5BRXA 2BG9E 2Y7YA 4HFBA 5FJVA 3U8KA 4TWFA 2BYNA 3WTJA 3WTIA 4BFQA 2W8FA 3UU4A 4UM3P 4HQPA 4A98A 2ZJVA 2XQ5A 5TVCA 3JAFA 3JAEA 3WTLA 3WTOA 4QAAA 4TWHA 4IL9A 4QACA 3UU3A 4EZ1A 5HEJA 2UZ6A 4ZJTA 5HEOA 3U8LA 4XK9A 2BYQA 2XQ4A 4FRRA 4Z91A 4ZK4A 4TWDA 2YKSA 4ZRUA
chains in the Genus database with same CATH topology
3PMZA 5AFMB 4ZZCA 5AFKA 4TNWA 5AFNA 2Y54A 2QC1B 2BG9B 2WZYA 3EAMA 4COFA 2BR7A 2X00A 4ALXA 4XHEA 5J0ZA 3IGQA 4HFEA 5J5GA 4ZJSA 3UU6A 4ILCA 2YMDA 3UU5A 2Y57A 2WN9A 2XYSA 3ZKRA 2C9TA 5JMEA 5LXBA 4ILBA 4AFTA 3JADA 4IL4A 3UQ7A 5AFMA 3RIFA 5HEGA 3TLSA 4HFHA 3EHZA 2W8GA 2PGZA 4UY2A 3UQ4A 5J5IA 4UM3S 3P50A 2BG9A 5CO5A 4HFCA 3WTHA 4PIRA 4ILAA 3TLVA 4LMLA 2WNLA 4UXUA 4QABA 4UM1A 2XQ6A 3UUBA 5HEHA 4F8HA 2XQAA 5LG3A 2PH9A 2X00D 5L4EA 1UV6A 4NZBA 4QH5A 2XNTA 4NPPA 3SQ9A 3U8NA 5BW2A 5HCMA 3C79A 3RI5A 3RIAA 2XNUA 2BG9C 2ZJUA 3U8JA 3ZDGA 3C84A 4IREA 2VL0A 2BYPA 3WTKA 4D01A 2BYRA 3GUAA 4QH4A 3LSVA 5BP0A 1UX2A 4HFIA 5CFBA 3U8MA 3SIOA 2WNCA 5L4HA 3SQ6A 3P4WA 2XZ6A 5HCJA 5L47A 4HFDA 3ZDHA 4DBMA 5J5HA 1UW6A 4QH1A 5J5FA 2XQ3A 3SH1A 2WNJA 4B5DA 4LMJA 5IUXA 1I9BA 5SYOA 2XQ9A 5KZUA 3WTNA 4ZK1A 4X5TA 5AFJA 3WTMA 4AFGA 2XQ8A 3WIPA 4ZR6A 3PEOA 5AFHA 2XYTA 3TLUA 2BR8A 2BJ0A 4AFHA 4LMKA 2XNVA 4A97A 5HEUA 5AINA 4BQTA 3RQWA 3RHWA 5KE4A 2XZ5A 2BYSA 3TLWA 2YMEA 2YOEA 3RQUA 3T4MA 2Y56A 4WV9A 3TLTA 2YN6A 2XQ7A 3EI0A 4TNVA 4UM3A 3UU8A 5AFLA 4Z90A 4ZZBA 2Y58A 5BRXA 2BG9E 2Y7YA 4HFBA 5FJVA 3U8KA 4TWFA 2BYNA 3WTJA 3WTIA 4BFQA 2W8FA 3UU4A 4UM3P 4HQPA 4A98A 2ZJVA 2XQ5A 5TVCA 3JAFA 3JAEA 3WTLA 3WTOA 4QAAA 4TWHA 4IL9A 4QACA 3UU3A 4EZ1A 5HEJA 2UZ6A 4ZJTA 5HEOA 3U8LA 4XK9A 2BYQA 2XQ4A 4FRRA 4Z91A 4ZK4A 4TWDA 2YKSA 4ZRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMZ A;  5AFM B;  4ZZC A;  5AFK A;  4TNW A;  5AFN A;  2Y54 A;  2QC1 B;  2BG9 B;  2WZY A;  3EAM A;  4COF A;  2BR7 A;  2X00 A;  4ALX A;  4XHE A;  5J0Z A;  3IGQ A;  4HFE A;  5J5G A;  4ZJS A;  3UU6 A;  4ILC A;  2YMD A;  3UU5 A;  2Y57 A;  2WN9 A;  2XYS A;  3ZKR A;  2C9T A;  5JME A;  5LXB A;  4ILB A;  4AFT A;  3JAD A;  4IL4 A;  3UQ7 A;  5AFM A;  3RIF A;  5HEG A;  3TLS A;  4HFH A;  3EHZ A;  2W8G A;  2PGZ A;  4UY2 A;  3UQ4 A;  5J5I A;  4UM3 S;  3P50 A;  2BG9 A;  5CO5 A;  4HFC A;  3WTH A;  4PIR A;  4ILA A;  3TLV A;  4LML A;  2WNL A;  4UXU A;  4QAB A;  4UM1 A;  2XQ6 A;  3UUB A;  5HEH A;  4F8H A;  2XQA A;  5LG3 A;  2PH9 A;  2X00 D;  5L4E A;  1UV6 A;  4NZB A;  4QH5 A;  2XNT A;  4NPP A;  3SQ9 A;  3U8N A;  5BW2 A;  5HCM A;  3C79 A;  3RI5 A;  3RIA A;  2XNU A;  2BG9 C;  2ZJU A;  3U8J A;  3ZDG A;  3C84 A;  4IRE A;  2VL0 A;  2BYP A;  3WTK A;  4D01 A;  2BYR A;  3GUA A;  4QH4 A;  3LSV A;  5BP0 A;  1UX2 A;  4HFI A;  5CFB A;  3U8M A;  3SIO A;  2WNC A;  5L4H A;  3SQ6 A;  3P4W A;  2XZ6 A;  5HCJ A;  5L47 A;  4HFD A;  3ZDH A;  4DBM A;  5J5H A;  1UW6 A;  4QH1 A;  5J5F A;  2XQ3 A;  3SH1 A;  2WNJ A;  4B5D A;  4LMJ A;  5IUX A;  1I9B A;  5SYO A;  2XQ9 A;  5KZU A;  3WTN A;  4ZK1 A;  4X5T A;  5AFJ A;  3WTM A;  4AFG A;  2XQ8 A;  3WIP A;  4ZR6 A;  3PEO A;  5AFH A;  2XYT A;  3TLU A;  2BR8 A;  2BJ0 A;  4AFH A;  4LMK A;  2XNV A;  4A97 A;  5HEU A;  5AIN A;  4BQT A;  3RQW A;  3RHW A;  5KE4 A;  2XZ5 A;  2BYS A;  3TLW A;  2YME A;  2YOE A;  3RQU A;  3T4M A;  2Y56 A;  4WV9 A;  3TLT A;  2YN6 A;  2XQ7 A;  3EI0 A;  4TNV A;  4UM3 A;  3UU8 A;  5AFL A;  4Z90 A;  4ZZB A;  2Y58 A;  5BRX A;  2BG9 E;  2Y7Y A;  4HFB A;  5FJV A;  3U8K A;  4TWF A;  2BYN A;  3WTJ A;  3WTI A;  4BFQ A;  2W8F A;  3UU4 A;  4UM3 P;  4HQP A;  4A98 A;  2ZJV A;  2XQ5 A;  5TVC A;  3JAF A;  3JAE A;  3WTL A;  3WTO A;  4QAA A;  4TWH A;  4IL9 A;  4QAC A;  3UU3 A;  4EZ1 A;  5HEJ A;  2UZ6 A;  4ZJT A;  5HEO A;  3U8L A;  4XK9 A;  2BYQ A;  2XQ4 A;  4FRR A;  4Z91 A;  4ZK4 A;  4TWD A;  2YKS A;  4ZRU A; 
#chains in the Genus database with same CATH topology
 3PMZ A;  5AFM B;  4ZZC A;  5AFK A;  4TNW A;  5AFN A;  2Y54 A;  2QC1 B;  2BG9 B;  2WZY A;  3EAM A;  4COF A;  2BR7 A;  2X00 A;  4ALX A;  4XHE A;  5J0Z A;  3IGQ A;  4HFE A;  5J5G A;  4ZJS A;  3UU6 A;  4ILC A;  2YMD A;  3UU5 A;  2Y57 A;  2WN9 A;  2XYS A;  3ZKR A;  2C9T A;  5JME A;  5LXB A;  4ILB A;  4AFT A;  3JAD A;  4IL4 A;  3UQ7 A;  5AFM A;  3RIF A;  5HEG A;  3TLS A;  4HFH A;  3EHZ A;  2W8G A;  2PGZ A;  4UY2 A;  3UQ4 A;  5J5I A;  4UM3 S;  3P50 A;  2BG9 A;  5CO5 A;  4HFC A;  3WTH A;  4PIR A;  4ILA A;  3TLV A;  4LML A;  2WNL A;  4UXU A;  4QAB A;  4UM1 A;  2XQ6 A;  3UUB A;  5HEH A;  4F8H A;  2XQA A;  5LG3 A;  2PH9 A;  2X00 D;  5L4E A;  1UV6 A;  4NZB A;  4QH5 A;  2XNT A;  4NPP A;  3SQ9 A;  3U8N A;  5BW2 A;  5HCM A;  3C79 A;  3RI5 A;  3RIA A;  2XNU A;  2BG9 C;  2ZJU A;  3U8J A;  3ZDG A;  3C84 A;  4IRE A;  2VL0 A;  2BYP A;  3WTK A;  4D01 A;  2BYR A;  3GUA A;  4QH4 A;  3LSV A;  5BP0 A;  1UX2 A;  4HFI A;  5CFB A;  3U8M A;  3SIO A;  2WNC A;  5L4H A;  3SQ6 A;  3P4W A;  2XZ6 A;  5HCJ A;  5L47 A;  4HFD A;  3ZDH A;  4DBM A;  5J5H A;  1UW6 A;  4QH1 A;  5J5F A;  2XQ3 A;  3SH1 A;  2WNJ A;  4B5D A;  4LMJ A;  5IUX A;  1I9B A;  5SYO A;  2XQ9 A;  5KZU A;  3WTN A;  4ZK1 A;  4X5T A;  5AFJ A;  3WTM A;  4AFG A;  2XQ8 A;  3WIP A;  4ZR6 A;  3PEO A;  5AFH A;  2XYT A;  3TLU A;  2BR8 A;  2BJ0 A;  4AFH A;  4LMK A;  2XNV A;  4A97 A;  5HEU A;  5AIN A;  4BQT A;  3RQW A;  3RHW A;  5KE4 A;  2XZ5 A;  2BYS A;  3TLW A;  2YME A;  2YOE A;  3RQU A;  3T4M A;  2Y56 A;  4WV9 A;  3TLT A;  2YN6 A;  2XQ7 A;  3EI0 A;  4TNV A;  4UM3 A;  3UU8 A;  5AFL A;  4Z90 A;  4ZZB A;  2Y58 A;  5BRX A;  2BG9 E;  2Y7Y A;  4HFB A;  5FJV A;  3U8K A;  4TWF A;  2BYN A;  3WTJ A;  3WTI A;  4BFQ A;  2W8F A;  3UU4 A;  4UM3 P;  4HQP A;  4A98 A;  2ZJV A;  2XQ5 A;  5TVC A;  3JAF A;  3JAE A;  3WTL A;  3WTO A;  4QAA A;  4TWH A;  4IL9 A;  4QAC A;  3UU3 A;  4EZ1 A;  5HEJ A;  2UZ6 A;  4ZJT A;  5HEO A;  3U8L A;  4XK9 A;  2BYQ A;  2XQ4 A;  4FRR A;  4Z91 A;  4ZK4 A;  4TWD A;  2YKS A;  4ZRU A; 
#chains in the Genus database with same CATH homology
 3PMZ A;  5AFM B;  4ZZC A;  5AFK A;  4TNW A;  5AFN A;  2Y54 A;  2QC1 B;  2BG9 B;  2WZY A;  3EAM A;  4COF A;  2BR7 A;  2X00 A;  4ALX A;  4XHE A;  5J0Z A;  3IGQ A;  4HFE A;  5J5G A;  4ZJS A;  3UU6 A;  4ILC A;  2YMD A;  3UU5 A;  2Y57 A;  2WN9 A;  2XYS A;  3ZKR A;  2C9T A;  5JME A;  5LXB A;  4ILB A;  4AFT A;  3JAD A;  4IL4 A;  3UQ7 A;  5AFM A;  3RIF A;  5HEG A;  3TLS A;  4HFH A;  3EHZ A;  2W8G A;  2PGZ A;  4UY2 A;  3UQ4 A;  5J5I A;  4UM3 S;  3P50 A;  2BG9 A;  5CO5 A;  4HFC A;  3WTH A;  4PIR A;  4ILA A;  3TLV A;  4LML A;  2WNL A;  4UXU A;  4QAB A;  4UM1 A;  2XQ6 A;  3UUB A;  5HEH A;  4F8H A;  2XQA A;  5LG3 A;  2PH9 A;  2X00 D;  5L4E A;  1UV6 A;  4NZB A;  4QH5 A;  2XNT A;  4NPP A;  3SQ9 A;  3U8N A;  5BW2 A;  5HCM A;  3C79 A;  3RI5 A;  3RIA A;  2XNU A;  2BG9 C;  2ZJU A;  3U8J A;  3ZDG A;  3C84 A;  4IRE A;  2VL0 A;  2BYP A;  3WTK A;  4D01 A;  2BYR A;  3GUA A;  4QH4 A;  3LSV A;  5BP0 A;  1UX2 A;  4HFI A;  5CFB A;  3U8M A;  3SIO A;  2WNC A;  5L4H A;  3SQ6 A;  3P4W A;  2XZ6 A;  5HCJ A;  5L47 A;  4HFD A;  3ZDH A;  4DBM A;  5J5H A;  1UW6 A;  4QH1 A;  5J5F A;  2XQ3 A;  3SH1 A;  2WNJ A;  4B5D A;  4LMJ A;  5IUX A;  1I9B A;  5SYO A;  2XQ9 A;  5KZU A;  3WTN A;  4ZK1 A;  4X5T A;  5AFJ A;  3WTM A;  4AFG A;  2XQ8 A;  3WIP A;  4ZR6 A;  3PEO A;  5AFH A;  2XYT A;  3TLU A;  2BR8 A;  2BJ0 A;  4AFH A;  4LMK A;  2XNV A;  4A97 A;  5HEU A;  5AIN A;  4BQT A;  3RQW A;  3RHW A;  5KE4 A;  2XZ5 A;  2BYS A;  3TLW A;  2YME A;  2YOE A;  3RQU A;  3T4M A;  2Y56 A;  4WV9 A;  3TLT A;  2YN6 A;  2XQ7 A;  3EI0 A;  4TNV A;  4UM3 A;  3UU8 A;  5AFL A;  4Z90 A;  4ZZB A;  2Y58 A;  5BRX A;  2BG9 E;  2Y7Y A;  4HFB A;  5FJV A;  3U8K A;  4TWF A;  2BYN A;  3WTJ A;  3WTI A;  4BFQ A;  2W8F A;  3UU4 A;  4UM3 P;  4HQP A;  4A98 A;  2ZJV A;  2XQ5 A;  5TVC A;  3JAF A;  3JAE A;  3WTL A;  3WTO A;  4QAA A;  4TWH A;  4IL9 A;  4QAC A;  3UU3 A;  4EZ1 A;  5HEJ A;  2UZ6 A;  4ZJT A;  5HEO A;  3U8L A;  4XK9 A;  2BYQ A;  2XQ4 A;  4FRR A;  4Z91 A;  4ZK4 A;  4TWD A;  2YKS A;  4ZRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...