5J5HA

X-ray structure of acetylcholine binding protein (achbp) in complex with 6-(2-methoxyphenyl)-n4,n4-bis[(pyridin-2-yl)methyl]pyrimidine-2,4-diamine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
209
structure length
204
Chain Sequence
DDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Substituted 2-Aminopyrimidines Selective for alpha 7-Nicotinic Acetylcholine Receptor Activation and Association with Acetylcholine Binding Proteins.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein
total genus 51
structure length 204
sequence length 209
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5j5hA00
3C79A 4HFCA 4ZR6A 5HEUA 3WTKA 2YMEA 3WTJA 5BRXA 4TWHA 4DBMA 5J5HA 3P50A 4ZZCA 5HEOA 2UZ6A 2XQAA 2XQ6A 3UQ4A 3U8MA 4Z91A 2XZ5A 3PMZA 4IL4A 5BP0A 3U8KA 5J5FA 3ZKRA 5TVCA 5FJVA 3WTNA 2XYSA 2BG9B 4ZJSA 4IL9A 4ALXA 3SH1A 2BYRA 2XQ3A 3RI5A 3UU5A 4BQTA 4F8HA 3WTOA 3C84A 5AFJA 5AFNA 2X00D 2Y54A 4AFHA 5AFMA 5AFHA 2XQ4A 5SYOA 5LG3A 2XNTA 2XQ7A 2Y56A 3RHWA 3RIFA 4UM3S 2BYSA 4D01A 3UU4A 3WIPA 5LXBA 1UW6A 2WNJA 5HCMA 3T4MA 2XYTA 3TLWA 4IREA 3GUAA 4HFBA 4HQPA 5L4HA 3U8LA 5IUXA 4QACA 5KZUA 4UM1A 3WTLA 3UQ7A 3ZDHA 2WNCA 2Y58A 4NZBA 4ZJTA 2BYPA 3JAEA 1I9BA 2PH9A 4XK9A 2WZYA 3TLSA 4EZ1A 2XQ8A 3RIAA 4UM3P 4A97A 2ZJUA 3JADA 5J5GA 4NPPA 4AFGA 2XQ9A 4ZRUA 4ILAA 2BG9E 2PGZA 2XZ6A 5J5IA 2BG9A 2YMDA 5BW2A 3RQUA 2BR8A 2XQ5A 2Y57A 2BR7A 4QABA 4BFQA 2C9TA 5CO5A 5CFBA 4FRRA 3TLVA 2YKSA 5AFMB 2XNUA 1UX2A 4HFIA 4TWFA 4X5TA 4COFA 4TNVA 4QH4A 3JAFA 4LMJA 2QC1B 5L4EA 4AFTA 3EAMA 4ZK4A 4UXUA 3WTHA 5AINA 5AFLA 5L47A 3SIOA 4QAAA 2YOEA 2BG9C 2VL0A 3P4WA 5AFKA 2WNLA 2BYQA 5HEJA 3EI0A 4ILBA 2ZJVA 4ZK1A 3SQ9A 3U8JA 1UV6A 3PEOA 5JMEA 3TLTA 4PIRA 4TWDA 3WTIA 5HCJA 4ILCA 5KE4A 2Y7YA 4LMKA 2BYNA 3UU3A 4HFDA 3ZDGA 4ZZBA 2WN9A 4XHEA 3TLUA 4QH1A 3LSVA 3IGQA 4WV9A 3U8NA 2X00A 5HEHA 3UUBA 2BJ0A 4UM3A 3UU6A 3UU8A 4B5DA 4QH5A 2YN6A 4A98A 3RQWA 2W8FA 4HFEA 4HFHA 4LMLA 4UY2A 3WTMA 3SQ6A 5HEGA 5J0ZA 4TNWA 2XNVA 4Z90A 3EHZA 2W8GA
chains in the Genus database with same CATH superfamily
3C79A 4HFCA 4ZR6A 5HEUA 3WTKA 2YMEA 3WTJA 5BRXA 4TWHA 4DBMA 5J5HA 3P50A 4ZZCA 5HEOA 2UZ6A 2XQAA 2XQ6A 3UQ4A 3U8MA 4Z91A 2XZ5A 3PMZA 4IL4A 5BP0A 3U8KA 5J5FA 3ZKRA 5TVCA 5FJVA 3WTNA 2XYSA 2BG9B 4ZJSA 4IL9A 4ALXA 3SH1A 2BYRA 2XQ3A 3RI5A 3UU5A 4BQTA 4F8HA 3WTOA 3C84A 5AFJA 5AFNA 2X00D 2Y54A 4AFHA 5AFMA 5AFHA 2XQ4A 5SYOA 5LG3A 2XNTA 2XQ7A 2Y56A 3RHWA 3RIFA 4UM3S 2BYSA 4D01A 3UU4A 3WIPA 5LXBA 1UW6A 2WNJA 5HCMA 3T4MA 2XYTA 3TLWA 4IREA 3GUAA 4HFBA 4HQPA 5L4HA 3U8LA 5IUXA 4QACA 5KZUA 4UM1A 3WTLA 3UQ7A 3ZDHA 2WNCA 2Y58A 4NZBA 4ZJTA 2BYPA 3JAEA 1I9BA 2PH9A 4XK9A 2WZYA 3TLSA 4EZ1A 2XQ8A 3RIAA 4UM3P 4A97A 2ZJUA 3JADA 5J5GA 4NPPA 4AFGA 2XQ9A 4ZRUA 4ILAA 2BG9E 2PGZA 2XZ6A 5J5IA 2BG9A 2YMDA 5BW2A 3RQUA 2BR8A 2XQ5A 2Y57A 2BR7A 4QABA 4BFQA 2C9TA 5CO5A 5CFBA 4FRRA 3TLVA 2YKSA 5AFMB 2XNUA 1UX2A 4HFIA 4TWFA 4X5TA 4COFA 4TNVA 4QH4A 3JAFA 4LMJA 2QC1B 5L4EA 4AFTA 3EAMA 4ZK4A 4UXUA 3WTHA 5AINA 5AFLA 5L47A 3SIOA 4QAAA 2YOEA 2BG9C 2VL0A 3P4WA 5AFKA 2WNLA 2BYQA 5HEJA 3EI0A 4ILBA 2ZJVA 4ZK1A 3SQ9A 3U8JA 1UV6A 3PEOA 5JMEA 3TLTA 4PIRA 4TWDA 3WTIA 5HCJA 4ILCA 5KE4A 2Y7YA 4LMKA 2BYNA 3UU3A 4HFDA 3ZDGA 4ZZBA 2WN9A 4XHEA 3TLUA 4QH1A 3LSVA 3IGQA 4WV9A 3U8NA 2X00A 5HEHA 3UUBA 2BJ0A 4UM3A 3UU6A 3UU8A 4B5DA 4QH5A 2YN6A 4A98A 3RQWA 2W8FA 4HFEA 4HFHA 4LMLA 4UY2A 3WTMA 3SQ6A 5HEGA 5J0ZA 4TNWA 2XNVA 4Z90A 3EHZA 2W8GA
chains in the Genus database with same CATH topology
3C79A 4HFCA 4ZR6A 5HEUA 3WTKA 2YMEA 3WTJA 5BRXA 4TWHA 4DBMA 5J5HA 3P50A 4ZZCA 5HEOA 2UZ6A 2XQAA 2XQ6A 3UQ4A 3U8MA 4Z91A 2XZ5A 3PMZA 4IL4A 5BP0A 3U8KA 5J5FA 3ZKRA 5TVCA 5FJVA 3WTNA 2XYSA 2BG9B 4ZJSA 4IL9A 4ALXA 3SH1A 2BYRA 2XQ3A 3RI5A 3UU5A 4BQTA 4F8HA 3WTOA 3C84A 5AFJA 5AFNA 2X00D 2Y54A 4AFHA 5AFMA 5AFHA 2XQ4A 5SYOA 5LG3A 2XNTA 2XQ7A 2Y56A 3RHWA 3RIFA 4UM3S 2BYSA 4D01A 3UU4A 3WIPA 5LXBA 1UW6A 2WNJA 5HCMA 3T4MA 2XYTA 3TLWA 4IREA 3GUAA 4HFBA 4HQPA 5L4HA 3U8LA 5IUXA 4QACA 5KZUA 4UM1A 3WTLA 3UQ7A 3ZDHA 2WNCA 2Y58A 4NZBA 4ZJTA 2BYPA 3JAEA 1I9BA 2PH9A 4XK9A 2WZYA 3TLSA 4EZ1A 2XQ8A 3RIAA 4UM3P 4A97A 2ZJUA 3JADA 5J5GA 4NPPA 4AFGA 2XQ9A 4ZRUA 4ILAA 2BG9E 2PGZA 2XZ6A 5J5IA 2BG9A 2YMDA 5BW2A 3RQUA 2BR8A 2XQ5A 2Y57A 2BR7A 4QABA 4BFQA 2C9TA 5CO5A 5CFBA 4FRRA 3TLVA 2YKSA 5AFMB 2XNUA 1UX2A 4HFIA 4TWFA 4X5TA 4COFA 4TNVA 4QH4A 3JAFA 4LMJA 2QC1B 5L4EA 4AFTA 3EAMA 4ZK4A 4UXUA 3WTHA 5AINA 5AFLA 5L47A 3SIOA 4QAAA 2YOEA 2BG9C 2VL0A 3P4WA 5AFKA 2WNLA 2BYQA 5HEJA 3EI0A 4ILBA 2ZJVA 4ZK1A 3SQ9A 3U8JA 1UV6A 3PEOA 5JMEA 3TLTA 4PIRA 4TWDA 3WTIA 5HCJA 4ILCA 5KE4A 2Y7YA 4LMKA 2BYNA 3UU3A 4HFDA 3ZDGA 4ZZBA 2WN9A 4XHEA 3TLUA 4QH1A 3LSVA 3IGQA 4WV9A 3U8NA 2X00A 5HEHA 3UUBA 2BJ0A 4UM3A 3UU6A 3UU8A 4B5DA 4QH5A 2YN6A 4A98A 3RQWA 2W8FA 4HFEA 4HFHA 4LMLA 4UY2A 3WTMA 3SQ6A 5HEGA 5J0ZA 4TNWA 2XNVA 4Z90A 3EHZA 2W8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C79 A;  4HFC A;  4ZR6 A;  5HEU A;  3WTK A;  2YME A;  3WTJ A;  5BRX A;  4TWH A;  4DBM A;  5J5H A;  3P50 A;  4ZZC A;  5HEO A;  2UZ6 A;  2XQA A;  2XQ6 A;  3UQ4 A;  3U8M A;  4Z91 A;  2XZ5 A;  3PMZ A;  4IL4 A;  5BP0 A;  3U8K A;  5J5F A;  3ZKR A;  5TVC A;  5FJV A;  3WTN A;  2XYS A;  2BG9 B;  4ZJS A;  4IL9 A;  4ALX A;  3SH1 A;  2BYR A;  2XQ3 A;  3RI5 A;  3UU5 A;  4BQT A;  4F8H A;  3WTO A;  3C84 A;  5AFJ A;  5AFN A;  2X00 D;  2Y54 A;  4AFH A;  5AFM A;  5AFH A;  2XQ4 A;  5SYO A;  5LG3 A;  2XNT A;  2XQ7 A;  2Y56 A;  3RHW A;  3RIF A;  4UM3 S;  2BYS A;  4D01 A;  3UU4 A;  3WIP A;  5LXB A;  1UW6 A;  2WNJ A;  5HCM A;  3T4M A;  2XYT A;  3TLW A;  4IRE A;  3GUA A;  4HFB A;  4HQP A;  5L4H A;  3U8L A;  5IUX A;  4QAC A;  5KZU A;  4UM1 A;  3WTL A;  3UQ7 A;  3ZDH A;  2WNC A;  2Y58 A;  4NZB A;  4ZJT A;  2BYP A;  3JAE A;  1I9B A;  2PH9 A;  4XK9 A;  2WZY A;  3TLS A;  4EZ1 A;  2XQ8 A;  3RIA A;  4UM3 P;  4A97 A;  2ZJU A;  3JAD A;  5J5G A;  4NPP A;  4AFG A;  2XQ9 A;  4ZRU A;  4ILA A;  2BG9 E;  2PGZ A;  2XZ6 A;  5J5I A;  2BG9 A;  2YMD A;  5BW2 A;  3RQU A;  2BR8 A;  2XQ5 A;  2Y57 A;  2BR7 A;  4QAB A;  4BFQ A;  2C9T A;  5CO5 A;  5CFB A;  4FRR A;  3TLV A;  2YKS A;  5AFM B;  2XNU A;  1UX2 A;  4HFI A;  4TWF A;  4X5T A;  4COF A;  4TNV A;  4QH4 A;  3JAF A;  4LMJ A;  2QC1 B;  5L4E A;  4AFT A;  3EAM A;  4ZK4 A;  4UXU A;  3WTH A;  5AIN A;  5AFL A;  5L47 A;  3SIO A;  4QAA A;  2YOE A;  2BG9 C;  2VL0 A;  3P4W A;  5AFK A;  2WNL A;  2BYQ A;  5HEJ A;  3EI0 A;  4ILB A;  2ZJV A;  4ZK1 A;  3SQ9 A;  3U8J A;  1UV6 A;  3PEO A;  5JME A;  3TLT A;  4PIR A;  4TWD A;  3WTI A;  5HCJ A;  4ILC A;  5KE4 A;  2Y7Y A;  4LMK A;  2BYN A;  3UU3 A;  4HFD A;  3ZDG A;  4ZZB A;  2WN9 A;  4XHE A;  3TLU A;  4QH1 A;  3LSV A;  3IGQ A;  4WV9 A;  3U8N A;  2X00 A;  5HEH A;  3UUB A;  2BJ0 A;  4UM3 A;  3UU6 A;  3UU8 A;  4B5D A;  4QH5 A;  2YN6 A;  4A98 A;  3RQW A;  2W8F A;  4HFE A;  4HFH A;  4LML A;  4UY2 A;  3WTM A;  3SQ6 A;  5HEG A;  5J0Z A;  4TNW A;  2XNV A;  4Z90 A;  3EHZ A;  2W8G A; 
#chains in the Genus database with same CATH topology
 3C79 A;  4HFC A;  4ZR6 A;  5HEU A;  3WTK A;  2YME A;  3WTJ A;  5BRX A;  4TWH A;  4DBM A;  5J5H A;  3P50 A;  4ZZC A;  5HEO A;  2UZ6 A;  2XQA A;  2XQ6 A;  3UQ4 A;  3U8M A;  4Z91 A;  2XZ5 A;  3PMZ A;  4IL4 A;  5BP0 A;  3U8K A;  5J5F A;  3ZKR A;  5TVC A;  5FJV A;  3WTN A;  2XYS A;  2BG9 B;  4ZJS A;  4IL9 A;  4ALX A;  3SH1 A;  2BYR A;  2XQ3 A;  3RI5 A;  3UU5 A;  4BQT A;  4F8H A;  3WTO A;  3C84 A;  5AFJ A;  5AFN A;  2X00 D;  2Y54 A;  4AFH A;  5AFM A;  5AFH A;  2XQ4 A;  5SYO A;  5LG3 A;  2XNT A;  2XQ7 A;  2Y56 A;  3RHW A;  3RIF A;  4UM3 S;  2BYS A;  4D01 A;  3UU4 A;  3WIP A;  5LXB A;  1UW6 A;  2WNJ A;  5HCM A;  3T4M A;  2XYT A;  3TLW A;  4IRE A;  3GUA A;  4HFB A;  4HQP A;  5L4H A;  3U8L A;  5IUX A;  4QAC A;  5KZU A;  4UM1 A;  3WTL A;  3UQ7 A;  3ZDH A;  2WNC A;  2Y58 A;  4NZB A;  4ZJT A;  2BYP A;  3JAE A;  1I9B A;  2PH9 A;  4XK9 A;  2WZY A;  3TLS A;  4EZ1 A;  2XQ8 A;  3RIA A;  4UM3 P;  4A97 A;  2ZJU A;  3JAD A;  5J5G A;  4NPP A;  4AFG A;  2XQ9 A;  4ZRU A;  4ILA A;  2BG9 E;  2PGZ A;  2XZ6 A;  5J5I A;  2BG9 A;  2YMD A;  5BW2 A;  3RQU A;  2BR8 A;  2XQ5 A;  2Y57 A;  2BR7 A;  4QAB A;  4BFQ A;  2C9T A;  5CO5 A;  5CFB A;  4FRR A;  3TLV A;  2YKS A;  5AFM B;  2XNU A;  1UX2 A;  4HFI A;  4TWF A;  4X5T A;  4COF A;  4TNV A;  4QH4 A;  3JAF A;  4LMJ A;  2QC1 B;  5L4E A;  4AFT A;  3EAM A;  4ZK4 A;  4UXU A;  3WTH A;  5AIN A;  5AFL A;  5L47 A;  3SIO A;  4QAA A;  2YOE A;  2BG9 C;  2VL0 A;  3P4W A;  5AFK A;  2WNL A;  2BYQ A;  5HEJ A;  3EI0 A;  4ILB A;  2ZJV A;  4ZK1 A;  3SQ9 A;  3U8J A;  1UV6 A;  3PEO A;  5JME A;  3TLT A;  4PIR A;  4TWD A;  3WTI A;  5HCJ A;  4ILC A;  5KE4 A;  2Y7Y A;  4LMK A;  2BYN A;  3UU3 A;  4HFD A;  3ZDG A;  4ZZB A;  2WN9 A;  4XHE A;  3TLU A;  4QH1 A;  3LSV A;  3IGQ A;  4WV9 A;  3U8N A;  2X00 A;  5HEH A;  3UUB A;  2BJ0 A;  4UM3 A;  3UU6 A;  3UU8 A;  4B5D A;  4QH5 A;  2YN6 A;  4A98 A;  3RQW A;  2W8F A;  4HFE A;  4HFH A;  4LML A;  4UY2 A;  3WTM A;  3SQ6 A;  5HEG A;  5J0Z A;  4TNW A;  2XNV A;  4Z90 A;  3EHZ A;  2W8G A; 
#chains in the Genus database with same CATH homology
 3C79 A;  4HFC A;  4ZR6 A;  5HEU A;  3WTK A;  2YME A;  3WTJ A;  5BRX A;  4TWH A;  4DBM A;  5J5H A;  3P50 A;  4ZZC A;  5HEO A;  2UZ6 A;  2XQA A;  2XQ6 A;  3UQ4 A;  3U8M A;  4Z91 A;  2XZ5 A;  3PMZ A;  4IL4 A;  5BP0 A;  3U8K A;  5J5F A;  3ZKR A;  5TVC A;  5FJV A;  3WTN A;  2XYS A;  2BG9 B;  4ZJS A;  4IL9 A;  4ALX A;  3SH1 A;  2BYR A;  2XQ3 A;  3RI5 A;  3UU5 A;  4BQT A;  4F8H A;  3WTO A;  3C84 A;  5AFJ A;  5AFN A;  2X00 D;  2Y54 A;  4AFH A;  5AFM A;  5AFH A;  2XQ4 A;  5SYO A;  5LG3 A;  2XNT A;  2XQ7 A;  2Y56 A;  3RHW A;  3RIF A;  4UM3 S;  2BYS A;  4D01 A;  3UU4 A;  3WIP A;  5LXB A;  1UW6 A;  2WNJ A;  5HCM A;  3T4M A;  2XYT A;  3TLW A;  4IRE A;  3GUA A;  4HFB A;  4HQP A;  5L4H A;  3U8L A;  5IUX A;  4QAC A;  5KZU A;  4UM1 A;  3WTL A;  3UQ7 A;  3ZDH A;  2WNC A;  2Y58 A;  4NZB A;  4ZJT A;  2BYP A;  3JAE A;  1I9B A;  2PH9 A;  4XK9 A;  2WZY A;  3TLS A;  4EZ1 A;  2XQ8 A;  3RIA A;  4UM3 P;  4A97 A;  2ZJU A;  3JAD A;  5J5G A;  4NPP A;  4AFG A;  2XQ9 A;  4ZRU A;  4ILA A;  2BG9 E;  2PGZ A;  2XZ6 A;  5J5I A;  2BG9 A;  2YMD A;  5BW2 A;  3RQU A;  2BR8 A;  2XQ5 A;  2Y57 A;  2BR7 A;  4QAB A;  4BFQ A;  2C9T A;  5CO5 A;  5CFB A;  4FRR A;  3TLV A;  2YKS A;  5AFM B;  2XNU A;  1UX2 A;  4HFI A;  4TWF A;  4X5T A;  4COF A;  4TNV A;  4QH4 A;  3JAF A;  4LMJ A;  2QC1 B;  5L4E A;  4AFT A;  3EAM A;  4ZK4 A;  4UXU A;  3WTH A;  5AIN A;  5AFL A;  5L47 A;  3SIO A;  4QAA A;  2YOE A;  2BG9 C;  2VL0 A;  3P4W A;  5AFK A;  2WNL A;  2BYQ A;  5HEJ A;  3EI0 A;  4ILB A;  2ZJV A;  4ZK1 A;  3SQ9 A;  3U8J A;  1UV6 A;  3PEO A;  5JME A;  3TLT A;  4PIR A;  4TWD A;  3WTI A;  5HCJ A;  4ILC A;  5KE4 A;  2Y7Y A;  4LMK A;  2BYN A;  3UU3 A;  4HFD A;  3ZDG A;  4ZZB A;  2WN9 A;  4XHE A;  3TLU A;  4QH1 A;  3LSV A;  3IGQ A;  4WV9 A;  3U8N A;  2X00 A;  5HEH A;  3UUB A;  2BJ0 A;  4UM3 A;  3UU6 A;  3UU8 A;  4B5D A;  4QH5 A;  2YN6 A;  4A98 A;  3RQW A;  2W8F A;  4HFE A;  4HFH A;  4LML A;  4UY2 A;  3WTM A;  3SQ6 A;  5HEG A;  5J0Z A;  4TNW A;  2XNV A;  4Z90 A;  3EHZ A;  2W8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...