5KE4A

Crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 6 nicotinic acetylcholine receptor in complex with 2-((5-(3,7-diazabicyclo[3.3.1]nonan-3-yl)pyridin-3-yl)oxy)- n,n-dimethylethanamine (bpc)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
211
structure length
207
Chain Sequence
DDKLHSQANLMRLKSDLFNYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTKHDIKYNCCEEIYTDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein
molecule keywords Soluble acetylcholine receptor
publication title Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 6 nicotinic acetylcholine receptor in complex with 2-((5-(3,7-Diazabicyclo[3.3.1]nonan-3-yl)pyridin-3-yl)oxy)- N,N-dimethylethanamine (BPC)
rcsb
source organism Aplysia californica
total genus 52
structure length 207
sequence length 211
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5ke4A00
3SH1A 2XZ6A 3JADA 3UU8A 2XQ7A 3UU3A 3WTKA 4TWFA 2Y7YA 3P50A 2XNVA 2BYSA 3SIOA 3TLUA 4ZZCA 5KZUA 2YMEA 2WNCA 4IL4A 5L47A 2BYPA 4BQTA 3U8JA 2QC1B 4NZBA 3RQWA 3RHWA 4QAAA 5L4EA 3GUAA 5AFHA 5AINA 2XQ9A 3UQ7A 5SYOA 4LMLA 3RIFA 3C84A 4DBMA 3WTHA 4IL9A 3RIAA 5AFMB 4HFEA 2Y54A 4A97A 4LMJA 4X5TA 2Y57A 3U8MA 3TLVA 2ZJUA 2WZYA 4TNVA 4AFGA 4Z91A 2YN6A 2XYSA 2XQAA 4HQPA 3WTMA 2PH9A 5HEOA 2VL0A 5FJVA 5J5HA 4FRRA 4WV9A 4IREA 5KE4A 3JAFA 2XQ3A 2PGZA 3IGQA 3T4MA 5JMEA 4QACA 2C9TA 4TNWA 3TLTA 4LMKA 4Z90A 3EI0A 3C79A 4ILCA 2XQ4A 5HEHA 2BR7A 3JAEA 5AFNA 2UZ6A 2XNTA 3PMZA 5J5IA 5LG3A 3WTJA 3RI5A 3RQUA 4NPPA 5IUXA 2XYTA 4B5DA 4COFA 4F8HA 2XQ5A 3EHZA 4UM3A 4ZJSA 3UU6A 2XQ8A 5BP0A 2BG9E 5J5GA 2WNJA 4UM1A 4PIRA 3WTOA 2BYRA 2YKSA 4EZ1A 1UX2A 5HEGA 2XQ6A 3PEOA 3UU4A 5AFMA 4HFHA 3EAMA 4HFDA 4ILAA 4A98A 4HFCA 5HEUA 4XHEA 4ZK1A 5J5FA 2WN9A 2BG9B 3U8LA 5CO5A 4ZZBA 2XNUA 4D01A 2X00D 4AFTA 4QH5A 5CFBA 5BRXA 1I9BA 4UM3S 3TLWA 4ZJTA 5BW2A 4ZRUA 3WTIA 3UU5A 3U8NA 5AFJA 4ALXA 2Y56A 2BG9A 5TVCA 2BYNA 5L4HA 4TWHA 4XK9A 2W8GA 2XZ5A 5HCJA 4UY2A 3UUBA 3ZDGA 5HEJA 4TWDA 4ZK4A 2ZJVA 2X00A 4QABA 2BG9C 2BYQA 4UM3P 3SQ6A 2Y58A 4QH4A 3WIPA 2BR8A 2BJ0A 3WTLA 2W8FA 4HFBA 4UXUA 3ZDHA 5AFKA 2WNLA 3ZKRA 3TLSA 4QH1A 3LSVA 5LXBA 4HFIA 3P4WA 4ZR6A 3UQ4A 4AFHA 4BFQA 3WTNA 2YMDA 2YOEA 3U8KA 1UV6A 4ILBA 5HCMA 3SQ9A 1UW6A 5AFLA 5J0ZA
chains in the Genus database with same CATH superfamily
3SH1A 2XZ6A 3JADA 3UU8A 2XQ7A 3UU3A 3WTKA 4TWFA 2Y7YA 3P50A 2XNVA 2BYSA 3SIOA 3TLUA 4ZZCA 5KZUA 2YMEA 2WNCA 4IL4A 5L47A 2BYPA 4BQTA 3U8JA 2QC1B 4NZBA 3RQWA 3RHWA 4QAAA 5L4EA 3GUAA 5AFHA 5AINA 2XQ9A 3UQ7A 5SYOA 4LMLA 3RIFA 3C84A 4DBMA 3WTHA 4IL9A 3RIAA 5AFMB 4HFEA 2Y54A 4A97A 4LMJA 4X5TA 2Y57A 3U8MA 3TLVA 2ZJUA 2WZYA 4TNVA 4AFGA 4Z91A 2YN6A 2XYSA 2XQAA 4HQPA 3WTMA 2PH9A 5HEOA 2VL0A 5FJVA 5J5HA 4FRRA 4WV9A 4IREA 5KE4A 3JAFA 2XQ3A 2PGZA 3IGQA 3T4MA 5JMEA 4QACA 2C9TA 4TNWA 3TLTA 4LMKA 4Z90A 3EI0A 3C79A 4ILCA 2XQ4A 5HEHA 2BR7A 3JAEA 5AFNA 2UZ6A 2XNTA 3PMZA 5J5IA 5LG3A 3WTJA 3RI5A 3RQUA 4NPPA 5IUXA 2XYTA 4B5DA 4COFA 4F8HA 2XQ5A 3EHZA 4UM3A 4ZJSA 3UU6A 2XQ8A 5BP0A 2BG9E 5J5GA 2WNJA 4UM1A 4PIRA 3WTOA 2BYRA 2YKSA 4EZ1A 1UX2A 5HEGA 2XQ6A 3PEOA 3UU4A 5AFMA 4HFHA 3EAMA 4HFDA 4ILAA 4A98A 4HFCA 5HEUA 4XHEA 4ZK1A 5J5FA 2WN9A 2BG9B 3U8LA 5CO5A 4ZZBA 2XNUA 4D01A 2X00D 4AFTA 4QH5A 5CFBA 5BRXA 1I9BA 4UM3S 3TLWA 4ZJTA 5BW2A 4ZRUA 3WTIA 3UU5A 3U8NA 5AFJA 4ALXA 2Y56A 2BG9A 5TVCA 2BYNA 5L4HA 4TWHA 4XK9A 2W8GA 2XZ5A 5HCJA 4UY2A 3UUBA 3ZDGA 5HEJA 4TWDA 4ZK4A 2ZJVA 2X00A 4QABA 2BG9C 2BYQA 4UM3P 3SQ6A 2Y58A 4QH4A 3WIPA 2BR8A 2BJ0A 3WTLA 2W8FA 4HFBA 4UXUA 3ZDHA 5AFKA 2WNLA 3ZKRA 3TLSA 4QH1A 3LSVA 5LXBA 4HFIA 3P4WA 4ZR6A 3UQ4A 4AFHA 4BFQA 3WTNA 2YMDA 2YOEA 3U8KA 1UV6A 4ILBA 5HCMA 3SQ9A 1UW6A 5AFLA 5J0ZA
chains in the Genus database with same CATH topology
3SH1A 2XZ6A 3JADA 3UU8A 2XQ7A 3UU3A 3WTKA 4TWFA 2Y7YA 3P50A 2XNVA 2BYSA 3SIOA 3TLUA 4ZZCA 5KZUA 2YMEA 2WNCA 4IL4A 5L47A 2BYPA 4BQTA 3U8JA 2QC1B 4NZBA 3RQWA 3RHWA 4QAAA 5L4EA 3GUAA 5AFHA 5AINA 2XQ9A 3UQ7A 5SYOA 4LMLA 3RIFA 3C84A 4DBMA 3WTHA 4IL9A 3RIAA 5AFMB 4HFEA 2Y54A 4A97A 4LMJA 4X5TA 2Y57A 3U8MA 3TLVA 2ZJUA 2WZYA 4TNVA 4AFGA 4Z91A 2YN6A 2XYSA 2XQAA 4HQPA 3WTMA 2PH9A 5HEOA 2VL0A 5FJVA 5J5HA 4FRRA 4WV9A 4IREA 5KE4A 3JAFA 2XQ3A 2PGZA 3IGQA 3T4MA 5JMEA 4QACA 2C9TA 4TNWA 3TLTA 4LMKA 4Z90A 3EI0A 3C79A 4ILCA 2XQ4A 5HEHA 2BR7A 3JAEA 5AFNA 2UZ6A 2XNTA 3PMZA 5J5IA 5LG3A 3WTJA 3RI5A 3RQUA 4NPPA 5IUXA 2XYTA 4B5DA 4COFA 4F8HA 2XQ5A 3EHZA 4UM3A 4ZJSA 3UU6A 2XQ8A 5BP0A 2BG9E 5J5GA 2WNJA 4UM1A 4PIRA 3WTOA 2BYRA 2YKSA 4EZ1A 1UX2A 5HEGA 2XQ6A 3PEOA 3UU4A 5AFMA 4HFHA 3EAMA 4HFDA 4ILAA 4A98A 4HFCA 5HEUA 4XHEA 4ZK1A 5J5FA 2WN9A 2BG9B 3U8LA 5CO5A 4ZZBA 2XNUA 4D01A 2X00D 4AFTA 4QH5A 5CFBA 5BRXA 1I9BA 4UM3S 3TLWA 4ZJTA 5BW2A 4ZRUA 3WTIA 3UU5A 3U8NA 5AFJA 4ALXA 2Y56A 2BG9A 5TVCA 2BYNA 5L4HA 4TWHA 4XK9A 2W8GA 2XZ5A 5HCJA 4UY2A 3UUBA 3ZDGA 5HEJA 4TWDA 4ZK4A 2ZJVA 2X00A 4QABA 2BG9C 2BYQA 4UM3P 3SQ6A 2Y58A 4QH4A 3WIPA 2BR8A 2BJ0A 3WTLA 2W8FA 4HFBA 4UXUA 3ZDHA 5AFKA 2WNLA 3ZKRA 3TLSA 4QH1A 3LSVA 5LXBA 4HFIA 3P4WA 4ZR6A 3UQ4A 4AFHA 4BFQA 3WTNA 2YMDA 2YOEA 3U8KA 1UV6A 4ILBA 5HCMA 3SQ9A 1UW6A 5AFLA 5J0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SH1 A;  2XZ6 A;  3JAD A;  3UU8 A;  2XQ7 A;  3UU3 A;  3WTK A;  4TWF A;  2Y7Y A;  3P50 A;  2XNV A;  2BYS A;  3SIO A;  3TLU A;  4ZZC A;  5KZU A;  2YME A;  2WNC A;  4IL4 A;  5L47 A;  2BYP A;  4BQT A;  3U8J A;  2QC1 B;  4NZB A;  3RQW A;  3RHW A;  4QAA A;  5L4E A;  3GUA A;  5AFH A;  5AIN A;  2XQ9 A;  3UQ7 A;  5SYO A;  4LML A;  3RIF A;  3C84 A;  4DBM A;  3WTH A;  4IL9 A;  3RIA A;  5AFM B;  4HFE A;  2Y54 A;  4A97 A;  4LMJ A;  4X5T A;  2Y57 A;  3U8M A;  3TLV A;  2ZJU A;  2WZY A;  4TNV A;  4AFG A;  4Z91 A;  2YN6 A;  2XYS A;  2XQA A;  4HQP A;  3WTM A;  2PH9 A;  5HEO A;  2VL0 A;  5FJV A;  5J5H A;  4FRR A;  4WV9 A;  4IRE A;  5KE4 A;  3JAF A;  2XQ3 A;  2PGZ A;  3IGQ A;  3T4M A;  5JME A;  4QAC A;  2C9T A;  4TNW A;  3TLT A;  4LMK A;  4Z90 A;  3EI0 A;  3C79 A;  4ILC A;  2XQ4 A;  5HEH A;  2BR7 A;  3JAE A;  5AFN A;  2UZ6 A;  2XNT A;  3PMZ A;  5J5I A;  5LG3 A;  3WTJ A;  3RI5 A;  3RQU A;  4NPP A;  5IUX A;  2XYT A;  4B5D A;  4COF A;  4F8H A;  2XQ5 A;  3EHZ A;  4UM3 A;  4ZJS A;  3UU6 A;  2XQ8 A;  5BP0 A;  2BG9 E;  5J5G A;  2WNJ A;  4UM1 A;  4PIR A;  3WTO A;  2BYR A;  2YKS A;  4EZ1 A;  1UX2 A;  5HEG A;  2XQ6 A;  3PEO A;  3UU4 A;  5AFM A;  4HFH A;  3EAM A;  4HFD A;  4ILA A;  4A98 A;  4HFC A;  5HEU A;  4XHE A;  4ZK1 A;  5J5F A;  2WN9 A;  2BG9 B;  3U8L A;  5CO5 A;  4ZZB A;  2XNU A;  4D01 A;  2X00 D;  4AFT A;  4QH5 A;  5CFB A;  5BRX A;  1I9B A;  4UM3 S;  3TLW A;  4ZJT A;  5BW2 A;  4ZRU A;  3WTI A;  3UU5 A;  3U8N A;  5AFJ A;  4ALX A;  2Y56 A;  2BG9 A;  5TVC A;  2BYN A;  5L4H A;  4TWH A;  4XK9 A;  2W8G A;  2XZ5 A;  5HCJ A;  4UY2 A;  3UUB A;  3ZDG A;  5HEJ A;  4TWD A;  4ZK4 A;  2ZJV A;  2X00 A;  4QAB A;  2BG9 C;  2BYQ A;  4UM3 P;  3SQ6 A;  2Y58 A;  4QH4 A;  3WIP A;  2BR8 A;  2BJ0 A;  3WTL A;  2W8F A;  4HFB A;  4UXU A;  3ZDH A;  5AFK A;  2WNL A;  3ZKR A;  3TLS A;  4QH1 A;  3LSV A;  5LXB A;  4HFI A;  3P4W A;  4ZR6 A;  3UQ4 A;  4AFH A;  4BFQ A;  3WTN A;  2YMD A;  2YOE A;  3U8K A;  1UV6 A;  4ILB A;  5HCM A;  3SQ9 A;  1UW6 A;  5AFL A;  5J0Z A; 
#chains in the Genus database with same CATH topology
 3SH1 A;  2XZ6 A;  3JAD A;  3UU8 A;  2XQ7 A;  3UU3 A;  3WTK A;  4TWF A;  2Y7Y A;  3P50 A;  2XNV A;  2BYS A;  3SIO A;  3TLU A;  4ZZC A;  5KZU A;  2YME A;  2WNC A;  4IL4 A;  5L47 A;  2BYP A;  4BQT A;  3U8J A;  2QC1 B;  4NZB A;  3RQW A;  3RHW A;  4QAA A;  5L4E A;  3GUA A;  5AFH A;  5AIN A;  2XQ9 A;  3UQ7 A;  5SYO A;  4LML A;  3RIF A;  3C84 A;  4DBM A;  3WTH A;  4IL9 A;  3RIA A;  5AFM B;  4HFE A;  2Y54 A;  4A97 A;  4LMJ A;  4X5T A;  2Y57 A;  3U8M A;  3TLV A;  2ZJU A;  2WZY A;  4TNV A;  4AFG A;  4Z91 A;  2YN6 A;  2XYS A;  2XQA A;  4HQP A;  3WTM A;  2PH9 A;  5HEO A;  2VL0 A;  5FJV A;  5J5H A;  4FRR A;  4WV9 A;  4IRE A;  5KE4 A;  3JAF A;  2XQ3 A;  2PGZ A;  3IGQ A;  3T4M A;  5JME A;  4QAC A;  2C9T A;  4TNW A;  3TLT A;  4LMK A;  4Z90 A;  3EI0 A;  3C79 A;  4ILC A;  2XQ4 A;  5HEH A;  2BR7 A;  3JAE A;  5AFN A;  2UZ6 A;  2XNT A;  3PMZ A;  5J5I A;  5LG3 A;  3WTJ A;  3RI5 A;  3RQU A;  4NPP A;  5IUX A;  2XYT A;  4B5D A;  4COF A;  4F8H A;  2XQ5 A;  3EHZ A;  4UM3 A;  4ZJS A;  3UU6 A;  2XQ8 A;  5BP0 A;  2BG9 E;  5J5G A;  2WNJ A;  4UM1 A;  4PIR A;  3WTO A;  2BYR A;  2YKS A;  4EZ1 A;  1UX2 A;  5HEG A;  2XQ6 A;  3PEO A;  3UU4 A;  5AFM A;  4HFH A;  3EAM A;  4HFD A;  4ILA A;  4A98 A;  4HFC A;  5HEU A;  4XHE A;  4ZK1 A;  5J5F A;  2WN9 A;  2BG9 B;  3U8L A;  5CO5 A;  4ZZB A;  2XNU A;  4D01 A;  2X00 D;  4AFT A;  4QH5 A;  5CFB A;  5BRX A;  1I9B A;  4UM3 S;  3TLW A;  4ZJT A;  5BW2 A;  4ZRU A;  3WTI A;  3UU5 A;  3U8N A;  5AFJ A;  4ALX A;  2Y56 A;  2BG9 A;  5TVC A;  2BYN A;  5L4H A;  4TWH A;  4XK9 A;  2W8G A;  2XZ5 A;  5HCJ A;  4UY2 A;  3UUB A;  3ZDG A;  5HEJ A;  4TWD A;  4ZK4 A;  2ZJV A;  2X00 A;  4QAB A;  2BG9 C;  2BYQ A;  4UM3 P;  3SQ6 A;  2Y58 A;  4QH4 A;  3WIP A;  2BR8 A;  2BJ0 A;  3WTL A;  2W8F A;  4HFB A;  4UXU A;  3ZDH A;  5AFK A;  2WNL A;  3ZKR A;  3TLS A;  4QH1 A;  3LSV A;  5LXB A;  4HFI A;  3P4W A;  4ZR6 A;  3UQ4 A;  4AFH A;  4BFQ A;  3WTN A;  2YMD A;  2YOE A;  3U8K A;  1UV6 A;  4ILB A;  5HCM A;  3SQ9 A;  1UW6 A;  5AFL A;  5J0Z A; 
#chains in the Genus database with same CATH homology
 3SH1 A;  2XZ6 A;  3JAD A;  3UU8 A;  2XQ7 A;  3UU3 A;  3WTK A;  4TWF A;  2Y7Y A;  3P50 A;  2XNV A;  2BYS A;  3SIO A;  3TLU A;  4ZZC A;  5KZU A;  2YME A;  2WNC A;  4IL4 A;  5L47 A;  2BYP A;  4BQT A;  3U8J A;  2QC1 B;  4NZB A;  3RQW A;  3RHW A;  4QAA A;  5L4E A;  3GUA A;  5AFH A;  5AIN A;  2XQ9 A;  3UQ7 A;  5SYO A;  4LML A;  3RIF A;  3C84 A;  4DBM A;  3WTH A;  4IL9 A;  3RIA A;  5AFM B;  4HFE A;  2Y54 A;  4A97 A;  4LMJ A;  4X5T A;  2Y57 A;  3U8M A;  3TLV A;  2ZJU A;  2WZY A;  4TNV A;  4AFG A;  4Z91 A;  2YN6 A;  2XYS A;  2XQA A;  4HQP A;  3WTM A;  2PH9 A;  5HEO A;  2VL0 A;  5FJV A;  5J5H A;  4FRR A;  4WV9 A;  4IRE A;  5KE4 A;  3JAF A;  2XQ3 A;  2PGZ A;  3IGQ A;  3T4M A;  5JME A;  4QAC A;  2C9T A;  4TNW A;  3TLT A;  4LMK A;  4Z90 A;  3EI0 A;  3C79 A;  4ILC A;  2XQ4 A;  5HEH A;  2BR7 A;  3JAE A;  5AFN A;  2UZ6 A;  2XNT A;  3PMZ A;  5J5I A;  5LG3 A;  3WTJ A;  3RI5 A;  3RQU A;  4NPP A;  5IUX A;  2XYT A;  4B5D A;  4COF A;  4F8H A;  2XQ5 A;  3EHZ A;  4UM3 A;  4ZJS A;  3UU6 A;  2XQ8 A;  5BP0 A;  2BG9 E;  5J5G A;  2WNJ A;  4UM1 A;  4PIR A;  3WTO A;  2BYR A;  2YKS A;  4EZ1 A;  1UX2 A;  5HEG A;  2XQ6 A;  3PEO A;  3UU4 A;  5AFM A;  4HFH A;  3EAM A;  4HFD A;  4ILA A;  4A98 A;  4HFC A;  5HEU A;  4XHE A;  4ZK1 A;  5J5F A;  2WN9 A;  2BG9 B;  3U8L A;  5CO5 A;  4ZZB A;  2XNU A;  4D01 A;  2X00 D;  4AFT A;  4QH5 A;  5CFB A;  5BRX A;  1I9B A;  4UM3 S;  3TLW A;  4ZJT A;  5BW2 A;  4ZRU A;  3WTI A;  3UU5 A;  3U8N A;  5AFJ A;  4ALX A;  2Y56 A;  2BG9 A;  5TVC A;  2BYN A;  5L4H A;  4TWH A;  4XK9 A;  2W8G A;  2XZ5 A;  5HCJ A;  4UY2 A;  3UUB A;  3ZDG A;  5HEJ A;  4TWD A;  4ZK4 A;  2ZJV A;  2X00 A;  4QAB A;  2BG9 C;  2BYQ A;  4UM3 P;  3SQ6 A;  2Y58 A;  4QH4 A;  3WIP A;  2BR8 A;  2BJ0 A;  3WTL A;  2W8F A;  4HFB A;  4UXU A;  3ZDH A;  5AFK A;  2WNL A;  3ZKR A;  3TLS A;  4QH1 A;  3LSV A;  5LXB A;  4HFI A;  3P4W A;  4ZR6 A;  3UQ4 A;  4AFH A;  4BFQ A;  3WTN A;  2YMD A;  2YOE A;  3U8K A;  1UV6 A;  4ILB A;  5HCM A;  3SQ9 A;  1UW6 A;  5AFL A;  5J0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...