5HEHA

Pentameric ligand-gated ion channel glic mutant p246a
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLAKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Signal Transduction at the Domain Interface of Prokaryotic Pentameric Ligand-Gated Ion Channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 85
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hehA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hehA01
3JAEA 3WTMA 4QACA 4D01A 4QH1A 2BG9E 4COFA 4QABA 2WNCA 2PH9A 2LKHA 4NPPA 5AFMB 1OEDC 3U8LA 5J5FA 5L4HA 3TLTA 3U8JA 5CO5A 4AFGA 3UQ7A 3U8NA 4Z90A 2BYPA 4ZRUA 5HEOA 2Y54A 4ZZBA 5AINA 2LKGA 3PEOA 4HFHA 1OEDE 2BYRA 2YMDA 3PMZA 3EHZA 4HFEA 3UU4A 3ZKRA 2WNLA 3RQWA 2XNUA 3EI0A 4ZR6A 3WTJA 2BG9C 3LSVA 2XZ5A 2WNJA 4X5TA 4LMJA 3RQUA 2BYQA 4BFQA 2XQ7A 2XNVA 3TLSA 4AFTA 4XK9A 2WZYA 5LG3A 2QC1B 3ZDHA 4LMKA 3P50A 3UUBA 3TLUA 4ILAA 1UV6A 2C9TA 4UM3P 5HEGA 2XQ6A 5J5HA 2Y7YA 1OEDB 2PGZA 3RHWA 3SH1A 2XQ3A 2BR7A 2UZ6A 3RI5A 3WTNA 5AFMA 3JAFA 2LLYA 4NZBA 2LM2A 3SQ9A 2BYNA 3JADA 1UX2A 5CFBA 4QH4A 5HEHA 2M6IA 4ZJSA 3U8KA 4ZK4A 5J5IA 4TWFA 4IL4A 2XZ6A 5SYOA 4XHEA 3WTKA 4TNVA 2BG9B 4PIRA 5AFJA 3GUAA 2VL0A 2KSRA 5J0ZA 2X00A 4HFIA 1I9BA 5FJVA 4ILBA 4BQTA 5AFLA 5AFHA 2XQAA 5IUXA 4IREA 4UY2A 5BRXA 4DBMA 3WTOA 4ZZCA 5HEUA 3T4MA 3U8MA 4IL9A 3WTIA 1UW6A 4ILCA 5BW2A 3UU8A 4A98A 2Y56A 2XQ4A 2MAWA 5J5GA 3UU5A 5HCMA 4HQPA 5L47A 3UU6A 4TWHA 4A97A 2XNTA 2XYTA 4ZJTA 4QH5A 5AFKA 4UM1A 2X00D 4QAAA 3TLWA 2W8FA 3IGQA 5LXBA 2YN6A 5HEJA 2XQ9A 4HFBA 2WN9A 3UU3A 2BG9A 2ZJUA 2Y57A 3C79A 5TVCA 5KZUA 5KE4A 5L4EA 3SIOA 4HFCA 5AFNA 3SQ6A 3ZDGA 4UM3S 2XQ5A 4Z91A 4ALXA 3WTHA 5JMEA 3RIAA 4WV9A 4AFHA 3C84A 5BP0A 2YKSA 3RIFA 4B5DA 3UQ4A 2W8GA 4HFDA 1OEDA 2XYSA 3P4WA 2ZJVA 4UM3A 2XQ8A 3TLVA 3WTLA 2Y58A 2M6BA 2YOEA 4UXUA 4ZK1A 2BYSA 4TWDA 4FRRA 2BJ0A 3WIPA 2YMEA 2BR8A 4F8HA 3EAMA 4TNWA 4LMLA 5HCJA 4EZ1A
chains in the Genus database with same CATH superfamily
5C3JA 3WTMA 2E2AA 2X67A 3HKEE 5FXWA 3CK6A 4O4IE 2MOZA 3LFMA 3HR0A 4DO0A 2LKGA 4HFHA 5EK2A 2ZLYA 3QC9A 3F31A 4WW0A 3PMZA 3UU4A 3AE8A 2X51A 2BG9C 1NWMX 2KWIB 2AE9A 3P4RA 1MIWA 3ESLA 3KV9A 4TV8E 2FJAA 4YJ3E 1DU2A 4IDNA 4WNKA 3G06A 1UX2A 4UV9B 5CFBA 4YTNA 2VVNA 4HGAA 4TNVA 4EV6A 1OXZA 3MXZA 5H6QB 1KNZA 4O2BE 2HPJA 4UV8B 2LRLA 4ASKA 5BRXA 5HEUA 1N34T 3T4MA 2XZEA 2RP4A 2CRBA 5L47A 2UXCT 4OK0A 2YINA 3KBUA 5HXRA 4KHZF 2WN9A 2IAKA 2L8KA 4KHPT 3H37A 4ALXA 3QB5A 3JCFA 3LJCA 4AKRB 1I94T 5JH7E 2HHHT 4F6RC 3NKZA 4JI4T 4PK5A 4O2AE 4U7IA 4OYJA 4CI2B 3ZMUB 4YTPA 1IJ6A 1VOMA 2GK9A 2WNCA 2K5BB 1YQ4A 5HEOA 4CN6A 1N33T 4HFVA 5LMNT 3WTJA 1LRZA 3AA0B 1KFYA 3RQUA 4BFQA 2X0LB 4AFTA 3FXDB 2FBWA 2QC1B 2NTYA 2N2NA 4ILAA 3C98B 2C9TA 4UM3P 4AKGA 4NZBA 2XAHB 3NWIA 2BYNA 5DJQC 3A7MA 3DP7A 3AEAA 4H9NC 2ZMAA 3LDQB 4JI2T 3NZPA 2A3DA 3EUHA 2R6GF 2X66A 3I0OA 2N1GA 3KDSE 1OWAA 4IREA 1ZOYA 3AXJB 1BR2A 4IL9A 1SHZC 2WZHA 2Y56A 4DIDB 4HQPA 2IW5B 3HKCE 3SFDA 2IUBA 2LOPA 3O4XE 4IDQA 3U78A 5CJ5A 2BS4A 4ANJA 3RC3A 3LBXB 5LP6E 2BZBA 4TZ4C 3KINB 4JI1T 2CXFA 4X20E 4DR6T 2XYSA 1AJ3A 1M62A 5JVDE 1B7TA 3K3OA 2X9YA 1E7PA 2YMEA 4F8HA 4CQIA 2FUPA 2YU1A 1EZ3A 4YFSA 5JR9C 5J5FA 5EZYE 3UFGA 3PUYF 4UIGA 4HWFA 5IWAT 4UELA 3MKDA 3N5LA 2XQ7A 4C91A 4U33A 4WBNE 1Z0PA 2K3WA 4EYUA 4LMKA 4J2CA 2CBJA 1VCSA 2Y7YA 2IMLA 2RPAA 4YTMA 4B3RT 3SS1A 5HEHA 1IBKT 3ZCIA 2KINB 4P1NA 4GKKT 4I0UA 4QXCB 2BDEA 4KP3C 5JTGA 2E5VA 1W0AA 3L8RA 2XAQB 4H63V 4I50E 3UU8A 3RRWA 5DQVA 3UFEA 2XNTA 1HG5A 2XTLA 3TLWA 4DR4T 4PK6A 4HFBA 4DR2T 2X0HA 3SQ6A 4A5XA 4CN4A 3PU8A 3QK6A 1HNXT 3QB5K 4WZXA 5HXCA 2LRKA 5LA6E 3ONJA 1D0ZA 3EDVA 4DBMA 2ZM0A 4AXPA 3UULA 1HCIA 3P4PA 3ABVA 2VK9A 4ISSA 2BYPA 2CMRA 3V5UA 4QX8B 2FJEA 2BKPA 2KNDA 2WS3A 3N2KE 3K3QC 3ZYLA 3LSVA 5AQSB 3FZKB 1J5ET 5FXXA 2KZ7B 2CE7A 3K1SA 3HL6A 3F57A 4EYYR 2W00A 3LBXA 3UTKA 4OHFA 3B57A 3PE0A 4WBOA 1YKHB 3OPCA 3PURA 3U8KA 3MZKB 2CA5A 1T8BA 3ZT6A 2CPTA 2BVMA 1WR6A 2VL0A 3RIUC 2E8IA 2WWVA 5IUXA 3AAIA 5L3CB 4IDPA 3OTOT 5L3GB 1UW6A 2EHOD 2QGSA 3ZMSB 4A98A 5FY0A 3BQIA 5JDNA 5HWYA 1HG2A 4A97A 2KWHA 2IIUA 3ZYKA 2LSYA 4Z91A 5CB4E 3OVUA 3Q2MA 3C84A 4N78D 3FZMB 4HEAA 2JRKA 3CVRA 5AQTB 1X9BA 4DUZT 2YOEA 4KX6A 3C4WA 4FRRA 1S35A 4MFRA 4M1PA 2P9BA 5ABHA 4YY3T 4QACA 3NRYA 3ZSSA 4COFA 4YSYA 5AQLB 2UXDT 3E08A 3ONLC 2CBIA 2VKJA 1L0VA 2WMNA 3HKBE 3RGLA 1JNRA 2NOXA 2XZ5A 1D1AA 2F4VT 2M67A 2W66A 3ZDHA 2V5CA 4U7YA 4QH4A 2XZ6A 3L09A 2MBGA 2I0MA 5JDHA 2DWKA 2NW8A 1GQEA 1YQ3A 2BS2A 5FL1A 1LKXA 2I59A 5AQVB 3FBZA 2V8SV 4U72A 4B6XA 4UM1A 2X68A 1D1CA 4GK0E 2KXPB 2LJLA 3VR8A 2MPKA 1KF6A 2J47A 4KUMB 4V1Av 2XPKA 5KE4A 4DNDA 2OLTA 2Q9QC 1W09A 4B5DA 3UQ4A 5F8PA 4HFDA 1UURA 2ZJVA 2Y58A 1HX1B 2BR8A 2DNXA 3AE5A 2VQFT 4TV9E 3VKHA 1WCRA 5LCYA 4OX9T 2VQET 4JBWF 4DVDA 2LSGA 2VURA 3N9OA 2V1DB 4YLHA 3U8JA 2V6XA 4IT4A 3IA3A 4ZZBA 2VKOA 3AA6B 3SWHA 5J2UE 4LF6T 2JMKA 4PFPA 4QXHB 5JDLA 3IEEA 3B5MA 3X1DA 3ZT7A 2Z6EA 2K48A 4X1YE 2XQ6A 4HE8A 2CLYC 3N2OA 3PUSA 4ILUA 1FEWA 3BQLA 2KT9A 4ZK4A 4XZCA 2YDSA 5SYOA 4JI0T 2XUEA 3IF8B 5AFJA 1IZNB 3FBLA 1ZEEA 5FJVA 4BAYB 4BJNA 5ABFA 1FJGT 2E9XC 3WTIA 3RX6A 4HTEA 4HWIB 2RA1A 2LE8A 4DUYT 3UU5A 1N32T 5DABA 3AECA 3RYHE 2XQYA 3KV4A 4QAAA 4DV1T 2ES0A 1XDPA 3WTHA 3L39A 3BQKA 2C5KT 2NWBA 3GN5A 2QA7A 5JDGA 2UUBT 3WTLA 3CQGB 2M6BA 4HKAA 2D0TA 3WIPA 5TAOA 3AEEA 2J4GA 2XHEB 1J1JA 3DTOA 4U74A 5HXSA 2PH9A 2PJQA 3U8LA 1IBMT 2UU9T 2VKHA 3UQ7A 4ZI3C 2NP9A 2Y54A 2XSAA 2WQYA 4JUYA 3LK2B 2NW9A 5LMUT 3EHZA 3R6NA 3KBTA 4CI3B 4ZR6A 4DR1T 1Z8UA 3TLSA 4JEUB 3W15B 5LG3A 1ZV4X 4KMCA 3Q5EA 3AE7A 1UGOA 1NAFA 3JADA 5BMVE 3KV5A 3PUXF 2LT3A 4OFZA 3J7Yq 3ANWA 4ZZCA 2HH7A 4PFOA 5L3BB 3CMLA 4ILCA 4EOZB 5HCMA 3O1HA 2XAFB 3K3NA 3UU6A 3T1YT 3AE1A 3ZCJA 3PDYA 1MMGA 2W8FA 2X9WA 3AVRA 2BG9A 3C79A 2LSJA 3UT5E 4CZZB 5JMEA 4WV9A 2W62A 3ZT5A 4ZI2C 5FXZA 2UUCT 5ADXL 1YD8G 2A9UA 4ZI7E 4UXUA 4H9QC 4JI5T 2L3LA 5HCJA 4K0KT 4AQYT 3VKGA 4QH1A 4D01A 2FJBA 3N2GE 4EZ4A 4I43B 4CXXA 4Z90A 4DV5T 5C2TA 2WNLA 5AQFB 2V5DA 3PJAJ 3SOLA 2XM2A 2VASA 2CEAA 3AEBA 1D1BA 2PGZA 3VRBA 4Q25A 5AFMA 1T98A 4TUYE 1O3XA 2BKOA 3MK7C 2LHRA 4IIJE 4ERRA 5AQGB 4L5GA 2JJ9A 3FB2A 1XNRT 1I9BA 5L3EB 1ZHCA 5KDMC 5FMNA 5BW2A 3NRXA 2AXDS 3AE3A 4JV5T 1SUMB 4LF7T 5EK3A 1X79A 2XYTA 3RYFE 4QH5A 2WMOA 3O1IA 4LFCT 3UU3A 3IHRA 4H9SE 3RIAA 1MNDA 2EHOB 1UUSA 2HN1A 2CXDA 3AEFA 2H7OA 4FJOA 4HWCA 4LFAT 4XBFB 1H7CA 1NENA 3PV0F 4P09A 1QUUA 3SFEA 4AQFC 1D0XA 5L3DB 2D2SA 3RKGA 3LK42 3ZYMA 2ACZA 3I9WA 1Y01A 4G2AA 3EVYA 4DR7T 2V26A 4MHCA 3VHLA 5AQRB 4Z8XA 3ZN1B 3JC6C 2IC9A 4HFEA 5AQHB 4EGWA 2DI4A 1G73A 5FP3A 4IE5A 3T8OA 2BBHA 4DBQA 2IC6A 4PAGA 1YXRA 3Q5XA 1OEDB 2UZ6A 1BR4A 4ZS3A 3E22E 3KVAA 2M6IA 5J5IA 4ZJSA 5F5WA 3AE9A 4JI7T 3WTKA 3J9X1 2QYWA 4JI3T 2CHNA 2VKDA 4EXTA 4UVCB 1MMNA 3MJXA 2CM0A 2XM1A 2DL1A 2H89A 4IE4A 2A2FX 2UXXB 4TWHA 4NIQA 1XWMA 5AFKA 1VRBA 3OJAA 1R8IA 3PUQA 3Q9DA 2QRXA 2XQ9A 1E1HB 4LF8T 4ZEYA 3RH3A 4YHJA 4E7SA 3DJBA 3AE4A 3P7IA 2YDRA 5LNKA 3PTRB 5AQOB 4DMVA 5HWXA 3UUXB 5KX5E 3ZJ1A 4PJNA 2WY2A 4PJMA 2X00D 3KVBA 1WLXA 2V7MA 1IJ5A 2PTFA 3AVSA 2LKHA 4OYKA 2OA5A 3Q5WA 5ETWA 4DV3T 3PEOA 2YMDA 2BBJA 4KI0F 4X5TA 5ABFB 4LMJA 2NTXA 4U2YA 2BKNA 4UR9A 4HWDA 2C5IT 4IDOA 3UUBA 3TLUA 4UF0B 5LJMA 4DV2T 2YEVC 2EHOA 3H3MA 3I1AA 3LK3B 2W63A 2BS3A 3GUAA 5J0ZA 4LFBT 2X00A 3I9YA 3WI3A 1XMOT 3WTOA 4NXNT 4X65T 5F3JA 2B1EA 3GN5B 2WDVA 4I4TE 2MAWA 1M7KA 4JI8T 1V9DA 3VR9A 3FXEB 3CX6B 2DHRA 2QVAA 5TVCA 3EABA 5JDQA 2LEHA 4X1IE 3S4UA 4IE7A 1OEDA 5AQJB 4JYAT 2DWGA 4ADZA 2DCFA 3UUMA 3PUZF 1WYCA 4YJ2E 2D5UA 4O4LE 4UVBB 4XAXB 1W9RA 3IBPA 3ZMVB 4NUVA 5AINA 3KV6A 5KMGP 2WDRA 3EI0A 3ANWB 5JRCA 2BYQA 1D0YA 4YSXA 2NR4A 3HI2A 2V7KA 3RHWA 1FMVA 3AB3B 2ACXA 2XQ3A 3SH1A 4X1KE 3WTNA 4UXNB 1IAPA 2FJDA 4GOUA 4AQGA 2E5LT 5AQQB 4TWFA 2KLQA 2DLRA 4DV0T 2BG9B 2W67A 1VCTA 2IDOB 4YT0A 5LHGB 4NXMT 5HAXA 4CXWA 3MACA 2LSKA 3B13A 1N36T 5M4YA 4HN9A 4NUUA 4ZJTA 1U4QA 1CHUA 3OYZA 2A72A 4ZS2A 2LM9A 3AA1B 4LF4T 1Y64B 2YN6A 3FZFB 5FKYA 4LF5T 1QLBA 2Y57A 1JNZA 1E2AA 3UUNA 3ZDGA 1SA0E 2Q9QD 4AISA 4ZOLE 3OBVE 4UF0A 3ZLIA 3RYCE 2VB6A 3KFWX 2UXNB 2BVLA 4LMLA 3JAEA 4JEHB 5BR8T 2XY8B 2BG9E 3CPZA 5AFMB 3WAKA 2I6HA 4QKNA 2JQHA 4TN7B 2WDQA 2W61A 4PK4A 2BYRA 2XNUA 3CX7B 3EDUA 2X0YA 5AQPB 5LBQB 3PU3A 5FY7A 3P50A 5EK4A 5C8YE 2MYSA 2W2UA 5J5HA 2ZM8A 2Q9QA 3QNUA 3C51A 3U3IA 2Y6XA 2YDQA 4EAHA 3MA9A 2WB5A 1HFAA 5IYZE 3QOFA 3RRCA 1J5WA 1LVKA 2XQAA 4A56A 4UY2A 5CGMA 1BR0A 2E9XD 5FVLA 2C0SA 4H9PC 4O4JE 3P4QA 5LHHB 4X64T 3M65A 3T1HT 3IGQA 5HEJA 4L0RA 3CQCB 3N9QA 3Q5DA 4IGUA 2D0UA 3RIFA 5HXHA 2W8GA 3GA8A 2XAJB 3H3AA 4X62T 2CCQA 4QWNB 4ZK1A 4GIWA 4DR5T 3EAMA 4TNWA 4YHHT 3C50A 2YU2A 2E9XA 3C4ZA 3TLTA 4KBMB 1XDOA 1MNEA 4ZI3D 1MMAA 2V6YB 1HNZT 2KMFA 3ZKRA 2XSBA 2JQ9A 2CHOA 2UXBT 1KEYA 2H88A 2OV9A 2XNVA 2LHNA 1YKEB 2LSIA 1UV6A 2Y8DA 5AFUL 1FIOA 5AQKB 5JR9B 2BR7A 3RI5A 3ONXA 3JAFA 2H3RA 3QUJA 1ZP0A 2J1DG 1HS7A 1SE7A 1UK5A 1UX5A 5ABGA 4IL4A 1LVFA 4CN1A 4DMWA 5A1LA 3PUWF 4PW8A 5AFHA 3NVOA 3AE2A 2PFVA 4GK5E 2CWOA 4IDZA 5DQWA 2C5JA 4YSZA 2XQ4A 4LF9T 4H63H 1MMDA 1KNPA 5JDFA 4DBRA 3M3ZB 4L9IA 3RC8A 5LXBA 2ZM2A 3AEGA 2CWYA 3ZSTA 3PJAA 3RF1A 2LOSA 4GYRA 4U3CA 4ZXLA 5L4EA 5LGNB 2XQ5A 3ZC1A 2YKSA 4ZI2D 5AQIB 3E0ZA 2ODVA 2XAGB 5LGUB 4UM3A 4AI6A 4TWDA 5J1GA 4YXDA 4EZ1A 5FY1A 5LJNA 4AKHA 1HTJF 2XASB 3HA4A 3AAAB 4BA9A 3CKDA 3ZJ2A 4C90A 3FZLB 4QABA 5GONE 2V7IA 2WU5A 4MLKA 3CX8B 2SPCA 4EEBA 3A5XA 4X66T 5CO5A 3U8NA 1CUNA 5CA0E 1WYBA 3N9PA 3N9MA 3RLFF 1HNWT 3CQXC 1G8XA 2WCAA 2WNJA 2D9DA 3N9LA 3HKDE 4XK9A 3L3PA 1XMQT 1W0BA 3R84B 3ETVA 5LG4A 2LLYA 5JQGE 3SQ9A 1S94A 3RKOA 4TX5A 2X9HA 4G63A 1XZYA 2NW7A 2YK0A 4GYSA 3O9XA 4WYVA 4BQTA 5HYAA 1T7SA 5LBMA 1U5PA 3ZMTB 2EHOC 1US7B 2HN2A 4O8SA 2PBIA 3N9NA 2XJ7A 2WWUA 1FMWA 2V6YA 4PNIA 5KXJA 3A8YC 3SRZA 2V7JA 4HFCA 5AFNA 5CA1E 4E7ZA 3GMIA 3CIRA 2WAUA 1WFDA 1WR0A 3AXJA 1BR1A 5JR9A 4MBQA 2XQ8A 3C64A 3TLVA 3NBXX 5JDMA 5L3FB 5FNVE 4K0UA 2JMHA 5JRCB 2BJ0A 2H7VC 5LHIB 5LB7B 3V5SA 4B3TT 5LGTB 1OEDC 5J2TE 1I6ZA 4AFGA 3PUGA 4QX7B 4ZRUA 3D0TA 2L9QA 3ZEFB 4MALA 4H9OC 1OEDE 3NZQA 2UUAT 3JC6D 1KNRA 5ABEA 1QSDA 2J62A 1YW0A 2W0GA 4EZHA 1IBLT 5AQMB 2G0UA 4IE6A 2X9XA 3AE6A 2K24A 5AQUB 3AAEB 4QXBB 4P0BA 5AQNB 1XNQT 1MIYA 4AKLA 4AQFA 4PIRA 2KSRA 4GKJT 4HFIA 5FL0A 4P0AA 3RPUA 5LYJE 3ZC0A 4HWHA 2VWAA 5FYMA 2WP9A 2PG8A 3GWHA 4BJMA 3P4SA 4QHOA 4CXYA 2ZJUA 2JIWA 2VL8A 3K8PC 4UM3S 2JQQA 4UEMA 4JI6T 4U2ZA 5BP0A 3VRAA 1KK7A 4H9RC 3ZMZB 4DV4T 4IE0A 3FHNA 2JPFA 2WU2A 2WZIA 1HF8A 4DV7T 4UVAB 4JLEA 5FXVA 4PJJA 1UCUA 2Q9QB 4NPPA 2VVSA 5L4HA 2W4XA 3OKQA 2N9DA 2IHR1 4AKIA 4EB6E 3RQWA 5L2LA 1WRDA 2ZM6T 4O4HE 4FI5A 1ZKEA 4U31A 2WZYA 3RIUA 4IHJE 2V7LA 3AA7B 4B3ST 5HEGA 3CWZB 3F2EA 3BK9A 2LM2A 1HR0T 1T72A 4DV6T 5HXEA 5JREA 4CI1B 3O1JA 4ZHQE 3VU7H 2HPLA 3PUAA 4ILBA 5AFLA 3ZN0B 5LOVE 3OYXA 2WSSV 4PJLA 3RYIE 3TKLB 3C4XA 2B76A 3U8MA 3LG7A 4ISTA 2CLYB 4EEDA 3ETUA 5J5GA 5H6RB 3I0QA 2JQKA 2K9AA 2MTQA 5LXTE 2ODUA 3AEDA 3WAJA 3ZPOA 5KZUA 4EIWA 3SIOA 3PUVF 4I55E 1MIVA 2E9XB 2CXLA 2WBLA 5IHYA 4AIUA 4AFHA 4B3MT 2WM9A 3P8CD 1UX4A 3FZHB 2Y48B 3P4WA 1NEKA 1HX8A 2BYSA 4DR3T 5E0OA 4XHEA 5FVKA
chains in the Genus database with same CATH topology
3JAEA 3WTMA 4QACA 4D01A 4QH1A 2BG9E 4COFA 4QABA 2WNCA 2PH9A 2LKHA 4NPPA 5AFMB 1OEDC 3U8LA 5J5FA 5L4HA 3TLTA 3U8JA 5CO5A 4AFGA 3UQ7A 3U8NA 4Z90A 2BYPA 4ZRUA 5HEOA 2Y54A 4ZZBA 5AINA 2LKGA 3PEOA 4HFHA 1OEDE 2BYRA 2YMDA 3PMZA 3EHZA 4HFEA 3UU4A 3ZKRA 2WNLA 3RQWA 2XNUA 3EI0A 4ZR6A 3WTJA 2BG9C 3LSVA 2XZ5A 2WNJA 4X5TA 4LMJA 3RQUA 2BYQA 4BFQA 2XQ7A 2XNVA 3TLSA 4AFTA 4XK9A 2WZYA 5LG3A 2QC1B 3ZDHA 4LMKA 3P50A 3UUBA 3TLUA 4ILAA 1UV6A 2C9TA 4UM3P 5HEGA 2XQ6A 5J5HA 2Y7YA 1OEDB 2PGZA 3RHWA 3SH1A 2XQ3A 2BR7A 2UZ6A 3RI5A 3WTNA 5AFMA 3JAFA 2LLYA 4NZBA 2LM2A 3SQ9A 2BYNA 3JADA 1UX2A 5CFBA 4QH4A 5HEHA 2M6IA 4ZJSA 3U8KA 4ZK4A 5J5IA 4TWFA 4IL4A 2XZ6A 5SYOA 4XHEA 3WTKA 4TNVA 2BG9B 4PIRA 5AFJA 3GUAA 2VL0A 2KSRA 5J0ZA 2X00A 4HFIA 1I9BA 5FJVA 4ILBA 4BQTA 5AFLA 5AFHA 2XQAA 5IUXA 4IREA 4UY2A 5BRXA 4DBMA 3WTOA 4ZZCA 5HEUA 3T4MA 3U8MA 4IL9A 3WTIA 1UW6A 4ILCA 5BW2A 3UU8A 4A98A 2Y56A 2XQ4A 2MAWA 5J5GA 3UU5A 5HCMA 4HQPA 5L47A 3UU6A 4TWHA 4A97A 2XNTA 2XYTA 4ZJTA 4QH5A 5AFKA 4UM1A 2X00D 4QAAA 3TLWA 2W8FA 3IGQA 5LXBA 2YN6A 5HEJA 2XQ9A 4HFBA 2WN9A 3UU3A 2BG9A 2ZJUA 2Y57A 3C79A 5TVCA 5KZUA 5KE4A 5L4EA 3SIOA 4HFCA 5AFNA 3SQ6A 3ZDGA 4UM3S 2XQ5A 4Z91A 4ALXA 3WTHA 5JMEA 3RIAA 4WV9A 4AFHA 3C84A 5BP0A 2YKSA 3RIFA 4B5DA 3UQ4A 2W8GA 4HFDA 1OEDA 2XYSA 3P4WA 2ZJVA 4UM3A 2XQ8A 3TLVA 3WTLA 2Y58A 2M6BA 2YOEA 4UXUA 4ZK1A 2BYSA 4TWDA 4FRRA 2BJ0A 3WIPA 2YMEA 2BR8A 4F8HA 3EAMA 4TNWA 4LMLA 5HCJA 4EZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAE A;  3WTM A;  4QAC A;  4D01 A;  4QH1 A;  2BG9 E;  4COF A;  4QAB A;  2WNC A;  2PH9 A;  2LKH A;  4NPP A;  5AFM B;  1OED C;  3U8L A;  5J5F A;  5L4H A;  3TLT A;  3U8J A;  5CO5 A;  4AFG A;  3UQ7 A;  3U8N A;  4Z90 A;  2BYP A;  4ZRU A;  5HEO A;  2Y54 A;  4ZZB A;  5AIN A;  2LKG A;  3PEO A;  4HFH A;  1OED E;  2BYR A;  2YMD A;  3PMZ A;  3EHZ A;  4HFE A;  3UU4 A;  3ZKR A;  2WNL A;  3RQW A;  2XNU A;  3EI0 A;  4ZR6 A;  3WTJ A;  2BG9 C;  3LSV A;  2XZ5 A;  2WNJ A;  4X5T A;  4LMJ A;  3RQU A;  2BYQ A;  4BFQ A;  2XQ7 A;  2XNV A;  3TLS A;  4AFT A;  4XK9 A;  2WZY A;  5LG3 A;  2QC1 B;  3ZDH A;  4LMK A;  3P50 A;  3UUB A;  3TLU A;  4ILA A;  1UV6 A;  2C9T A;  4UM3 P;  5HEG A;  2XQ6 A;  5J5H A;  2Y7Y A;  1OED B;  2PGZ A;  3RHW A;  3SH1 A;  2XQ3 A;  2BR7 A;  2UZ6 A;  3RI5 A;  3WTN A;  5AFM A;  3JAF A;  2LLY A;  4NZB A;  2LM2 A;  3SQ9 A;  2BYN A;  3JAD A;  1UX2 A;  5CFB A;  4QH4 A;  5HEH A;  2M6I A;  4ZJS A;  3U8K A;  4ZK4 A;  5J5I A;  4TWF A;  4IL4 A;  2XZ6 A;  5SYO A;  4XHE A;  3WTK A;  4TNV A;  2BG9 B;  4PIR A;  5AFJ A;  3GUA A;  2VL0 A;  2KSR A;  5J0Z A;  2X00 A;  4HFI A;  1I9B A;  5FJV A;  4ILB A;  4BQT A;  5AFL A;  5AFH A;  2XQA A;  5IUX A;  4IRE A;  4UY2 A;  5BRX A;  4DBM A;  3WTO A;  4ZZC A;  5HEU A;  3T4M A;  3U8M A;  4IL9 A;  3WTI A;  1UW6 A;  4ILC A;  5BW2 A;  3UU8 A;  4A98 A;  2Y56 A;  2XQ4 A;  2MAW A;  5J5G A;  3UU5 A;  5HCM A;  4HQP A;  5L47 A;  3UU6 A;  4TWH A;  4A97 A;  2XNT A;  2XYT A;  4ZJT A;  4QH5 A;  5AFK A;  4UM1 A;  2X00 D;  4QAA A;  3TLW A;  2W8F A;  3IGQ A;  5LXB A;  2YN6 A;  5HEJ A;  2XQ9 A;  4HFB A;  2WN9 A;  3UU3 A;  2BG9 A;  2ZJU A;  2Y57 A;  3C79 A;  5TVC A;  5KZU A;  5KE4 A;  5L4E A;  3SIO A;  4HFC A;  5AFN A;  3SQ6 A;  3ZDG A;  4UM3 S;  2XQ5 A;  4Z91 A;  4ALX A;  3WTH A;  5JME A;  3RIA A;  4WV9 A;  4AFH A;  3C84 A;  5BP0 A;  2YKS A;  3RIF A;  4B5D A;  3UQ4 A;  2W8G A;  4HFD A;  1OED A;  2XYS A;  3P4W A;  2ZJV A;  4UM3 A;  2XQ8 A;  3TLV A;  3WTL A;  2Y58 A;  2M6B A;  2YOE A;  4UXU A;  4ZK1 A;  2BYS A;  4TWD A;  4FRR A;  2BJ0 A;  3WIP A;  2YME A;  2BR8 A;  4F8H A;  3EAM A;  4TNW A;  4LML A;  5HCJ A;  4EZ1 A; 
#chains in the Genus database with same CATH topology
 5C3J A;  3WTM A;  2E2A A;  2X67 A;  3HKE E;  5FXW A;  3CK6 A;  4O4I E;  2MOZ A;  3LFM A;  3HR0 A;  4DO0 A;  2LKG A;  4HFH A;  5EK2 A;  2ZLY A;  3QC9 A;  3F31 A;  4WW0 A;  3PMZ A;  3UU4 A;  3AE8 A;  2X51 A;  2BG9 C;  1NWM X;  2KWI B;  2AE9 A;  3P4R A;  1MIW A;  3ESL A;  3KV9 A;  4TV8 E;  2FJA A;  4YJ3 E;  1DU2 A;  4IDN A;  4WNK A;  3G06 A;  1UX2 A;  4UV9 B;  5CFB A;  4YTN A;  2VVN A;  4HGA A;  4TNV A;  4EV6 A;  1OXZ A;  3MXZ A;  5H6Q B;  1KNZ A;  4O2B E;  2HPJ A;  4UV8 B;  2LRL A;  4ASK A;  5BRX A;  5HEU A;  1N34 T;  3T4M A;  2XZE A;  2RP4 A;  2CRB A;  5L47 A;  2UXC T;  4OK0 A;  2YIN A;  3KBU A;  5HXR A;  4KHZ F;  2WN9 A;  2IAK A;  2L8K A;  4KHP T;  3H37 A;  4ALX A;  3QB5 A;  3JCF A;  3LJC A;  4AKR B;  1I94 T;  5JH7 E;  2HHH T;  4F6R C;  3NKZ A;  4JI4 T;  4PK5 A;  4O2A E;  4U7I A;  4OYJ A;  4CI2 B;  3ZMU B;  4YTP A;  1IJ6 A;  1VOM A;  2GK9 A;  2WNC A;  2K5B B;  1YQ4 A;  5HEO A;  4CN6 A;  1N33 T;  4HFV A;  5LMN T;  3WTJ A;  1LRZ A;  3AA0 B;  1KFY A;  3RQU A;  4BFQ A;  2X0L B;  4AFT A;  3FXD B;  2FBW A;  2QC1 B;  2NTY A;  2N2N A;  4ILA A;  3C98 B;  2C9T A;  4UM3 P;  4AKG A;  4NZB A;  2XAH B;  3NWI A;  2BYN A;  5DJQ C;  3A7M A;  3DP7 A;  3AEA A;  4H9N C;  2ZMA A;  3LDQ B;  4JI2 T;  3NZP A;  2A3D A;  3EUH A;  2R6G F;  2X66 A;  3I0O A;  2N1G A;  3KDS E;  1OWA A;  4IRE A;  1ZOY A;  3AXJ B;  1BR2 A;  4IL9 A;  1SHZ C;  2WZH A;  2Y56 A;  4DID B;  4HQP A;  2IW5 B;  3HKC E;  3SFD A;  2IUB A;  2LOP A;  3O4X E;  4IDQ A;  3U78 A;  5CJ5 A;  2BS4 A;  4ANJ A;  3RC3 A;  3LBX B;  5LP6 E;  2BZB A;  4TZ4 C;  3KIN B;  4JI1 T;  2CXF A;  4X20 E;  4DR6 T;  2XYS A;  1AJ3 A;  1M62 A;  5JVD E;  1B7T A;  3K3O A;  2X9Y A;  1E7P A;  2YME A;  4F8H A;  4CQI A;  2FUP A;  2YU1 A;  1EZ3 A;  4YFS A;  5JR9 C;  5J5F A;  5EZY E;  3UFG A;  3PUY F;  4UIG A;  4HWF A;  5IWA T;  4UEL A;  3MKD A;  3N5L A;  2XQ7 A;  4C91 A;  4U33 A;  4WBN E;  1Z0P A;  2K3W A;  4EYU A;  4LMK A;  4J2C A;  2CBJ A;  1VCS A;  2Y7Y A;  2IML A;  2RPA A;  4YTM A;  4B3R T;  3SS1 A;  5HEH A;  1IBK T;  3ZCI A;  2KIN B;  4P1N A;  4GKK T;  4I0U A;  4QXC B;  2BDE A;  4KP3 C;  5JTG A;  2E5V A;  1W0A A;  3L8R A;  2XAQ B;  4H63 V;  4I50 E;  3UU8 A;  3RRW A;  5DQV A;  3UFE A;  2XNT A;  1HG5 A;  2XTL A;  3TLW A;  4DR4 T;  4PK6 A;  4HFB A;  4DR2 T;  2X0H A;  3SQ6 A;  4A5X A;  4CN4 A;  3PU8 A;  3QK6 A;  1HNX T;  3QB5 K;  4WZX A;  5HXC A;  2LRK A;  5LA6 E;  3ONJ A;  1D0Z A;  3EDV A;  4DBM A;  2ZM0 A;  4AXP A;  3UUL A;  1HCI A;  3P4P A;  3ABV A;  2VK9 A;  4ISS A;  2BYP A;  2CMR A;  3V5U A;  4QX8 B;  2FJE A;  2BKP A;  2KND A;  2WS3 A;  3N2K E;  3K3Q C;  3ZYL A;  3LSV A;  5AQS B;  3FZK B;  1J5E T;  5FXX A;  2KZ7 B;  2CE7 A;  3K1S A;  3HL6 A;  3F57 A;  4EYY R;  2W00 A;  3LBX A;  3UTK A;  4OHF A;  3B57 A;  3PE0 A;  4WBO A;  1YKH B;  3OPC A;  3PUR A;  3U8K A;  3MZK B;  2CA5 A;  1T8B A;  3ZT6 A;  2CPT A;  2BVM A;  1WR6 A;  2VL0 A;  3RIU C;  2E8I A;  2WWV A;  5IUX A;  3AAI A;  5L3C B;  4IDP A;  3OTO T;  5L3G B;  1UW6 A;  2EHO D;  2QGS A;  3ZMS B;  4A98 A;  5FY0 A;  3BQI A;  5JDN A;  5HWY A;  1HG2 A;  4A97 A;  2KWH A;  2IIU A;  3ZYK A;  2LSY A;  4Z91 A;  5CB4 E;  3OVU A;  3Q2M A;  3C84 A;  4N78 D;  3FZM B;  4HEA A;  2JRK A;  3CVR A;  5AQT B;  1X9B A;  4DUZ T;  2YOE A;  4KX6 A;  3C4W A;  4FRR A;  1S35 A;  4MFR A;  4M1P A;  2P9B A;  5ABH A;  4YY3 T;  4QAC A;  3NRY A;  3ZSS A;  4COF A;  4YSY A;  5AQL B;  2UXD T;  3E08 A;  3ONL C;  2CBI A;  2VKJ A;  1L0V A;  2WMN A;  3HKB E;  3RGL A;  1JNR A;  2NOX A;  2XZ5 A;  1D1A A;  2F4V T;  2M67 A;  2W66 A;  3ZDH A;  2V5C A;  4U7Y A;  4QH4 A;  2XZ6 A;  3L09 A;  2MBG A;  2I0M A;  5JDH A;  2DWK A;  2NW8 A;  1GQE A;  1YQ3 A;  2BS2 A;  5FL1 A;  1LKX A;  2I59 A;  5AQV B;  3FBZ A;  2V8S V;  4U72 A;  4B6X A;  4UM1 A;  2X68 A;  1D1C A;  4GK0 E;  2KXP B;  2LJL A;  3VR8 A;  2MPK A;  1KF6 A;  2J47 A;  4KUM B;  4V1A v;  2XPK A;  5KE4 A;  4DND A;  2OLT A;  2Q9Q C;  1W09 A;  4B5D A;  3UQ4 A;  5F8P A;  4HFD A;  1UUR A;  2ZJV A;  2Y58 A;  1HX1 B;  2BR8 A;  2DNX A;  3AE5 A;  2VQF T;  4TV9 E;  3VKH A;  1WCR A;  5LCY A;  4OX9 T;  2VQE T;  4JBW F;  4DVD A;  2LSG A;  2VUR A;  3N9O A;  2V1D B;  4YLH A;  3U8J A;  2V6X A;  4IT4 A;  3IA3 A;  4ZZB A;  2VKO A;  3AA6 B;  3SWH A;  5J2U E;  4LF6 T;  2JMK A;  4PFP A;  4QXH B;  5JDL A;  3IEE A;  3B5M A;  3X1D A;  3ZT7 A;  2Z6E A;  2K48 A;  4X1Y E;  2XQ6 A;  4HE8 A;  2CLY C;  3N2O A;  3PUS A;  4ILU A;  1FEW A;  3BQL A;  2KT9 A;  4ZK4 A;  4XZC A;  2YDS A;  5SYO A;  4JI0 T;  2XUE A;  3IF8 B;  5AFJ A;  1IZN B;  3FBL A;  1ZEE A;  5FJV A;  4BAY B;  4BJN A;  5ABF A;  1FJG T;  2E9X C;  3WTI A;  3RX6 A;  4HTE A;  4HWI B;  2RA1 A;  2LE8 A;  4DUY T;  3UU5 A;  1N32 T;  5DAB A;  3AEC A;  3RYH E;  2XQY A;  3KV4 A;  4QAA A;  4DV1 T;  2ES0 A;  1XDP A;  3WTH A;  3L39 A;  3BQK A;  2C5K T;  2NWB A;  3GN5 A;  2QA7 A;  5JDG A;  2UUB T;  3WTL A;  3CQG B;  2M6B A;  4HKA A;  2D0T A;  3WIP A;  5TAO A;  3AEE A;  2J4G A;  2XHE B;  1J1J A;  3DTO A;  4U74 A;  5HXS A;  2PH9 A;  2PJQ A;  3U8L A;  1IBM T;  2UU9 T;  2VKH A;  3UQ7 A;  4ZI3 C;  2NP9 A;  2Y54 A;  2XSA A;  2WQY A;  4JUY A;  3LK2 B;  2NW9 A;  5LMU T;  3EHZ A;  3R6N A;  3KBT A;  4CI3 B;  4ZR6 A;  4DR1 T;  1Z8U A;  3TLS A;  4JEU B;  3W15 B;  5LG3 A;  1ZV4 X;  4KMC A;  3Q5E A;  3AE7 A;  1UGO A;  1NAF A;  3JAD A;  5BMV E;  3KV5 A;  3PUX F;  2LT3 A;  4OFZ A;  3J7Y q;  3ANW A;  4ZZC A;  2HH7 A;  4PFO A;  5L3B B;  3CML A;  4ILC A;  4EOZ B;  5HCM A;  3O1H A;  2XAF B;  3K3N A;  3UU6 A;  3T1Y T;  3AE1 A;  3ZCJ A;  3PDY A;  1MMG A;  2W8F A;  2X9W A;  3AVR A;  2BG9 A;  3C79 A;  2LSJ A;  3UT5 E;  4CZZ B;  5JME A;  4WV9 A;  2W62 A;  3ZT5 A;  4ZI2 C;  5FXZ A;  2UUC T;  5ADX L;  1YD8 G;  2A9U A;  4ZI7 E;  4UXU A;  4H9Q C;  4JI5 T;  2L3L A;  5HCJ A;  4K0K T;  4AQY T;  3VKG A;  4QH1 A;  4D01 A;  2FJB A;  3N2G E;  4EZ4 A;  4I43 B;  4CXX A;  4Z90 A;  4DV5 T;  5C2T A;  2WNL A;  5AQF B;  2V5D A;  3PJA J;  3SOL A;  2XM2 A;  2VAS A;  2CEA A;  3AEB A;  1D1B A;  2PGZ A;  3VRB A;  4Q25 A;  5AFM A;  1T98 A;  4TUY E;  1O3X A;  2BKO A;  3MK7 C;  2LHR A;  4IIJ E;  4ERR A;  5AQG B;  4L5G A;  2JJ9 A;  3FB2 A;  1XNR T;  1I9B A;  5L3E B;  1ZHC A;  5KDM C;  5FMN A;  5BW2 A;  3NRX A;  2AXD S;  3AE3 A;  4JV5 T;  1SUM B;  4LF7 T;  5EK3 A;  1X79 A;  2XYT A;  3RYF E;  4QH5 A;  2WMO A;  3O1I A;  4LFC T;  3UU3 A;  3IHR A;  4H9S E;  3RIA A;  1MND A;  2EHO B;  1UUS A;  2HN1 A;  2CXD A;  3AEF A;  2H7O A;  4FJO A;  4HWC A;  4LFA T;  4XBF B;  1H7C A;  1NEN A;  3PV0 F;  4P09 A;  1QUU A;  3SFE A;  4AQF C;  1D0X A;  5L3D B;  2D2S A;  3RKG A;  3LK4 2;  3ZYM A;  2ACZ A;  3I9W A;  1Y01 A;  4G2A A;  3EVY A;  4DR7 T;  2V26 A;  4MHC A;  3VHL A;  5AQR B;  4Z8X A;  3ZN1 B;  3JC6 C;  2IC9 A;  4HFE A;  5AQH B;  4EGW A;  2DI4 A;  1G73 A;  5FP3 A;  4IE5 A;  3T8O A;  2BBH A;  4DBQ A;  2IC6 A;  4PAG A;  1YXR A;  3Q5X A;  1OED B;  2UZ6 A;  1BR4 A;  4ZS3 A;  3E22 E;  3KVA A;  2M6I A;  5J5I A;  4ZJS A;  5F5W A;  3AE9 A;  4JI7 T;  3WTK A;  3J9X 1;  2QYW A;  4JI3 T;  2CHN A;  2VKD A;  4EXT A;  4UVC B;  1MMN A;  3MJX A;  2CM0 A;  2XM1 A;  2DL1 A;  2H89 A;  4IE4 A;  2A2F X;  2UXX B;  4TWH A;  4NIQ A;  1XWM A;  5AFK A;  1VRB A;  3OJA A;  1R8I A;  3PUQ A;  3Q9D A;  2QRX A;  2XQ9 A;  1E1H B;  4LF8 T;  4ZEY A;  3RH3 A;  4YHJ A;  4E7S A;  3DJB A;  3AE4 A;  3P7I A;  2YDR A;  5LNK A;  3PTR B;  5AQO B;  4DMV A;  5HWX A;  3UUX B;  5KX5 E;  3ZJ1 A;  4PJN A;  2WY2 A;  4PJM A;  2X00 D;  3KVB A;  1WLX A;  2V7M A;  1IJ5 A;  2PTF A;  3AVS A;  2LKH A;  4OYK A;  2OA5 A;  3Q5W A;  5ETW A;  4DV3 T;  3PEO A;  2YMD A;  2BBJ A;  4KI0 F;  4X5T A;  5ABF B;  4LMJ A;  2NTX A;  4U2Y A;  2BKN A;  4UR9 A;  4HWD A;  2C5I T;  4IDO A;  3UUB A;  3TLU A;  4UF0 B;  5LJM A;  4DV2 T;  2YEV C;  2EHO A;  3H3M A;  3I1A A;  3LK3 B;  2W63 A;  2BS3 A;  3GUA A;  5J0Z A;  4LFB T;  2X00 A;  3I9Y A;  3WI3 A;  1XMO T;  3WTO A;  4NXN T;  4X65 T;  5F3J A;  2B1E A;  3GN5 B;  2WDV A;  4I4T E;  2MAW A;  1M7K A;  4JI8 T;  1V9D A;  3VR9 A;  3FXE B;  3CX6 B;  2DHR A;  2QVA A;  5TVC A;  3EAB A;  5JDQ A;  2LEH A;  4X1I E;  3S4U A;  4IE7 A;  1OED A;  5AQJ B;  4JYA T;  2DWG A;  4ADZ A;  2DCF A;  3UUM A;  3PUZ F;  1WYC A;  4YJ2 E;  2D5U A;  4O4L E;  4UVB B;  4XAX B;  1W9R A;  3IBP A;  3ZMV B;  4NUV A;  5AIN A;  3KV6 A;  5KMG P;  2WDR A;  3EI0 A;  3ANW B;  5JRC A;  2BYQ A;  1D0Y A;  4YSX A;  2NR4 A;  3HI2 A;  2V7K A;  3RHW A;  1FMV A;  3AB3 B;  2ACX A;  2XQ3 A;  3SH1 A;  4X1K E;  3WTN A;  4UXN B;  1IAP A;  2FJD A;  4GOU A;  4AQG A;  2E5L T;  5AQQ B;  4TWF A;  2KLQ A;  2DLR A;  4DV0 T;  2BG9 B;  2W67 A;  1VCT A;  2IDO B;  4YT0 A;  5LHG B;  4NXM T;  5HAX A;  4CXW A;  3MAC A;  2LSK A;  3B13 A;  1N36 T;  5M4Y A;  4HN9 A;  4NUU A;  4ZJT A;  1U4Q A;  1CHU A;  3OYZ A;  2A72 A;  4ZS2 A;  2LM9 A;  3AA1 B;  4LF4 T;  1Y64 B;  2YN6 A;  3FZF B;  5FKY A;  4LF5 T;  1QLB A;  2Y57 A;  1JNZ A;  1E2A A;  3UUN A;  3ZDG A;  1SA0 E;  2Q9Q D;  4AIS A;  4ZOL E;  3OBV E;  4UF0 A;  3ZLI A;  3RYC E;  2VB6 A;  3KFW X;  2UXN B;  2BVL A;  4LML A;  3JAE A;  4JEH B;  5BR8 T;  2XY8 B;  2BG9 E;  3CPZ A;  5AFM B;  3WAK A;  2I6H A;  4QKN A;  2JQH A;  4TN7 B;  2WDQ A;  2W61 A;  4PK4 A;  2BYR A;  2XNU A;  3CX7 B;  3EDU A;  2X0Y A;  5AQP B;  5LBQ B;  3PU3 A;  5FY7 A;  3P50 A;  5EK4 A;  5C8Y E;  2MYS A;  2W2U A;  5J5H A;  2ZM8 A;  2Q9Q A;  3QNU A;  3C51 A;  3U3I A;  2Y6X A;  2YDQ A;  4EAH A;  3MA9 A;  2WB5 A;  1HFA A;  5IYZ E;  3QOF A;  3RRC A;  1J5W A;  1LVK A;  2XQA A;  4A56 A;  4UY2 A;  5CGM A;  1BR0 A;  2E9X D;  5FVL A;  2C0S A;  4H9P C;  4O4J E;  3P4Q A;  5LHH B;  4X64 T;  3M65 A;  3T1H T;  3IGQ A;  5HEJ A;  4L0R A;  3CQC B;  3N9Q A;  3Q5D A;  4IGU A;  2D0U A;  3RIF A;  5HXH A;  2W8G A;  3GA8 A;  2XAJ B;  3H3A A;  4X62 T;  2CCQ A;  4QWN B;  4ZK1 A;  4GIW A;  4DR5 T;  3EAM A;  4TNW A;  4YHH T;  3C50 A;  2YU2 A;  2E9X A;  3C4Z A;  3TLT A;  4KBM B;  1XDO A;  1MNE A;  4ZI3 D;  1MMA A;  2V6Y B;  1HNZ T;  2KMF A;  3ZKR A;  2XSB A;  2JQ9 A;  2CHO A;  2UXB T;  1KEY A;  2H88 A;  2OV9 A;  2XNV A;  2LHN A;  1YKE B;  2LSI A;  1UV6 A;  2Y8D A;  5AFU L;  1FIO A;  5AQK B;  5JR9 B;  2BR7 A;  3RI5 A;  3ONX A;  3JAF A;  2H3R A;  3QUJ A;  1ZP0 A;  2J1D G;  1HS7 A;  1SE7 A;  1UK5 A;  1UX5 A;  5ABG A;  4IL4 A;  1LVF A;  4CN1 A;  4DMW A;  5A1L A;  3PUW F;  4PW8 A;  5AFH A;  3NVO A;  3AE2 A;  2PFV A;  4GK5 E;  2CWO A;  4IDZ A;  5DQW A;  2C5J A;  4YSZ A;  2XQ4 A;  4LF9 T;  4H63 H;  1MMD A;  1KNP A;  5JDF A;  4DBR A;  3M3Z B;  4L9I A;  3RC8 A;  5LXB A;  2ZM2 A;  3AEG A;  2CWY A;  3ZST A;  3PJA A;  3RF1 A;  2LOS A;  4GYR A;  4U3C A;  4ZXL A;  5L4E A;  5LGN B;  2XQ5 A;  3ZC1 A;  2YKS A;  4ZI2 D;  5AQI B;  3E0Z A;  2ODV A;  2XAG B;  5LGU B;  4UM3 A;  4AI6 A;  4TWD A;  5J1G A;  4YXD A;  4EZ1 A;  5FY1 A;  5LJN A;  4AKH A;  1HTJ F;  2XAS B;  3HA4 A;  3AAA B;  4BA9 A;  3CKD A;  3ZJ2 A;  4C90 A;  3FZL B;  4QAB A;  5GON E;  2V7I A;  2WU5 A;  4MLK A;  3CX8 B;  2SPC A;  4EEB A;  3A5X A;  4X66 T;  5CO5 A;  3U8N A;  1CUN A;  5CA0 E;  1WYB A;  3N9P A;  3N9M A;  3RLF F;  1HNW T;  3CQX C;  1G8X A;  2WCA A;  2WNJ A;  2D9D A;  3N9L A;  3HKD E;  4XK9 A;  3L3P A;  1XMQ T;  1W0B A;  3R84 B;  3ETV A;  5LG4 A;  2LLY A;  5JQG E;  3SQ9 A;  1S94 A;  3RKO A;  4TX5 A;  2X9H A;  4G63 A;  1XZY A;  2NW7 A;  2YK0 A;  4GYS A;  3O9X A;  4WYV A;  4BQT A;  5HYA A;  1T7S A;  5LBM A;  1U5P A;  3ZMT B;  2EHO C;  1US7 B;  2HN2 A;  4O8S A;  2PBI A;  3N9N A;  2XJ7 A;  2WWU A;  1FMW A;  2V6Y A;  4PNI A;  5KXJ A;  3A8Y C;  3SRZ A;  2V7J A;  4HFC A;  5AFN A;  5CA1 E;  4E7Z A;  3GMI A;  3CIR A;  2WAU A;  1WFD A;  1WR0 A;  3AXJ A;  1BR1 A;  5JR9 A;  4MBQ A;  2XQ8 A;  3C64 A;  3TLV A;  3NBX X;  5JDM A;  5L3F B;  5FNV E;  4K0U A;  2JMH A;  5JRC B;  2BJ0 A;  2H7V C;  5LHI B;  5LB7 B;  3V5S A;  4B3T T;  5LGT B;  1OED C;  5J2T E;  1I6Z A;  4AFG A;  3PUG A;  4QX7 B;  4ZRU A;  3D0T A;  2L9Q A;  3ZEF B;  4MAL A;  4H9O C;  1OED E;  3NZQ A;  2UUA T;  3JC6 D;  1KNR A;  5ABE A;  1QSD A;  2J62 A;  1YW0 A;  2W0G A;  4EZH A;  1IBL T;  5AQM B;  2G0U A;  4IE6 A;  2X9X A;  3AE6 A;  2K24 A;  5AQU B;  3AAE B;  4QXB B;  4P0B A;  5AQN B;  1XNQ T;  1MIY A;  4AKL A;  4AQF A;  4PIR A;  2KSR A;  4GKJ T;  4HFI A;  5FL0 A;  4P0A A;  3RPU A;  5LYJ E;  3ZC0 A;  4HWH A;  2VWA A;  5FYM A;  2WP9 A;  2PG8 A;  3GWH A;  4BJM A;  3P4S A;  4QHO A;  4CXY A;  2ZJU A;  2JIW A;  2VL8 A;  3K8P C;  4UM3 S;  2JQQ A;  4UEM A;  4JI6 T;  4U2Z A;  5BP0 A;  3VRA A;  1KK7 A;  4H9R C;  3ZMZ B;  4DV4 T;  4IE0 A;  3FHN A;  2JPF A;  2WU2 A;  2WZI A;  1HF8 A;  4DV7 T;  4UVA B;  4JLE A;  5FXV A;  4PJJ A;  1UCU A;  2Q9Q B;  4NPP A;  2VVS A;  5L4H A;  2W4X A;  3OKQ A;  2N9D A;  2IHR 1;  4AKI A;  4EB6 E;  3RQW A;  5L2L A;  1WRD A;  2ZM6 T;  4O4H E;  4FI5 A;  1ZKE A;  4U31 A;  2WZY A;  3RIU A;  4IHJ E;  2V7L A;  3AA7 B;  4B3S T;  5HEG A;  3CWZ B;  3F2E A;  3BK9 A;  2LM2 A;  1HR0 T;  1T72 A;  4DV6 T;  5HXE A;  5JRE A;  4CI1 B;  3O1J A;  4ZHQ E;  3VU7 H;  2HPL A;  3PUA A;  4ILB A;  5AFL A;  3ZN0 B;  5LOV E;  3OYX A;  2WSS V;  4PJL A;  3RYI E;  3TKL B;  3C4X A;  2B76 A;  3U8M A;  3LG7 A;  4IST A;  2CLY B;  4EED A;  3ETU A;  5J5G A;  5H6R B;  3I0Q A;  2JQK A;  2K9A A;  2MTQ A;  5LXT E;  2ODU A;  3AED A;  3WAJ A;  3ZPO A;  5KZU A;  4EIW A;  3SIO A;  3PUV F;  4I55 E;  1MIV A;  2E9X B;  2CXL A;  2WBL A;  5IHY A;  4AIU A;  4AFH A;  4B3M T;  2WM9 A;  3P8C D;  1UX4 A;  3FZH B;  2Y48 B;  3P4W A;  1NEK A;  1HX8 A;  2BYS A;  4DR3 T;  5E0O A;  4XHE A;  5FVK A; 
#chains in the Genus database with same CATH homology
 3JAE A;  3WTM A;  4QAC A;  4D01 A;  4QH1 A;  2BG9 E;  4COF A;  4QAB A;  2WNC A;  2PH9 A;  2LKH A;  4NPP A;  5AFM B;  1OED C;  3U8L A;  5J5F A;  5L4H A;  3TLT A;  3U8J A;  5CO5 A;  4AFG A;  3UQ7 A;  3U8N A;  4Z90 A;  2BYP A;  4ZRU A;  5HEO A;  2Y54 A;  4ZZB A;  5AIN A;  2LKG A;  3PEO A;  4HFH A;  1OED E;  2BYR A;  2YMD A;  3PMZ A;  3EHZ A;  4HFE A;  3UU4 A;  3ZKR A;  2WNL A;  3RQW A;  2XNU A;  3EI0 A;  4ZR6 A;  3WTJ A;  2BG9 C;  3LSV A;  2XZ5 A;  2WNJ A;  4X5T A;  4LMJ A;  3RQU A;  2BYQ A;  4BFQ A;  2XQ7 A;  2XNV A;  3TLS A;  4AFT A;  4XK9 A;  2WZY A;  5LG3 A;  2QC1 B;  3ZDH A;  4LMK A;  3P50 A;  3UUB A;  3TLU A;  4ILA A;  1UV6 A;  2C9T A;  4UM3 P;  5HEG A;  2XQ6 A;  5J5H A;  2Y7Y A;  1OED B;  2PGZ A;  3RHW A;  3SH1 A;  2XQ3 A;  2BR7 A;  2UZ6 A;  3RI5 A;  3WTN A;  5AFM A;  3JAF A;  2LLY A;  4NZB A;  2LM2 A;  3SQ9 A;  2BYN A;  3JAD A;  1UX2 A;  5CFB A;  4QH4 A;  5HEH A;  2M6I A;  4ZJS A;  3U8K A;  4ZK4 A;  5J5I A;  4TWF A;  4IL4 A;  2XZ6 A;  5SYO A;  4XHE A;  3WTK A;  4TNV A;  2BG9 B;  4PIR A;  5AFJ A;  3GUA A;  2VL0 A;  2KSR A;  5J0Z A;  2X00 A;  4HFI A;  1I9B A;  5FJV A;  4ILB A;  4BQT A;  5AFL A;  5AFH A;  2XQA A;  5IUX A;  4IRE A;  4UY2 A;  5BRX A;  4DBM A;  3WTO A;  4ZZC A;  5HEU A;  3T4M A;  3U8M A;  4IL9 A;  3WTI A;  1UW6 A;  4ILC A;  5BW2 A;  3UU8 A;  4A98 A;  2Y56 A;  2XQ4 A;  2MAW A;  5J5G A;  3UU5 A;  5HCM A;  4HQP A;  5L47 A;  3UU6 A;  4TWH A;  4A97 A;  2XNT A;  2XYT A;  4ZJT A;  4QH5 A;  5AFK A;  4UM1 A;  2X00 D;  4QAA A;  3TLW A;  2W8F A;  3IGQ A;  5LXB A;  2YN6 A;  5HEJ A;  2XQ9 A;  4HFB A;  2WN9 A;  3UU3 A;  2BG9 A;  2ZJU A;  2Y57 A;  3C79 A;  5TVC A;  5KZU A;  5KE4 A;  5L4E A;  3SIO A;  4HFC A;  5AFN A;  3SQ6 A;  3ZDG A;  4UM3 S;  2XQ5 A;  4Z91 A;  4ALX A;  3WTH A;  5JME A;  3RIA A;  4WV9 A;  4AFH A;  3C84 A;  5BP0 A;  2YKS A;  3RIF A;  4B5D A;  3UQ4 A;  2W8G A;  4HFD A;  1OED A;  2XYS A;  3P4W A;  2ZJV A;  4UM3 A;  2XQ8 A;  3TLV A;  3WTL A;  2Y58 A;  2M6B A;  2YOE A;  4UXU A;  4ZK1 A;  2BYS A;  4TWD A;  4FRR A;  2BJ0 A;  3WIP A;  2YME A;  2BR8 A;  4F8H A;  3EAM A;  4TNW A;  4LML A;  5HCJ A;  4EZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...