5HEHA

Pentameric ligand-gated ion channel glic mutant p246a
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLAKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Signal Transduction at the Domain Interface of Prokaryotic Pentameric Ligand-Gated Ion Channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
total genus 85
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hehA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hehA01
3WTLA 4QABA 5AFJA 5HEJA 3UU5A 2BYRA 3U8MA 4FRRA 3WTNA 3JAFA 2WNJA 5L47A 2WNLA 2Y54A 2BJ0A 3T4MA 3TLVA 2XQ9A 2QC1B 4LMKA 2BYQA 5HCMA 3WTOA 3IGQA 3UU6A 5CFBA 4ILCA 2WZYA 1OEDC 2PH9A 4UM3P 2XQ8A 3U8JA 3C79A 4D01A 5KZUA 3RIFA 3C84A 2WN9A 2UZ6A 4ILBA 5AFLA 4UM3A 4XHEA 1OEDA 3UQ7A 5J5GA 3GUAA 4HQPA 2Y57A 4ZZCA 5L4EA 2XQ7A 3EAMA 4HFDA 2LKGA 3UQ4A 4PIRA 4QACA 4WV9A 3SIOA 2Y7YA 5TVCA 3EI0A 3P4WA 4LMJA 4QH1A 4ZJSA 4XK9A 2W8GA 5LXBA 4COFA 4HFHA 5LG3A 2BYNA 2BR8A 2PGZA 5HEHA 2XNTA 2XYTA 5FJVA 3RHWA 2BG9C 3SQ9A 3EHZA 4ALXA 3PEOA 5AFMA 3JADA 3LSVA 5J5IA 4A97A 4Z90A 2VL0A 4TWDA 3ZDGA 2XQ5A 5AFKA 5BRXA 4DBMA 2M6BA 5SYOA 4QH5A 3TLWA 5KE4A 5HEGA 3RQUA 2XNVA 2BG9A 4F8HA 3PMZA 5CO5A 4IL9A 2YMEA 3JAEA 4HFBA 4ZK4A 5J5HA 2XQ6A 4IREA 3WTJA 4HFIA 3U8KA 3WTHA 4TWHA 2Y56A 1OEDE 4UY2A 4ZJTA 1OEDB 5HEUA 5HCJA 4TNWA 2M6IA 2XQ4A 1UV6A 4QH4A 5JMEA 2ZJVA 4ZK1A 3WTIA 2LKHA 2YMDA 4B5DA 4A98A 2XZ6A 3ZKRA 4NZBA 4QAAA 2WNCA 2X00D 4ILAA 2YN6A 3WTMA 3UUBA 4LMLA 4HFEA 1I9BA 4BQTA 5AFMB 4NPPA 3UU3A 3TLUA 1UX2A 2YKSA 2KSRA 2W8FA 2LLYA 2BG9E 5AFNA 5BW2A 2BG9B 4ZZBA 3U8LA 4UXUA 3RQWA 2X00A 3RI5A 2XQ3A 4TWFA 5J0ZA 5HEOA 4IL4A 3TLSA 3SQ6A 4X5TA 3TLTA 2XZ5A 2C9TA 4AFGA 4UM1A 5AFHA 3UU4A 3SH1A 2XNUA 3RIAA 4ZR6A 4ZRUA 3WTKA 4AFHA 4AFTA 4BFQA 3ZDHA 4EZ1A 2LM2A 2XYSA 2ZJUA 5J5FA 4UM3S 2YOEA 3P50A 4Z91A 2BYPA 3U8NA 3UU8A 1UW6A 4TNVA 2MAWA 5BP0A 2XQAA 5L4HA 2Y58A 3WIPA 5IUXA 4HFCA 2BYSA 5AINA 2BR7A
chains in the Genus database with same CATH superfamily
3K3OA 5ABHA 5HXEA 2QC1B 1IBLT 1S94A 3CX7B 4XAXB 5F5WA 3C79A 4P09A 4BJNA 3QB5K 4H9OC 4HQPA 2UXNB 2LKGA 4WV9A 5JR9C 4ZI3D 4QH1A 1D0ZA 4DR2T 1BR2A 2X51A 3IHRA 2VL0A 2XY8B 1T98A 2LSGA 2YU2A 4TX5A 3JAEA 4HWIB 3BQIA 3OTOT 5C2TA 4CI1B 5JDMA 3T1HT 3PUGA 1XNRT 2UU9T 5F8PA 4X62T 2EHOD 1UUSA 4GK5E 2VKOA 2WY2A 2QRXA 1OWAA 1X9BA 4EEDA 3UUBA 4E7ZA 1XMOT 2RPAA 4P0AA 2CBIA 1ZP0A 2MOZA 4IDPA 2I0MA 1UX4A 2XQ3A 4TWFA 4O4JE 3TLTA 5LHHB 4AFGA 3RYCE 4CZZB 4ZOLE 4WW0A 3QB5A 2LHNA 2XYSA 3GMIA 2KZ7B 4CI2B 2DWGA 3CQXC 5BP0A 5J1GA 2CE7A 4HWFA 1W9RA 5CB4E 3CVRA 2WNJA 1FEWA 2VQET 5HCMA 2XJ7A 5LGUB 1OEDC 1O3XA 4PK4A 2LHRA 1HG2A 3AE9A 5EZYE 3ZSSA 1UCUA 4U74A 2IMLA 5A1LA 2LE8A 3OVUA 3RC3A 4HFDA 4IE7A 1NAFA 3G06A 3P4WA 4ZJSA 4IHJE 3GN5B 3PUYF 4BJMA 3CKDA 2VVNA 5AFMA 1L0VA 1YXRA 5FVLA 3RQUA 5JDQA 3B57A 3S4UA 4X1KE 2XQ6A 4IREA 3AE3A 4AISA 3U8KA 3FZFB 2CWYA 4ZK1A 2LEHA 2CLYB 4G2AA 4BQTA 3O9XA 3AEDA 4YSZA 4UIGA 2WMNA 2YDRA 2BKOA 3HA4A 4GYSA 3U8LA 4ZZBA 3RKOA 2HPLA 2BBHA 5FL1A 2WU5A 4N78D 5J0ZA 3Q5XA 3N9MA 4ERRA 3RF1A 2Q9QA 4DBQA 3ZDHA 5DJQC 5L3GB 1Z8UA 3AAAB 4DUZT 1UX5A 1N34T 5ADXL 2GK9A 1J5WA 2K5BB 5H6RB 2X9YA 1KNPA 3QNUA 5HEJA 3UU5A 3CWZB 3EDUA 5LHIB 4YTPA 4ZS3A 4DR7T 2MBGA 4LMKA 4UV9B 5AQUB 2VVSA 3AAEB 2V5CA 4DV5T 2L9QA 2FUPA 2RP4A 3ZYKA 3LFMA 3UQ7A 4OFZA 1YW0A 3RX6A 5TVCA 3CQCB 1MMGA 4ZEYA 4H63H 5JR9A 2XYTA 4ALXA 5LA6E 2BG9C 2IIUA 4TWDA 3RYIE 3N9PA 5C3JA 2K48A 5LBMA 2Y6XA 1D1BA 5LNKA 3ZYMA 2KNDA 5AQTB 1MNEA 5JDHA 3E08A 3T8OA 2JQQA 2D0TA 3H3AA 4DR1T 4AKGA 5FL0A 2YEVC 3RRCA 2AE9A 1HG5A 5KXJA 1T72A 2YKSA 3NWIA 5FNVE 4UXUA 2J47A 3ZN1B 4IL4A 4O4IE 1YD8G 2XZ5A 2V6YB 5JRCA 3O1HA 3C51A 5KDMC 4C91A 5CA1E 1N32T 4QHOA 3PU8A 3SS1A 3NBXX 3KBTA 1UW6A 4LF7T 3AE5A 3MA9A 1D1CA 1S35A 4JI0T 4UELA 3DJBA 4P1NA 3GA8A 2BYRA 3JAFA 4DV6T 1NWMX 3SOLA 5KX5E 4ISTA 2VL8A 2BDEA 2Y48B 3AVRA 3AA0B 2YINA 1OEDA 3WAKA 3ZT5A 3H37A 4DR5T 2NR4A 2YDSA 3RHWA 4A97A 3NRXA 4CN6A 2XNVA 2XZEA 2AXDS 1IZNB 2IAKA 3R84B 4PW8A 2NP9A 3VRBA 4B3TT 4GK0E 1US7B 2V7MA 4H63V 4IT4A 4DV0T 4YSXA 3ZCIA 1I6ZA 1MIYA 4HFEA 1MIVA 4DV4T 1WR6A 5AFMB 3N9OA 2ZMAA 3SRZA 2IW5B 1ZKEA 2DWKA 3A7MA 2C9TA 3I1AA 3UULA 4ZR6A 2LRKA 3N2KE 2A9UA 2BYPA 2X66A 4A56A 2B1EA 4QKNA 3ZC1A 2XTLA 3N9NA 5DQVA 4YLHA 3MJXA 2EHOB 2PG8A 5FYMA 4ILUA 3HL6A 4GKJT 2Q9QB 2VKDA 3CMLA 4UM3P 2HHHT 4DMWA 3C84A 1G8XA 3AAIA 4B3RT 5J5GA 3GUAA 2UUAT 3ZN0B 2XQ7A 2OLTA 4K0UA 4PJNA 5AQPB 4CXXA 4EV6A 4DIDB 4ZHQE 2BR8A 3ONJA 5J5IA 3EHZA 4KHPT 4DBMA 4MLKA 4IE6A 2BG9A 1YKHB 2YMEA 3WTJA 4HFIA 2Y8DA 4PJLA 4UY2A 4ASKA 3FHNA 4QXHB 3AE4A 5EK3A 5JMEA 1LVFA 3WTIA 4ZI3C 2WNCA 2VQFT 5JR9B 4LMLA 3Q5DA 5JDNA 3E22E 3L3PA 3RIUC 5HXSA 1U5PA 1GQEA 1XDPA 5EK2A 2X9HA 1HX8A 4YXDA 4UM1A 4BFQA 2CXDA 4I43B 2IUBA 3PUAA 4XBFB 1QLBA 2EHOC 2H7VC 3AXJA 2X0HA 2IDOB 5IUXA 5BMVE 2HN1A 3ZMVB 2HH7A 2W62A 2Z6EA 1MMNA 3U3IA 1WR0A 3M3ZB 4DR6T 5AQGB 4LF6T 5CA0E 4QXBB 2WZYA 5JRCB 2WM9A 4GIWA 3AEFA 2XM2A 4AQFC 4I0UA 5E0OA 3O1JA 4PK6A 2B76A 3AEEA 3C98B 2PBIA 4AXPA 3F31A 4CN1A 5L3DB 2PTFA 2VKHA 5FJVA 5FXWA 4TUYE 5SYOA 3MACA 5CO5A 2W66A 5L3BB 2ZM6T 4ZK4A 3WTHA 1OEDE 1OEDB 4OX9T 5AQVB 1Y64B 2WWVA 1SE7A 3LBXA 2C5IT 4B5DA 4A98A 1W0BA 2QVAA 1HCIA 4ILAA 3N9QA 3C50A 1I9BA 1HFAA 2LT3A 2MYSA 2BKNA 5BW2A 1Z0PA 4JI2T 4HE8A 1MIWA 4EB6E 1VCSA 2WBLA 2V6YA 1HNWT 4H9NC 2JPFA 5L3CB 1IBKT 3P50A 3OBVE 3UU8A 3N9LA 5IYZE 4PFOA 5L4HA 2A2FX 3I0OA 3P8CD 3M65A 4FJOA 3RLFF 3BK9A 4HWCA 2CCQA 3ZT6A 3UFGA 2FBWA 3UT5E 3ABVA 2WZIA 3QK6A 2N9DA 2QYWA 2PH9A 4HKAA 2QGSA 4HWHA 3N2GE 5AFLA 3BQKA 4EXTA 4YT0A 3JC6C 2WSSV 2JRKA 4EYYR 1T7SA 3J9X1 4ADZA 1HF8A 3PEOA 4I4TE 4JV5T 2IHR1 1MNDA 4O8SA 2BZBA 2FJDA 5KE4A 2J4GA 4MFRA 5HEUA 5JDGA 3U78A 3UUMA 2YMDA 4NZBA 3GWHA 4QAAA 2DI4A 2YN6A 1D1AA 3J7Yq 2CM0A 4NPPA 3P7IA 2BG9E 2BG9B 4J2CA 4A5XA 5LJNA 3RI5A 1ZEEA 3TLSA 2DL1A 3RIUA 3RGLA 3VR9A 4ZRUA 4EZ1A 1H7CA 2KWIB 3ZSTA 2BBJA 1E7PA 3EVYA 1MMAA 2G0UA 4U7YA 2XASB 2XQAA 4IE0A 2EHOA 2V5DA 3P4RA 5AQOB 3PURA 3WTLA 3FZKB 3QUJA 4HGAA 1BR4A 1WYCA 3T4MA 4DV2T 3SFEA 4CN4A 1IJ6A 2L8KA 5CFBA 3FBZA 2LOSA 3JC6D 4E7SA 1N33T 4UVAB 2VWAA 3LJCA 4XHEA 3FB2A 3V5UA 3AXJB 1WFDA 3ZJ2A 4UR9A 3Q2MA 3EI0A 2CPTA 5LOVE 4JI7T 4NUVA 4JEUB 2VK9A 4I50E 3SWHA 2ODVA 3CPZA 4DV7T 3AE7A 4QXCB 3LK3B 1FMVA 4F8HA 5LG4A 4TV9E 3PJAJ 5H6QB 2Y56A 1T8BA 1U4QA 5LB7B 4IIJE 4QH4A 4EYUA 5LP6E 2UUBT 2A72A 4KBMB 3ZKRA 3PUZF 2NW7A 5JVDE 3PTRB 4PFPA 2YK0A 3RC8A 3UU3A 3KV5A 4IDOA 5AFNA 4TZ4C 4EAHA 4X5TA 4FI5A 3HKBE 3LBXB 3IEEA 3WTKA 4IDNA 2LM2A 4UM3S 3VKHA 3F2EA 4Z91A 2NTXA 2D5UA 4O2AE 1G73A 3IA3A 3ZCJA 5JREA 3A8YC 1WYBA 3KDSE 2Y54A 5AQKB 2LJLA 4B3ST 5GONE 1YQ4A 5ABEA 5JDFA 4NUUA 3VR8A 2FJAA 3W15B 2UXDT 2SPCA 3E0ZA 4P0BA 4AKLA 3EAMA 4WZXA 2BS2A 1IAPA 2V7JA 4U2YA 4DR4T 2ZM0A 5LBQB 1LVKA 4YJ2E 5FKYA 3SQ9A 1E1HB 4EZHA 3LSVA 4NIQA 2E9XC 4PK5A 2XQ5A 3RRWA 2X68A 1SUMB 3PMZA 1UURA 2V26A 4HFBA 1DU2A 2KMFA 2W0GA 4TNWA 3HKDE 3FZLB 1UV6A 2ZJVA 2LKHA 5ETWA 5LYJE 3VHLA 2WB5A 5BR8T 2V7IA 3VKGA 2HPJA 3ETUA 4O2BE 3I0QA 1UX2A 4EZ4A 2KSRA 2HN2A 4YJ3E 1XMQT 2BVMA 3CK6A 3FXEB 2ZJUA 3NRYA 4M1PA 2YOEA 4OK0A 4QWNB 5HAXA 5HWXA 2NOXA 1W09A 2Y58A 3C4ZA 2L3LA 4X1YE 4FRRA 5FY0A 4YHHT 2BJ0A 5AQSB 2XQ9A 5LXTE 4YTNA 3VRAA 4YSYA 3TKLB 2LSKA 2K3WA 5FP3A 4OYJA 2UZ6A 1BR1A 1WLXA 5L2LA 1KNRA 2W67A 3HR0A 3ONLC 1EZ3A 4IDQA 2ES0A 2E9XD 2XNTA 2LSJA 5HYAA 2ODUA 3ZDGA 2JIWA 5BRXA 2M6BA 3TLWA 3ZMZB 3FXDB 3SFDA 2M67A 2XPKA 3T1YT 1CHUA 5AQNB 2XAHB 4AQGA 2M6IA 5M4YA 4JBWF 3KVAA 4I55E 3K3QC 4EGWA 2CWOA 4H9RC 3RKGA 3LK42 5LHGB 2BS3A 3TLUA 4DNDA 4UXNB 4JI6T 5JQGE 4JI3T 4UVCB 2BKPA 2RA1A 5DQWA 5EK4A 2D9DA 2W63A 5F3JA 4DR3T 1IBMT 3AA7B 4DO0A 3AA6B 3QOFA 5LMNT 3NKZA 2WDQA 4HFVA 1YQ3A 2H88A 3MK7C 2PJQA 3MZKB 5L47A 1ZV4X 3P4QA 3ZJ1A 2BYQA 2OV9A 3OYXA 4U3CA 4DMVA 2LSYA 2Y57A 4B3MT 3FBLA 2C5KT 2V6XA 2NWBA 2IC6A 1W0AA 2DCFA 4CI3B 1M7KA 5LMUT 2CMRA 5L3FB 2ACZA 3PE0A 2KLQA 3I9YA 2BVLA 4ZJTA 3OYZA 1FIOA 4L9IA 4AI6A 4U72A 4AQYT 2XZ6A 4U33A 2E2AA 3WTMA 4H9QC 3UTKA 3NZPA 2XQYA 3ZMTB 4ZI2C 2W8FA 2JQ9A 2N1GA 3PU3A 5CGMA 1BR0A 4CXWA 2FJBA 3QC9A 4AFTA 5J5FA 3N2OA 2V8SV 1FJGT 3CIRA 1XWMA 5FY1A 2N2NA 3AEBA 3UUXB 5AINA 5LXBA 2BR7A 3HKCE 4QABA 5AFJA 3HKEE 3U8MA 4ZI7E 2W00A 3ZYLA 4PJJA 1R8IA 2WAUA 3WTOA 3IGQA 2XAGB 1ZHCA 3IBPA 4D01A 2WN9A 5FMNA 4KI0F 5AQFB 2X0YA 3P4SA 4YTMA 4L5GA 4ZZCA 5AQRB 2NTYA 2R6GF 4PIRA 3UQ4A 1JNZA 3EUHA 2W4XA 4COFA 3KINB 2QA7A 3PUQA 5FXVA 2C5JA 3L09A 4QH5A 3KV4A 2Q9QD 1D0XA 4LF5T 4IL9A 5FVKA 1KF6A 1SA0E 2X9XA 2F4VT 2NW9A 4LFAT 2WDVA 1NENA 3B13A 1WCRA 4ZXLA 2WU2A 2KWHA 4ISSA 1KK7A 4ZI2D 2WWUA 4XZCA 2FJEA 3AE8A 3PUXF 2A3DA 2XSAA 4LF4T 3PUWF 1HNZT 2LLYA 4JI8T 3OKQA 3RYHE 3PJAA 4IGUA 2WS3A 2XNUA 4DUYT 4F6RC 1CUNA 3CX6B 1UGOA 4UF0A 4LF8T 2KT9A 4BAYB 2H7OA 3HI2A 5ABFA 1E2AA 3AE2A 5HXRA 3O4XE 3BQLA 3OPCA 1UK5A 3I9WA 2JQKA 1KFYA 5FXXA 3ZC0A 4EIWA 1D0YA 5AQLB 2K24A 3C4XA 4ILCA 4U31A 1NEKA 2VASA 5KZUA 3RIFA 3AECA 4ILBA 1I94T 5HWYA 4MALA 5L4EA 3ETVA 4X20E 2ZM8A 2XUEA 5LGNB 3DP7A 2PGZA 5HEHA 2LM9A 2XM1A 3JADA 3KFWX 2JJ9A 3UFEA 2X0LB 3KV9A 4TWHA 5ABGA 2CEAA 4WYVA 4AQFA 4AKHA 3AEGA 4V1Av 2X00D 1QUUA 1MMDA 4C90A 3RQWA 2E9XB 1M62A 5HEOA 3SQ6A 5HXHA 4U2ZA 2X9WA 4AFHA 1XZYA 4GYRA 5AQIB 1FMWA 2C0SA 4AKIA 3EABA 3MKDA 3K3NA 5AQJB 2E5LT 4LFBT 3R6NA 3WAJA 4Z8XA 4DVDA 2DNXA 4AKRB 3WTNA 2UXBT 3V5SA 3ZEFB 4LFCT 2PFVA 3H3MA 2DLRA 2LOPA 2LRLA 5AQMB 3L39A 3UU6A 3U8JA 4YFSA 3ZMSB 4H9PC 2CRBA 2V1DB 4UM3A 1XDOA 4QX8B 3PDYA 2W61A 1X79A 2CLYC 4Q25A 4LMJA 2W8GA 4CXYA 2VKJA 2VURA 4HFHA 1ZOYA 2WP9A 3ONXA 3VU7H 2WQYA 5AFKA 5HEGA 4OYKA 2KXPB 2CHOA 2NW8A 3AVSA 4TN7B 4WBNE 5J2UE 1JNRA 3A5XA 2CXFA 5AQHB 5HCJA 4KP3C 5IHYA 4EOZB 1KNZA 3RPUA 3FZMB 3D0TA 4PAGA 2JMKA 3AE6A 2ZM2A 4JLEA 2KINB 3JCFA 1QSDA 3ANWA 2CHNA 2UXCT 4AIUA 1B7TA 3NVOA 2XSBA 3Q5WA 1HTJF 2X00A 2JQHA 3KVBA 2CXLA 4WNKA 5LGTB 2WDRA 1HS7A 3AE1A 4LF9T 1N36T 5AFHA 5JDLA 1YKEB 3C64A 4JEHB 3DTOA 5FY7A 2YU1A 3MXZA 3U8NA 2MAWA 4BA9A 3WIPA 1VOMA 3C4WA 2BYSA 5LJMA 2D0UA 1HR0T 2MTQA 4PJMA 5C8YE 4DV1T 4JYAT 4GOUA 5L3EB 2P9BA 3ZMUB 2CA5A 4UF0B 5ABFB 3B5MA 4OHFA 3EDVA 3SIOA 4WBOA 2V7KA 4XK9A 4JI1T 2WZHA 2W2UA 2BYNA 1J5ET 3UUNA 3CX8B 4HWDA 4UV8B 3ESLA 4YY3T 4H9SE 4MHCA 5CJ5A 2J1DG 3KV6A 3RH3A 3WI3A 4K0KT 5AQQB 3K8PC 1SHZC 1HNXT 5LCYA 3AEAA 3PV0F 4HEAA 3LK2B 4X66T 2IC9A 4ANJA 3RYFE 4U7IA 4L0RA 4IE5A 4CQIA 4PNIA 1J1JA 4JI5T 5AFUL 3PUVF 3O1IA 2H89A 3K1SA 4O4HE 3UU4A 3IF8B 3SH1A 3RIAA 4X1IE 3X1DA 3LDQB 3Q9DA 3F57A 2CBJA 1LKXA 2J62A 5TAOA 2OA5A 2MPKA 1LRZA 2XHEB 5HXCA 5JTGA 3GN5A 3Q5EA 2D2SA 3LG7A 2ZLYA 3ZT7A 2BS4A 2ACXA 2WNLA 3FZHB 3TLVA 2E8IA 2WMOA 4DBRA 1WRDA 2YDQA 2XAQB 1AJ3A 2XQ8A 4MBQA 4YHJA 4B6XA 4JI4T 4UVBB 2JMHA 4QACA 2LSIA 4JUYA 2Y7YA 4IE4A 5J2TE 4KMCA 4TV8E 2WCAA 3PUSA 3N5LA 5LG3A 3P4PA 1HX1B 1KEYA 3AB3B 4GKKT 4Z90A 4IDZA 2I59A 4G63A 1IJ5A 5J5HA 2XAFB 5FXZA 3ZLIA 2UXXB 3ZPOA 2XQ4A 4UEMA 2E5VA 4O4LE 4HTEA 1Y01A 5KMGP 1OXZA 4KX6A 5IWAT 5DABA 4EEBA 3NZQA 4KHZF 2XAJB 3AA1B 2E9XA 1VCTA 2Q9QC 4NXNT 4HN9A 1VRBA 3OJAA 2X67A 5JH7E 4X65T 2I6HA 4KUMB 4X64T 4DV3T 2K9AA 2DHRA 3CQGB 4QX7B 3L8RA 2V7LA 2UUCT 3KBUA 1XNQT 2VB6A 4ZS2A 4TNVA 1V9DA 2H3RA 4NXMT 4HFCA 3ANWB
chains in the Genus database with same CATH topology
3WTLA 4QABA 5AFJA 5HEJA 3UU5A 2BYRA 3U8MA 4FRRA 3WTNA 3JAFA 2WNJA 5L47A 2WNLA 2Y54A 2BJ0A 3T4MA 3TLVA 2XQ9A 2QC1B 4LMKA 2BYQA 5HCMA 3WTOA 3IGQA 3UU6A 5CFBA 4ILCA 2WZYA 1OEDC 2PH9A 4UM3P 2XQ8A 3U8JA 3C79A 4D01A 5KZUA 3RIFA 3C84A 2WN9A 2UZ6A 4ILBA 5AFLA 4UM3A 4XHEA 1OEDA 3UQ7A 5J5GA 3GUAA 4HQPA 2Y57A 4ZZCA 5L4EA 2XQ7A 3EAMA 4HFDA 2LKGA 3UQ4A 4PIRA 4QACA 4WV9A 3SIOA 2Y7YA 5TVCA 3EI0A 3P4WA 4LMJA 4QH1A 4ZJSA 4XK9A 2W8GA 5LXBA 4COFA 4HFHA 5LG3A 2BYNA 2BR8A 2PGZA 5HEHA 2XNTA 2XYTA 5FJVA 3RHWA 2BG9C 3SQ9A 3EHZA 4ALXA 3PEOA 5AFMA 3JADA 3LSVA 5J5IA 4A97A 4Z90A 2VL0A 4TWDA 3ZDGA 2XQ5A 5AFKA 5BRXA 4DBMA 2M6BA 5SYOA 4QH5A 3TLWA 5KE4A 5HEGA 3RQUA 2XNVA 2BG9A 4F8HA 3PMZA 5CO5A 4IL9A 2YMEA 3JAEA 4HFBA 4ZK4A 5J5HA 2XQ6A 4IREA 3WTJA 4HFIA 3U8KA 3WTHA 4TWHA 2Y56A 1OEDE 4UY2A 4ZJTA 1OEDB 5HEUA 5HCJA 4TNWA 2M6IA 2XQ4A 1UV6A 4QH4A 5JMEA 2ZJVA 4ZK1A 3WTIA 2LKHA 2YMDA 4B5DA 4A98A 2XZ6A 3ZKRA 4NZBA 4QAAA 2WNCA 2X00D 4ILAA 2YN6A 3WTMA 3UUBA 4LMLA 4HFEA 1I9BA 4BQTA 5AFMB 4NPPA 3UU3A 3TLUA 1UX2A 2YKSA 2KSRA 2W8FA 2LLYA 2BG9E 5AFNA 5BW2A 2BG9B 4ZZBA 3U8LA 4UXUA 3RQWA 2X00A 3RI5A 2XQ3A 4TWFA 5J0ZA 5HEOA 4IL4A 3TLSA 3SQ6A 4X5TA 3TLTA 2XZ5A 2C9TA 4AFGA 4UM1A 5AFHA 3UU4A 3SH1A 2XNUA 3RIAA 4ZR6A 4ZRUA 3WTKA 4AFHA 4AFTA 4BFQA 3ZDHA 4EZ1A 2LM2A 2XYSA 2ZJUA 5J5FA 4UM3S 2YOEA 3P50A 4Z91A 2BYPA 3U8NA 3UU8A 1UW6A 4TNVA 2MAWA 5BP0A 2XQAA 5L4HA 2Y58A 3WIPA 5IUXA 4HFCA 2BYSA 5AINA 2BR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTL A;  4QAB A;  5AFJ A;  5HEJ A;  3UU5 A;  2BYR A;  3U8M A;  4FRR A;  3WTN A;  3JAF A;  2WNJ A;  5L47 A;  2WNL A;  2Y54 A;  2BJ0 A;  3T4M A;  3TLV A;  2XQ9 A;  2QC1 B;  4LMK A;  2BYQ A;  5HCM A;  3WTO A;  3IGQ A;  3UU6 A;  5CFB A;  4ILC A;  2WZY A;  1OED C;  2PH9 A;  4UM3 P;  2XQ8 A;  3U8J A;  3C79 A;  4D01 A;  5KZU A;  3RIF A;  3C84 A;  2WN9 A;  2UZ6 A;  4ILB A;  5AFL A;  4UM3 A;  4XHE A;  1OED A;  3UQ7 A;  5J5G A;  3GUA A;  4HQP A;  2Y57 A;  4ZZC A;  5L4E A;  2XQ7 A;  3EAM A;  4HFD A;  2LKG A;  3UQ4 A;  4PIR A;  4QAC A;  4WV9 A;  3SIO A;  2Y7Y A;  5TVC A;  3EI0 A;  3P4W A;  4LMJ A;  4QH1 A;  4ZJS A;  4XK9 A;  2W8G A;  5LXB A;  4COF A;  4HFH A;  5LG3 A;  2BYN A;  2BR8 A;  2PGZ A;  5HEH A;  2XNT A;  2XYT A;  5FJV A;  3RHW A;  2BG9 C;  3SQ9 A;  3EHZ A;  4ALX A;  3PEO A;  5AFM A;  3JAD A;  3LSV A;  5J5I A;  4A97 A;  4Z90 A;  2VL0 A;  4TWD A;  3ZDG A;  2XQ5 A;  5AFK A;  5BRX A;  4DBM A;  2M6B A;  5SYO A;  4QH5 A;  3TLW A;  5KE4 A;  5HEG A;  3RQU A;  2XNV A;  2BG9 A;  4F8H A;  3PMZ A;  5CO5 A;  4IL9 A;  2YME A;  3JAE A;  4HFB A;  4ZK4 A;  5J5H A;  2XQ6 A;  4IRE A;  3WTJ A;  4HFI A;  3U8K A;  3WTH A;  4TWH A;  2Y56 A;  1OED E;  4UY2 A;  4ZJT A;  1OED B;  5HEU A;  5HCJ A;  4TNW A;  2M6I A;  2XQ4 A;  1UV6 A;  4QH4 A;  5JME A;  2ZJV A;  4ZK1 A;  3WTI A;  2LKH A;  2YMD A;  4B5D A;  4A98 A;  2XZ6 A;  3ZKR A;  4NZB A;  4QAA A;  2WNC A;  2X00 D;  4ILA A;  2YN6 A;  3WTM A;  3UUB A;  4LML A;  4HFE A;  1I9B A;  4BQT A;  5AFM B;  4NPP A;  3UU3 A;  3TLU A;  1UX2 A;  2YKS A;  2KSR A;  2W8F A;  2LLY A;  2BG9 E;  5AFN A;  5BW2 A;  2BG9 B;  4ZZB A;  3U8L A;  4UXU A;  3RQW A;  2X00 A;  3RI5 A;  2XQ3 A;  4TWF A;  5J0Z A;  5HEO A;  4IL4 A;  3TLS A;  3SQ6 A;  4X5T A;  3TLT A;  2XZ5 A;  2C9T A;  4AFG A;  4UM1 A;  5AFH A;  3UU4 A;  3SH1 A;  2XNU A;  3RIA A;  4ZR6 A;  4ZRU A;  3WTK A;  4AFH A;  4AFT A;  4BFQ A;  3ZDH A;  4EZ1 A;  2LM2 A;  2XYS A;  2ZJU A;  5J5F A;  4UM3 S;  2YOE A;  3P50 A;  4Z91 A;  2BYP A;  3U8N A;  3UU8 A;  1UW6 A;  4TNV A;  2MAW A;  5BP0 A;  2XQA A;  5L4H A;  2Y58 A;  3WIP A;  5IUX A;  4HFC A;  2BYS A;  5AIN A;  2BR7 A; 
#chains in the Genus database with same CATH topology
 3K3O A;  5ABH A;  5HXE A;  2QC1 B;  1IBL T;  1S94 A;  3CX7 B;  4XAX B;  5F5W A;  3C79 A;  4P09 A;  4BJN A;  3QB5 K;  4H9O C;  4HQP A;  2UXN B;  2LKG A;  4WV9 A;  5JR9 C;  4ZI3 D;  4QH1 A;  1D0Z A;  4DR2 T;  1BR2 A;  2X51 A;  3IHR A;  2VL0 A;  2XY8 B;  1T98 A;  2LSG A;  2YU2 A;  4TX5 A;  3JAE A;  4HWI B;  3BQI A;  3OTO T;  5C2T A;  4CI1 B;  5JDM A;  3T1H T;  3PUG A;  1XNR T;  2UU9 T;  5F8P A;  4X62 T;  2EHO D;  1UUS A;  4GK5 E;  2VKO A;  2WY2 A;  2QRX A;  1OWA A;  1X9B A;  4EED A;  3UUB A;  4E7Z A;  1XMO T;  2RPA A;  4P0A A;  2CBI A;  1ZP0 A;  2MOZ A;  4IDP A;  2I0M A;  1UX4 A;  2XQ3 A;  4TWF A;  4O4J E;  3TLT A;  5LHH B;  4AFG A;  3RYC E;  4CZZ B;  4ZOL E;  4WW0 A;  3QB5 A;  2LHN A;  2XYS A;  3GMI A;  2KZ7 B;  4CI2 B;  2DWG A;  3CQX C;  5BP0 A;  5J1G A;  2CE7 A;  4HWF A;  1W9R A;  5CB4 E;  3CVR A;  2WNJ A;  1FEW A;  2VQE T;  5HCM A;  2XJ7 A;  5LGU B;  1OED C;  1O3X A;  4PK4 A;  2LHR A;  1HG2 A;  3AE9 A;  5EZY E;  3ZSS A;  1UCU A;  4U74 A;  2IML A;  5A1L A;  2LE8 A;  3OVU A;  3RC3 A;  4HFD A;  4IE7 A;  1NAF A;  3G06 A;  3P4W A;  4ZJS A;  4IHJ E;  3GN5 B;  3PUY F;  4BJM A;  3CKD A;  2VVN A;  5AFM A;  1L0V A;  1YXR A;  5FVL A;  3RQU A;  5JDQ A;  3B57 A;  3S4U A;  4X1K E;  2XQ6 A;  4IRE A;  3AE3 A;  4AIS A;  3U8K A;  3FZF B;  2CWY A;  4ZK1 A;  2LEH A;  2CLY B;  4G2A A;  4BQT A;  3O9X A;  3AED A;  4YSZ A;  4UIG A;  2WMN A;  2YDR A;  2BKO A;  3HA4 A;  4GYS A;  3U8L A;  4ZZB A;  3RKO A;  2HPL A;  2BBH A;  5FL1 A;  2WU5 A;  4N78 D;  5J0Z A;  3Q5X A;  3N9M A;  4ERR A;  3RF1 A;  2Q9Q A;  4DBQ A;  3ZDH A;  5DJQ C;  5L3G B;  1Z8U A;  3AAA B;  4DUZ T;  1UX5 A;  1N34 T;  5ADX L;  2GK9 A;  1J5W A;  2K5B B;  5H6R B;  2X9Y A;  1KNP A;  3QNU A;  5HEJ A;  3UU5 A;  3CWZ B;  3EDU A;  5LHI B;  4YTP A;  4ZS3 A;  4DR7 T;  2MBG A;  4LMK A;  4UV9 B;  5AQU B;  2VVS A;  3AAE B;  2V5C A;  4DV5 T;  2L9Q A;  2FUP A;  2RP4 A;  3ZYK A;  3LFM A;  3UQ7 A;  4OFZ A;  1YW0 A;  3RX6 A;  5TVC A;  3CQC B;  1MMG A;  4ZEY A;  4H63 H;  5JR9 A;  2XYT A;  4ALX A;  5LA6 E;  2BG9 C;  2IIU A;  4TWD A;  3RYI E;  3N9P A;  5C3J A;  2K48 A;  5LBM A;  2Y6X A;  1D1B A;  5LNK A;  3ZYM A;  2KND A;  5AQT B;  1MNE A;  5JDH A;  3E08 A;  3T8O A;  2JQQ A;  2D0T A;  3H3A A;  4DR1 T;  4AKG A;  5FL0 A;  2YEV C;  3RRC A;  2AE9 A;  1HG5 A;  5KXJ A;  1T72 A;  2YKS A;  3NWI A;  5FNV E;  4UXU A;  2J47 A;  3ZN1 B;  4IL4 A;  4O4I E;  1YD8 G;  2XZ5 A;  2V6Y B;  5JRC A;  3O1H A;  3C51 A;  5KDM C;  4C91 A;  5CA1 E;  1N32 T;  4QHO A;  3PU8 A;  3SS1 A;  3NBX X;  3KBT A;  1UW6 A;  4LF7 T;  3AE5 A;  3MA9 A;  1D1C A;  1S35 A;  4JI0 T;  4UEL A;  3DJB A;  4P1N A;  3GA8 A;  2BYR A;  3JAF A;  4DV6 T;  1NWM X;  3SOL A;  5KX5 E;  4IST A;  2VL8 A;  2BDE A;  2Y48 B;  3AVR A;  3AA0 B;  2YIN A;  1OED A;  3WAK A;  3ZT5 A;  3H37 A;  4DR5 T;  2NR4 A;  2YDS A;  3RHW A;  4A97 A;  3NRX A;  4CN6 A;  2XNV A;  2XZE A;  2AXD S;  1IZN B;  2IAK A;  3R84 B;  4PW8 A;  2NP9 A;  3VRB A;  4B3T T;  4GK0 E;  1US7 B;  2V7M A;  4H63 V;  4IT4 A;  4DV0 T;  4YSX A;  3ZCI A;  1I6Z A;  1MIY A;  4HFE A;  1MIV A;  4DV4 T;  1WR6 A;  5AFM B;  3N9O A;  2ZMA A;  3SRZ A;  2IW5 B;  1ZKE A;  2DWK A;  3A7M A;  2C9T A;  3I1A A;  3UUL A;  4ZR6 A;  2LRK A;  3N2K E;  2A9U A;  2BYP A;  2X66 A;  4A56 A;  2B1E A;  4QKN A;  3ZC1 A;  2XTL A;  3N9N A;  5DQV A;  4YLH A;  3MJX A;  2EHO B;  2PG8 A;  5FYM A;  4ILU A;  3HL6 A;  4GKJ T;  2Q9Q B;  2VKD A;  3CML A;  4UM3 P;  2HHH T;  4DMW A;  3C84 A;  1G8X A;  3AAI A;  4B3R T;  5J5G A;  3GUA A;  2UUA T;  3ZN0 B;  2XQ7 A;  2OLT A;  4K0U A;  4PJN A;  5AQP B;  4CXX A;  4EV6 A;  4DID B;  4ZHQ E;  2BR8 A;  3ONJ A;  5J5I A;  3EHZ A;  4KHP T;  4DBM A;  4MLK A;  4IE6 A;  2BG9 A;  1YKH B;  2YME A;  3WTJ A;  4HFI A;  2Y8D A;  4PJL A;  4UY2 A;  4ASK A;  3FHN A;  4QXH B;  3AE4 A;  5EK3 A;  5JME A;  1LVF A;  3WTI A;  4ZI3 C;  2WNC A;  2VQF T;  5JR9 B;  4LML A;  3Q5D A;  5JDN A;  3E22 E;  3L3P A;  3RIU C;  5HXS A;  1U5P A;  1GQE A;  1XDP A;  5EK2 A;  2X9H A;  1HX8 A;  4YXD A;  4UM1 A;  4BFQ A;  2CXD A;  4I43 B;  2IUB A;  3PUA A;  4XBF B;  1QLB A;  2EHO C;  2H7V C;  3AXJ A;  2X0H A;  2IDO B;  5IUX A;  5BMV E;  2HN1 A;  3ZMV B;  2HH7 A;  2W62 A;  2Z6E A;  1MMN A;  3U3I A;  1WR0 A;  3M3Z B;  4DR6 T;  5AQG B;  4LF6 T;  5CA0 E;  4QXB B;  2WZY A;  5JRC B;  2WM9 A;  4GIW A;  3AEF A;  2XM2 A;  4AQF C;  4I0U A;  5E0O A;  3O1J A;  4PK6 A;  2B76 A;  3AEE A;  3C98 B;  2PBI A;  4AXP A;  3F31 A;  4CN1 A;  5L3D B;  2PTF A;  2VKH A;  5FJV A;  5FXW A;  4TUY E;  5SYO A;  3MAC A;  5CO5 A;  2W66 A;  5L3B B;  2ZM6 T;  4ZK4 A;  3WTH A;  1OED E;  1OED B;  4OX9 T;  5AQV B;  1Y64 B;  2WWV A;  1SE7 A;  3LBX A;  2C5I T;  4B5D A;  4A98 A;  1W0B A;  2QVA A;  1HCI A;  4ILA A;  3N9Q A;  3C50 A;  1I9B A;  1HFA A;  2LT3 A;  2MYS A;  2BKN A;  5BW2 A;  1Z0P A;  4JI2 T;  4HE8 A;  1MIW A;  4EB6 E;  1VCS A;  2WBL A;  2V6Y A;  1HNW T;  4H9N C;  2JPF A;  5L3C B;  1IBK T;  3P50 A;  3OBV E;  3UU8 A;  3N9L A;  5IYZ E;  4PFO A;  5L4H A;  2A2F X;  3I0O A;  3P8C D;  3M65 A;  4FJO A;  3RLF F;  3BK9 A;  4HWC A;  2CCQ A;  3ZT6 A;  3UFG A;  2FBW A;  3UT5 E;  3ABV A;  2WZI A;  3QK6 A;  2N9D A;  2QYW A;  2PH9 A;  4HKA A;  2QGS A;  4HWH A;  3N2G E;  5AFL A;  3BQK A;  4EXT A;  4YT0 A;  3JC6 C;  2WSS V;  2JRK A;  4EYY R;  1T7S A;  3J9X 1;  4ADZ A;  1HF8 A;  3PEO A;  4I4T E;  4JV5 T;  2IHR 1;  1MND A;  4O8S A;  2BZB A;  2FJD A;  5KE4 A;  2J4G A;  4MFR A;  5HEU A;  5JDG A;  3U78 A;  3UUM A;  2YMD A;  4NZB A;  3GWH A;  4QAA A;  2DI4 A;  2YN6 A;  1D1A A;  3J7Y q;  2CM0 A;  4NPP A;  3P7I A;  2BG9 E;  2BG9 B;  4J2C A;  4A5X A;  5LJN A;  3RI5 A;  1ZEE A;  3TLS A;  2DL1 A;  3RIU A;  3RGL A;  3VR9 A;  4ZRU A;  4EZ1 A;  1H7C A;  2KWI B;  3ZST A;  2BBJ A;  1E7P A;  3EVY A;  1MMA A;  2G0U A;  4U7Y A;  2XAS B;  2XQA A;  4IE0 A;  2EHO A;  2V5D A;  3P4R A;  5AQO B;  3PUR A;  3WTL A;  3FZK B;  3QUJ A;  4HGA A;  1BR4 A;  1WYC A;  3T4M A;  4DV2 T;  3SFE A;  4CN4 A;  1IJ6 A;  2L8K A;  5CFB A;  3FBZ A;  2LOS A;  3JC6 D;  4E7S A;  1N33 T;  4UVA B;  2VWA A;  3LJC A;  4XHE A;  3FB2 A;  3V5U A;  3AXJ B;  1WFD A;  3ZJ2 A;  4UR9 A;  3Q2M A;  3EI0 A;  2CPT A;  5LOV E;  4JI7 T;  4NUV A;  4JEU B;  2VK9 A;  4I50 E;  3SWH A;  2ODV A;  3CPZ A;  4DV7 T;  3AE7 A;  4QXC B;  3LK3 B;  1FMV A;  4F8H A;  5LG4 A;  4TV9 E;  3PJA J;  5H6Q B;  2Y56 A;  1T8B A;  1U4Q A;  5LB7 B;  4IIJ E;  4QH4 A;  4EYU A;  5LP6 E;  2UUB T;  2A72 A;  4KBM B;  3ZKR A;  3PUZ F;  2NW7 A;  5JVD E;  3PTR B;  4PFP A;  2YK0 A;  3RC8 A;  3UU3 A;  3KV5 A;  4IDO A;  5AFN A;  4TZ4 C;  4EAH A;  4X5T A;  4FI5 A;  3HKB E;  3LBX B;  3IEE A;  3WTK A;  4IDN A;  2LM2 A;  4UM3 S;  3VKH A;  3F2E A;  4Z91 A;  2NTX A;  2D5U A;  4O2A E;  1G73 A;  3IA3 A;  3ZCJ A;  5JRE A;  3A8Y C;  1WYB A;  3KDS E;  2Y54 A;  5AQK B;  2LJL A;  4B3S T;  5GON E;  1YQ4 A;  5ABE A;  5JDF A;  4NUU A;  3VR8 A;  2FJA A;  3W15 B;  2UXD T;  2SPC A;  3E0Z A;  4P0B A;  4AKL A;  3EAM A;  4WZX A;  2BS2 A;  1IAP A;  2V7J A;  4U2Y A;  4DR4 T;  2ZM0 A;  5LBQ B;  1LVK A;  4YJ2 E;  5FKY A;  3SQ9 A;  1E1H B;  4EZH A;  3LSV A;  4NIQ A;  2E9X C;  4PK5 A;  2XQ5 A;  3RRW A;  2X68 A;  1SUM B;  3PMZ A;  1UUR A;  2V26 A;  4HFB A;  1DU2 A;  2KMF A;  2W0G A;  4TNW A;  3HKD E;  3FZL B;  1UV6 A;  2ZJV A;  2LKH A;  5ETW A;  5LYJ E;  3VHL A;  2WB5 A;  5BR8 T;  2V7I A;  3VKG A;  2HPJ A;  3ETU A;  4O2B E;  3I0Q A;  1UX2 A;  4EZ4 A;  2KSR A;  2HN2 A;  4YJ3 E;  1XMQ T;  2BVM A;  3CK6 A;  3FXE B;  2ZJU A;  3NRY A;  4M1P A;  2YOE A;  4OK0 A;  4QWN B;  5HAX A;  5HWX A;  2NOX A;  1W09 A;  2Y58 A;  3C4Z A;  2L3L A;  4X1Y E;  4FRR A;  5FY0 A;  4YHH T;  2BJ0 A;  5AQS B;  2XQ9 A;  5LXT E;  4YTN A;  3VRA A;  4YSY A;  3TKL B;  2LSK A;  2K3W A;  5FP3 A;  4OYJ A;  2UZ6 A;  1BR1 A;  1WLX A;  5L2L A;  1KNR A;  2W67 A;  3HR0 A;  3ONL C;  1EZ3 A;  4IDQ A;  2ES0 A;  2E9X D;  2XNT A;  2LSJ A;  5HYA A;  2ODU A;  3ZDG A;  2JIW A;  5BRX A;  2M6B A;  3TLW A;  3ZMZ B;  3FXD B;  3SFD A;  2M67 A;  2XPK A;  3T1Y T;  1CHU A;  5AQN B;  2XAH B;  4AQG A;  2M6I A;  5M4Y A;  4JBW F;  3KVA A;  4I55 E;  3K3Q C;  4EGW A;  2CWO A;  4H9R C;  3RKG A;  3LK4 2;  5LHG B;  2BS3 A;  3TLU A;  4DND A;  4UXN B;  4JI6 T;  5JQG E;  4JI3 T;  4UVC B;  2BKP A;  2RA1 A;  5DQW A;  5EK4 A;  2D9D A;  2W63 A;  5F3J A;  4DR3 T;  1IBM T;  3AA7 B;  4DO0 A;  3AA6 B;  3QOF A;  5LMN T;  3NKZ A;  2WDQ A;  4HFV A;  1YQ3 A;  2H88 A;  3MK7 C;  2PJQ A;  3MZK B;  5L47 A;  1ZV4 X;  3P4Q A;  3ZJ1 A;  2BYQ A;  2OV9 A;  3OYX A;  4U3C A;  4DMV A;  2LSY A;  2Y57 A;  4B3M T;  3FBL A;  2C5K T;  2V6X A;  2NWB A;  2IC6 A;  1W0A A;  2DCF A;  4CI3 B;  1M7K A;  5LMU T;  2CMR A;  5L3F B;  2ACZ A;  3PE0 A;  2KLQ A;  3I9Y A;  2BVL A;  4ZJT A;  3OYZ A;  1FIO A;  4L9I A;  4AI6 A;  4U72 A;  4AQY T;  2XZ6 A;  4U33 A;  2E2A A;  3WTM A;  4H9Q C;  3UTK A;  3NZP A;  2XQY A;  3ZMT B;  4ZI2 C;  2W8F A;  2JQ9 A;  2N1G A;  3PU3 A;  5CGM A;  1BR0 A;  4CXW A;  2FJB A;  3QC9 A;  4AFT A;  5J5F A;  3N2O A;  2V8S V;  1FJG T;  3CIR A;  1XWM A;  5FY1 A;  2N2N A;  3AEB A;  3UUX B;  5AIN A;  5LXB A;  2BR7 A;  3HKC E;  4QAB A;  5AFJ A;  3HKE E;  3U8M A;  4ZI7 E;  2W00 A;  3ZYL A;  4PJJ A;  1R8I A;  2WAU A;  3WTO A;  3IGQ A;  2XAG B;  1ZHC A;  3IBP A;  4D01 A;  2WN9 A;  5FMN A;  4KI0 F;  5AQF B;  2X0Y A;  3P4S A;  4YTM A;  4L5G A;  4ZZC A;  5AQR B;  2NTY A;  2R6G F;  4PIR A;  3UQ4 A;  1JNZ A;  3EUH A;  2W4X A;  4COF A;  3KIN B;  2QA7 A;  3PUQ A;  5FXV A;  2C5J A;  3L09 A;  4QH5 A;  3KV4 A;  2Q9Q D;  1D0X A;  4LF5 T;  4IL9 A;  5FVK A;  1KF6 A;  1SA0 E;  2X9X A;  2F4V T;  2NW9 A;  4LFA T;  2WDV A;  1NEN A;  3B13 A;  1WCR A;  4ZXL A;  2WU2 A;  2KWH A;  4ISS A;  1KK7 A;  4ZI2 D;  2WWU A;  4XZC A;  2FJE A;  3AE8 A;  3PUX F;  2A3D A;  2XSA A;  4LF4 T;  3PUW F;  1HNZ T;  2LLY A;  4JI8 T;  3OKQ A;  3RYH E;  3PJA A;  4IGU A;  2WS3 A;  2XNU A;  4DUY T;  4F6R C;  1CUN A;  3CX6 B;  1UGO A;  4UF0 A;  4LF8 T;  2KT9 A;  4BAY B;  2H7O A;  3HI2 A;  5ABF A;  1E2A A;  3AE2 A;  5HXR A;  3O4X E;  3BQL A;  3OPC A;  1UK5 A;  3I9W A;  2JQK A;  1KFY A;  5FXX A;  3ZC0 A;  4EIW A;  1D0Y A;  5AQL B;  2K24 A;  3C4X A;  4ILC A;  4U31 A;  1NEK A;  2VAS A;  5KZU A;  3RIF A;  3AEC A;  4ILB A;  1I94 T;  5HWY A;  4MAL A;  5L4E A;  3ETV A;  4X20 E;  2ZM8 A;  2XUE A;  5LGN B;  3DP7 A;  2PGZ A;  5HEH A;  2LM9 A;  2XM1 A;  3JAD A;  3KFW X;  2JJ9 A;  3UFE A;  2X0L B;  3KV9 A;  4TWH A;  5ABG A;  2CEA A;  4WYV A;  4AQF A;  4AKH A;  3AEG A;  4V1A v;  2X00 D;  1QUU A;  1MMD A;  4C90 A;  3RQW A;  2E9X B;  1M62 A;  5HEO A;  3SQ6 A;  5HXH A;  4U2Z A;  2X9W A;  4AFH A;  1XZY A;  4GYR A;  5AQI B;  1FMW A;  2C0S A;  4AKI A;  3EAB A;  3MKD A;  3K3N A;  5AQJ B;  2E5L T;  4LFB T;  3R6N A;  3WAJ A;  4Z8X A;  4DVD A;  2DNX A;  4AKR B;  3WTN A;  2UXB T;  3V5S A;  3ZEF B;  4LFC T;  2PFV A;  3H3M A;  2DLR A;  2LOP A;  2LRL A;  5AQM B;  3L39 A;  3UU6 A;  3U8J A;  4YFS A;  3ZMS B;  4H9P C;  2CRB A;  2V1D B;  4UM3 A;  1XDO A;  4QX8 B;  3PDY A;  2W61 A;  1X79 A;  2CLY C;  4Q25 A;  4LMJ A;  2W8G A;  4CXY A;  2VKJ A;  2VUR A;  4HFH A;  1ZOY A;  2WP9 A;  3ONX A;  3VU7 H;  2WQY A;  5AFK A;  5HEG A;  4OYK A;  2KXP B;  2CHO A;  2NW8 A;  3AVS A;  4TN7 B;  4WBN E;  5J2U E;  1JNR A;  3A5X A;  2CXF A;  5AQH B;  5HCJ A;  4KP3 C;  5IHY A;  4EOZ B;  1KNZ A;  3RPU A;  3FZM B;  3D0T A;  4PAG A;  2JMK A;  3AE6 A;  2ZM2 A;  4JLE A;  2KIN B;  3JCF A;  1QSD A;  3ANW A;  2CHN A;  2UXC T;  4AIU A;  1B7T A;  3NVO A;  2XSB A;  3Q5W A;  1HTJ F;  2X00 A;  2JQH A;  3KVB A;  2CXL A;  4WNK A;  5LGT B;  2WDR A;  1HS7 A;  3AE1 A;  4LF9 T;  1N36 T;  5AFH A;  5JDL A;  1YKE B;  3C64 A;  4JEH B;  3DTO A;  5FY7 A;  2YU1 A;  3MXZ A;  3U8N A;  2MAW A;  4BA9 A;  3WIP A;  1VOM A;  3C4W A;  2BYS A;  5LJM A;  2D0U A;  1HR0 T;  2MTQ A;  4PJM A;  5C8Y E;  4DV1 T;  4JYA T;  4GOU A;  5L3E B;  2P9B A;  3ZMU B;  2CA5 A;  4UF0 B;  5ABF B;  3B5M A;  4OHF A;  3EDV A;  3SIO A;  4WBO A;  2V7K A;  4XK9 A;  4JI1 T;  2WZH A;  2W2U A;  2BYN A;  1J5E T;  3UUN A;  3CX8 B;  4HWD A;  4UV8 B;  3ESL A;  4YY3 T;  4H9S E;  4MHC A;  5CJ5 A;  2J1D G;  3KV6 A;  3RH3 A;  3WI3 A;  4K0K T;  5AQQ B;  3K8P C;  1SHZ C;  1HNX T;  5LCY A;  3AEA A;  3PV0 F;  4HEA A;  3LK2 B;  4X66 T;  2IC9 A;  4ANJ A;  3RYF E;  4U7I A;  4L0R A;  4IE5 A;  4CQI A;  4PNI A;  1J1J A;  4JI5 T;  5AFU L;  3PUV F;  3O1I A;  2H89 A;  3K1S A;  4O4H E;  3UU4 A;  3IF8 B;  3SH1 A;  3RIA A;  4X1I E;  3X1D A;  3LDQ B;  3Q9D A;  3F57 A;  2CBJ A;  1LKX A;  2J62 A;  5TAO A;  2OA5 A;  2MPK A;  1LRZ A;  2XHE B;  5HXC A;  5JTG A;  3GN5 A;  3Q5E A;  2D2S A;  3LG7 A;  2ZLY A;  3ZT7 A;  2BS4 A;  2ACX A;  2WNL A;  3FZH B;  3TLV A;  2E8I A;  2WMO A;  4DBR A;  1WRD A;  2YDQ A;  2XAQ B;  1AJ3 A;  2XQ8 A;  4MBQ A;  4YHJ A;  4B6X A;  4JI4 T;  4UVB B;  2JMH A;  4QAC A;  2LSI A;  4JUY A;  2Y7Y A;  4IE4 A;  5J2T E;  4KMC A;  4TV8 E;  2WCA A;  3PUS A;  3N5L A;  5LG3 A;  3P4P A;  1HX1 B;  1KEY A;  3AB3 B;  4GKK T;  4Z90 A;  4IDZ A;  2I59 A;  4G63 A;  1IJ5 A;  5J5H A;  2XAF B;  5FXZ A;  3ZLI A;  2UXX B;  3ZPO A;  2XQ4 A;  4UEM A;  2E5V A;  4O4L E;  4HTE A;  1Y01 A;  5KMG P;  1OXZ A;  4KX6 A;  5IWA T;  5DAB A;  4EEB A;  3NZQ A;  4KHZ F;  2XAJ B;  3AA1 B;  2E9X A;  1VCT A;  2Q9Q C;  4NXN T;  4HN9 A;  1VRB A;  3OJA A;  2X67 A;  5JH7 E;  4X65 T;  2I6H A;  4KUM B;  4X64 T;  4DV3 T;  2K9A A;  2DHR A;  3CQG B;  4QX7 B;  3L8R A;  2V7L A;  2UUC T;  3KBU A;  1XNQ T;  2VB6 A;  4ZS2 A;  4TNV A;  1V9D A;  2H3R A;  4NXM T;  4HFC A;  3ANW B; 
#chains in the Genus database with same CATH homology
 3WTL A;  4QAB A;  5AFJ A;  5HEJ A;  3UU5 A;  2BYR A;  3U8M A;  4FRR A;  3WTN A;  3JAF A;  2WNJ A;  5L47 A;  2WNL A;  2Y54 A;  2BJ0 A;  3T4M A;  3TLV A;  2XQ9 A;  2QC1 B;  4LMK A;  2BYQ A;  5HCM A;  3WTO A;  3IGQ A;  3UU6 A;  5CFB A;  4ILC A;  2WZY A;  1OED C;  2PH9 A;  4UM3 P;  2XQ8 A;  3U8J A;  3C79 A;  4D01 A;  5KZU A;  3RIF A;  3C84 A;  2WN9 A;  2UZ6 A;  4ILB A;  5AFL A;  4UM3 A;  4XHE A;  1OED A;  3UQ7 A;  5J5G A;  3GUA A;  4HQP A;  2Y57 A;  4ZZC A;  5L4E A;  2XQ7 A;  3EAM A;  4HFD A;  2LKG A;  3UQ4 A;  4PIR A;  4QAC A;  4WV9 A;  3SIO A;  2Y7Y A;  5TVC A;  3EI0 A;  3P4W A;  4LMJ A;  4QH1 A;  4ZJS A;  4XK9 A;  2W8G A;  5LXB A;  4COF A;  4HFH A;  5LG3 A;  2BYN A;  2BR8 A;  2PGZ A;  5HEH A;  2XNT A;  2XYT A;  5FJV A;  3RHW A;  2BG9 C;  3SQ9 A;  3EHZ A;  4ALX A;  3PEO A;  5AFM A;  3JAD A;  3LSV A;  5J5I A;  4A97 A;  4Z90 A;  2VL0 A;  4TWD A;  3ZDG A;  2XQ5 A;  5AFK A;  5BRX A;  4DBM A;  2M6B A;  5SYO A;  4QH5 A;  3TLW A;  5KE4 A;  5HEG A;  3RQU A;  2XNV A;  2BG9 A;  4F8H A;  3PMZ A;  5CO5 A;  4IL9 A;  2YME A;  3JAE A;  4HFB A;  4ZK4 A;  5J5H A;  2XQ6 A;  4IRE A;  3WTJ A;  4HFI A;  3U8K A;  3WTH A;  4TWH A;  2Y56 A;  1OED E;  4UY2 A;  4ZJT A;  1OED B;  5HEU A;  5HCJ A;  4TNW A;  2M6I A;  2XQ4 A;  1UV6 A;  4QH4 A;  5JME A;  2ZJV A;  4ZK1 A;  3WTI A;  2LKH A;  2YMD A;  4B5D A;  4A98 A;  2XZ6 A;  3ZKR A;  4NZB A;  4QAA A;  2WNC A;  2X00 D;  4ILA A;  2YN6 A;  3WTM A;  3UUB A;  4LML A;  4HFE A;  1I9B A;  4BQT A;  5AFM B;  4NPP A;  3UU3 A;  3TLU A;  1UX2 A;  2YKS A;  2KSR A;  2W8F A;  2LLY A;  2BG9 E;  5AFN A;  5BW2 A;  2BG9 B;  4ZZB A;  3U8L A;  4UXU A;  3RQW A;  2X00 A;  3RI5 A;  2XQ3 A;  4TWF A;  5J0Z A;  5HEO A;  4IL4 A;  3TLS A;  3SQ6 A;  4X5T A;  3TLT A;  2XZ5 A;  2C9T A;  4AFG A;  4UM1 A;  5AFH A;  3UU4 A;  3SH1 A;  2XNU A;  3RIA A;  4ZR6 A;  4ZRU A;  3WTK A;  4AFH A;  4AFT A;  4BFQ A;  3ZDH A;  4EZ1 A;  2LM2 A;  2XYS A;  2ZJU A;  5J5F A;  4UM3 S;  2YOE A;  3P50 A;  4Z91 A;  2BYP A;  3U8N A;  3UU8 A;  1UW6 A;  4TNV A;  2MAW A;  5BP0 A;  2XQA A;  5L4H A;  2Y58 A;  3WIP A;  5IUX A;  4HFC A;  2BYS A;  5AIN A;  2BR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...