5HEHA

Pentameric ligand-gated ion channel glic mutant p246a
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLAKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Proton-gated ion channel
publication title Signal Transduction at the Domain Interface of Prokaryotic Pentameric Ligand-Gated Ion Channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 85
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hehA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hehA01
2Y58A 4ILCA 3RQUA 4UM3P 2XNUA 2WNCA 2XQ9A 4HFEA 3UQ7A 2XNVA 3U8LA 5J5IA 3TLVA 5AFMB 2BYNA 2BYQA 3WTKA 4PIRA 4UY2A 2WNJA 3JAEA 3C79A 3ZDHA 3ZDGA 3RI5A 3UUBA 5AINA 2MAWA 2KSRA 1UX2A 3T4MA 2XQ4A 3U8KA 4D01A 4ZR6A 3TLTA 5LG3A 2UZ6A 5L47A 5BW2A 3RHWA 2Y54A 4TWHA 5AFHA 5BRXA 5LXBA 4Z90A 4B5DA 5HEJA 4ZRUA 2WZYA 3U8MA 2XQ7A 2Y7YA 2LKGA 4UM3A 3EAMA 5AFLA 4HFCA 4ZZBA 3TLUA 3UU8A 5KZUA 2BG9E 3WTHA 5IUXA 4ALXA 3C84A 4IL9A 2W8FA 4NPPA 4FRRA 5CO5A 2M6BA 3WIPA 5KE4A 4TNWA 2BYPA 5AFNA 5J5GA 5L4HA 4LMJA 4X5TA 5AFMA 2XQAA 1OEDC 4AFTA 4EZ1A 5HEGA 2XZ5A 3SIOA 4ILBA 4QH5A 2YMEA 3WTJA 3WTLA 2BR8A 5AFKA 4LMLA 3RIFA 4ZZCA 3GUAA 1OEDB 5TVCA 5CFBA 1I9BA 3UU4A 2YMDA 4UXUA 3RIAA 4BQTA 3IGQA 3WTMA 2XNTA 2XQ3A 2Y57A 3ZKRA 1OEDA 3PEOA 2BYRA 3U8NA 4HFIA 4BFQA 4A97A 2WNLA 2PGZA 2XQ8A 4TWDA 5HCMA 5HEOA 2XZ6A 2Y56A 3RQWA 4DBMA 3UU3A 2VL0A 2LLYA 5HEUA 3PMZA 4UM3S 5HEHA 4F8HA 2ZJUA 2BJ0A 3P4WA 2M6IA 3WTNA 3SQ9A 5J5HA 4IREA 3WTIA 4UM1A 3UQ4A 3SQ6A 4QH4A 4ZK1A 5JMEA 2XQ5A 4TWFA 4QABA 2XYTA 3SH1A 2ZJVA 5J5FA 1UV6A 5AFJA 5L4EA 3TLWA 2X00A 4HFBA 4AFGA 2WN9A 2LM2A 4QACA 3TLSA 4IL4A 2W8GA 4HFHA 4AFHA 2BYSA 2YN6A 5HCJA 2X00D 3JAFA 2BR7A 3EI0A 1OEDE 4HFDA 3UU6A 4HQPA 2BG9C 5BP0A 2C9TA 3EHZA 4ILAA 4TNVA 4WV9A 2YKSA 3LSVA 4Z91A 4COFA 4LMKA 1UW6A 2QC1B 4XHEA 2YOEA 2PH9A 3WTOA 2BG9B 4QH1A 3UU5A 5FJVA 4ZJSA 4NZBA 3U8JA 4A98A 3JADA 4ZJTA 4XK9A 4QAAA 4ZK4A 2LKHA 3P50A 2XYSA 2BG9A 5J0ZA 2XQ6A 5SYOA
chains in the Genus database with same CATH superfamily
3ZJ2A 2J4GA 1NENA 4UM3P 3UQ7A 5J5IA 2VKHA 4HTEA 1E2AA 4PK6A 1BR1A 2WWUA 4BAYB 5LG3A 2UZ6A 2K3WA 1WCRA 4B6XA 2FBWA 1W0BA 2XZEA 3NKZA 3R84B 5HXSA 2GK9A 2UU9T 2JRKA 2D2SA 4HWCA 3SFEA 2CLYC 3RYFE 3WIPA 3CVRA 3GWHA 2E9XA 4DV3T 3N9NA 2QGSA 3SIOA 4QH5A 4A5XA 3GUAA 2I0MA 5AQRB 2LOSA 1ZHCA 5C2TA 1FMWA 4QWNB 5FVKA 3RH3A 4ISTA 4JUYA 2FJEA 5F3JA 1CUNA 2PGZA 1UX4A 2CE7A 4EIWA 3X1DA 3HL6A 2B76A 4F8HA 2XM2A 2KZ7B 2IMLA 2KMFA 2CWOA 4TUYE 3ZMVB 3VR9A 2K24A 4IDZA 3A5XA 3PV0F 1HNZT 4HFHA 3CX7B 1JNZA 2C0SA 3JAFA 4H9SE 5KX5E 3ANWB 4KUMB 3ZMTB 3UU5A 2J1DG 4CI2B 1FEWA 1WYBA 2IUBA 2XYSA 3KDSE 1E1HB 2C5KT 4EYUA 5FL1A 1ZEEA 5LGNB 2B1EA 4DR2T 4J2CA 4MFRA 2KSRA 2WWVA 3N9QA 1MMNA 2CBJA 4JEHB 3FZFB 4TWHA 5LXBA 3AVSA 3IEEA 2XJ7A 5JQGE 4UM3A 3AAEB 4B3RT 2V7LA 3TLUA 5CGMA 5AQSB 2E9XB 2N2NA 1UGOA 2W8FA 3ZMZB 1XDOA 3KV5A 3G06A 4TZ4C 2X9HA 3ESLA 3NZQA 3N9OA 2BR8A 1YD8G 4LMLA 2HPJA 3SWHA 4OYJA 5AQVB 5FXXA 1J5WA 4O2BE 1HX1B 5JREA 3ZKRA 3LBXA 2X68A 1KNPA 3EDUA 1HFAA 2A2FX 1XWMA 4H9RC 1X9BA 4UM3S 5AQOB 4OK0A 5LBQB 2CCQA 4AKHA 2XQ5A 4QABA 2XYTA 2MPKA 5AQGB 4MLKA 3AE1A 2VK9A 5JTGA 1W0AA 1O3XA 2Y48B 4XZCA 2YN6A 2JJ9A 4YFSA 2NTYA 1IZNB 3GMIA 4JI0T 4ZJSA 3U8JA 2W00A 3NVOA 1N32T 4P0AA 4ZI3C 2JMHA 2WNCA 4UXNB 3TLVA 4ILUA 1XMOT 2BYQA 4DV0T 4NXNT 2CHOA 1D1AA 2Q9QD 4PJNA 1ZP0A 4B5DA 5HEJA 4IDQA 3UT5E 4AQFC 2CXDA 5IUXA 5KDMC 1FIOA 2XQYA 3QK6A 2CA5A 4UELA 2XZ5A 5L3GB 4CN4A 3PJAJ 1KF6A 1UUSA 4UXUA 3LBXB 4ZS2A 5L3EB 2WBLA 5GONE 4MHCA 4DR6T 3C4ZA 4HWFA 4AKGA 4BJNA 5DQVA 3MXZA 3QNUA 4JI8T 3AE2A 2OLTA 4KP3C 5L4EA 5AQMB 4LF4T 3TLSA 2WMNA 2WP9A 2E8IA 5LB7B 3RYIE 4HQPA 5JVDE 4TV9E 4COFA 4YXDA 2F4VT 4A98A 5JDMA 1I94T 3E0ZA 2FJDA 3VU7H 2WZIA 1ZOYA 5AQJB 4P09A 4UV9B 2WDVA 2NW7A 2VURA 4IDNA 2YU2A 4DBQA 2IAKA 4UY2A 2BDEA 5HXRA 2MAWA 4UVBB 2JQ9A 3U8KA 4DR3T 3RHWA 2Y6XA 4B3MT 2NR4A 2WZYA 1H7CA 4X1YE 4ISSA 1D1CA 3C84A 5AQLB 5DABA 5FYMA 3ETUA 4GKKT 2L9QA 3CIRA 4X5TA 3S4UA 4WNKA 3VKHA 5LOVE 3AEGA 3AAAB 4U74A 5CFBA 2Y8DA 1HG5A 2NTXA 5AQNB 2WAUA 4IDOA 2NW8A 2XQ8A 3JC6C 5JDNA 2C5JA 2ZJUA 3AE5A 3Q9DA 5J5HA 3F57A 2Z6EA 5AFUL 5AQIB 3AE9A 4TWFA 1M62A 3NZPA 3SH1A 3P4QA 3AEDA 5AFJA 1QLBA 3CK6A 4HFBA 3O1HA 2W4XA 4JI1T 1OEDE 3UU6A 2LT3A 2C5IT 3R6NA 5CA1E 3OJAA 4FI5A 2VVNA 2J62A 3SFDA 2W66A 3GA8A 4YTPA 3NRYA 3ZPOA 1N33T 3QUJA 3KBUA 3CQXC 3HKDE 2LEHA 2YINA 4HEAA 4KMCA 3MKDA 3V5SA 2QA7A 2MBGA 1U5PA 5BW2A 3OYXA 2VQET 4Z8XA 2KNDA 2YU1A 3N2KE 2XPKA 1R8IA 3I9YA 2Q9QA 5KE4A 2CLYB 1N34T 5EK3A 3OYZA 1OEDC 2N1GA 4ILBA 1LRZA 3WTJA 2IHR1 4U2ZA 4WYVA 2X51A 3M3ZB 3RC8A 2WZHA 2V26A 1WR6A 3WTMA 1UURA 4HWHA 4B3ST 4X1IE 3SOLA 3JC6D 3M65A 3IBPA 2JIWA 2AE9A 2VASA 2VL0A 4GIWA 4TV8E 5LHHB 5LHGB 3PUVF 4AQYT 3SRZA 2K48A 4L9IA 2XAGB 4JI4T 3K3OA 3KVAA 2R6GF 4DV5T 1M7KA 5KMGP 2UXXB 2VKOA 2DHRA 3I9WA 2WQYA 2X0YA 2BS4A 5LJNA 2H3RA 3ZT6A 4ERRA 5LMUT 4ILAA 2DCFA 4YJ2E 2YOEA 4GYSA 2PH9A 4O4IE 5CA0E 4ZOLE 5FJVA 3KINB 4DR4T 4TX5A 2MTQA 4ZJTA 3P50A 2V6XA 4FJOA 5BMVE 3DP7A 4HFEA 2X9YA 2WNJA 3UFGA 3ZDGA 3UUXB 3AEBA 4QXHB 4PNIA 2CMRA 2XQ7A 3HR0A 3EAMA 2E5LT 3AECA 3LDQB 4YSYA 1IAPA 2YK0A 2BYPA 2PJQA 4C90A 2LSKA 4AQFA 5C3JA 4AI6A 4YHHT 4UF0A 2LSGA 3HKCE 2QRXA 4ADZA 4EZ4A 1MMDA 3ZSSA 4O2AE 4I4TE 5FKYA 2XNTA 1J1JA 1L0VA 4Q25A 5HCMA 1AJ3A 3D0TA 2OV9A 5FP3A 3KV6A 2M6IA 3FZHB 5FVLA 1MMGA 4G63A 2ZJVA 3PUXF 4TN7B 1UV6A 2LM2A 2UUCT 3TKLB 3ZSTA 4HFDA 2D0UA 3RIUC 4WV9A 4ASKA 5L3DB 5IWAT 4A56A 2OA5A 3B57A 3FHNA 2HPLA 4HE8A 1YQ3A 4PJLA 4K0KT 2NP9A 4ILCA 2W61A 3RQUA 4KHZF 5AFMB 3WTKA 2V5CA 4L0RA 5ABHA 4UVAB 5LYJE 4EV6A 3PURA 2NW9A 2VKDA 3N9LA 3UUMA 5LHIB 2PTFA 4U31A 5ABFA 2W62A 4CZZB 4ZI2C 2M6BA 3PUQA 4UF0B 4LFBT 2XQAA 4E7SA 2E2AA 3C64A 3U3IA 3RRWA 5JRCB 5ABGA 3RIAA 4MBQA 3PEOA 4IHJE 2BYRA 4PFOA 4JI6T 4GYRA 4YSXA 3PUYF 5HEHA 1NWMX 5FXWA 1JNRA 4UIGA 5LMNT 2L8KA 2WM9A 3ZEFB 4F6RC 2YEVC 3ZYKA 4JI3T 3FXEB 4AKRB 2JQQA 4HWDA 4X66T 3H3MA 2K5BB 2YKSA 5M4YA 3L8RA 3AEAA 2G0UA 3ABVA 5AQHB 4DMWA 1XZYA 3BQIA 2LKHA 4GKJT 4X1KE 4JI7T 2Y58A 3FXDB 4U7YA 3F31A 2XNUA 2XNVA 4CQIA 4O4LE 4O4HE 3IF8B 2DWGA 2LOPA 1WR0A 2CM0A 1MIWA 3L3PA 2RP4A 5L47A 1S94A 5ABFB 2H89A 4JBWF 5AFLA 3C4XA 4ZI2D 2LE8A 3WI3A 3FZMB 4PFPA 3ZT5A 2JMKA 3W15B 2BBJA 3LFMA 3AXJA 2NOXA 5ADXL 4UEMA 3VHLA 1YXRA 5HEGA 3O1JA 5LGTB 1Z8UA 3RF1A 4ZZCA 3IGQA 3AEEA 1OEDA 1BR2A 3CWZB 3Q5XA 3I1AA 1SHZC 3PU8A 5HEOA 5LXTE 2Y56A 2X9XA 5CJ5A 5HEUA 4KX6A 5CB4E 2FUPA 5F5WA 3NRXA 3ZMUB 3VKGA 2XTLA 3CPZA 4QH4A 1N36T 4QKNA 3OPCA 3LK3B 4NUVA 4DMVA 2KWHA 1KEYA 5HXCA 4NIQA 5JDLA 1HR0T 2X00D 3HI2A 4JEUB 3A7MA 3EHZA 1UW6A 4DR1T 3WTOA 2D5UA 1B7TA 2UXBT 3ZN0B 2MYSA 4PK5A 3K8PC 5SYOA 5EK2A 4XAXB 3P8CD 2DWKA 2XQ9A 4JI5T 3U8LA 3ONXA 4CI1B 2VQFT 2KXPB 4DV7T 3K3NA 2XAQB 5L3BB 2ZM8A 5JDHA 3OTOT 2W63A 3MACA 4OX9T 2XQ4A 5HAXA 5A1LA 1MNDA 3ETVA 4ZI3D 4UVCB 4ZI7E 2A3DA 3WTHA 3AXJB 2IDOB 4H9OC 4NPPA 2LRKA 3AEFA 2CBIA 4X65T 5C8YE 4YSZA 3AA1B 4AFTA 3Q2MA 4WBNE 1OEDB 2M67A 3QB5A 4IIJE 2X67A 2AXDS 4BFQA 5LNKA 2XZ6A 3ZT7A 2MOZA 4GOUA 3UU3A 2V1DB 2VVSA 4KBMB 5IYZE 2BS2A 1VRBA 4ZK1A 2LHNA 3F2EA 1HX8A 3UULA 3T1YT 1FMVA 3TLWA 4LFCT 3EABA 4IL4A 4UV8B 1UX5A 2XSAA 2ACZA 3ZC0A 2YDQA 4H63H 2CHNA 3JADA 2WU2A 5FNVE 1X79A 1W09A 3E22E 2UXDT 5J2TE 4DNDA 4HGAA 4DBRA 3UUBA 5AINA 3N9PA 2CPTA 2JQKA 5FY1A 2BZBA 1E7PA 2LKGA 3PU3A 1EZ3A 3ZCJA 5KZUA 2BG9E 2WDRA 1KK7A 4IL9A 3VRBA 5AQTB 5L2LA 3JCFA 3Q5EA 4V1Av 5J1GA 4DIDB 4G2AA 2QVAA 1ZV4X 1YKEB 2WMOA 4BJMA 1US7B 4MALA 2UUBT 2WS3A 4EAHA 4WZXA 3NWIA 4HKAA 5HWYA 3P4PA 3SS1A 3CX8B 3PUZF 2CEAA 4AKIA 2BS3A 5JDGA 3EDVA 3AE3A 4IREA 3RX6A 4U3CA 1G73A 2ZLYA 4AKLA 4EEBA 5J5FA 2CWYA 1LVFA 3FB2A 3KFWX 1IBLT 1FJGT 1XNRT 3N2GE 2UUAT 3OVUA 3O1IA 4U72A 2BG9C 2C9TA 1MNEA 3AA7B 2V7MA 4LMKA 2HH7A 5LG4A 2ZM2A 2BVLA 3AB3B 5IHYA 3O4XE 4XK9A 2UXNB 1J5ET 2BKNA 3PDYA 2X00A 3LJCA 2EHOC 3KBTA 2BYNA 5L3FB 4PIRA 4IE6A 3AE7A 3JAEA 4QHOA 4UR9A 3C4WA 2FJAA 3FZKB 1OXZA 3B13A 4DUZT 3T1HT 4PJMA 3UU8A 3PJAA 5E0OA 3VR8A 3Q5WA 2CXLA 4I50E 2BKOA 5L4HA 5AFMA 1YW0A 1NAFA 2QYWA 5FY0A 5FXVA 1KNZA 3RIFA 3N5LA 1I9BA 2YMDA 4BQTA 3AE6A 5JDFA 2XQ3A 3C51A 3J9X1 1IJ6A 4OYKA 3CMLA 1OWAA 4DBMA 2HN2A 3PMZA 3NBXX 2FJBA 3L39A 2BJ0A 3P4WA 2ES0A 3MA9A 4UM1A 3UQ4A 3SQ6A 5ABEA 2XAFB 5FXZA 5DJQC 4H63V 5AQUB 3EUHA 4DVDA 3V5UA 4ZXLA 5JRCA 1VCSA 5H6QB 2N9DA 1XDPA 1W9RA 1T8BA 4DV4T 2K9AA 3MZKB 3PUSA 4OHFA 3A8YC 2W67A 4PJJA 4X64T 1T72A 4QAAA 1DU2A 2V6YA 2EHOD 1UK5A 2LJLA 4LF8T 4XBFB 4CN6A 3DJBA 1WFDA 3C50A 3GN5A 1BR0A 4D01A 3TLTA 1IJ5A 3RYCE 3L09A 5JR9C 5AFHA 4I43B 1NEKA 4HFCA 4LF7T 4AISA 2CRBA 4YTNA 4E7ZA 2RPAA 4LMJA 5LCYA 2V7IA 4GK0E 5HXHA 4U33A 5AQQB 1HNXT 2YDSA 4EGWA 4HFIA 4YHJA 5AQFB 3ZCIA 2KLQA 3RQWA 5KXJA 2XUEA 5JH7E 2ODUA 4PK4A 3WTNA 3U78A 4I0UA 3WTIA 4EZHA 2XAJB 4HWIB 2ZM0A 1U4QA 3DTOA 1HCIA 3UUNA 4L5GA 4H9QC 2W8GA 2DI4A 4BA9A 2JQHA 4XHEA 2Q9QC 2V6YB 3O9XA 2J47A 4ZK4A 3ONJA 3H3AA 3BK9A 2H7VC 2XQ6A 2PFVA 4IT4A 2LHRA 3AE4A 3WAJA 2A72A 3AA6B 3K3QC 3K1SA 4O4JE 3GN5B 2WCAA 4NXMT 5AQKB 1Z0PA 4X62T 4QX8B 4DUYT 2CXFA 3RLFF 4Z90A 4C91A 2ZM6T 1HF8A 4ZRUA 3CQCB 3KV4A 2XM1A 2NWBA 3CX6B 4EB6E 3OKQA 3QB5K 1IBKT 4ANJA 2D9DA 2I59A 4IE7A 3WTLA 3IA3A 4EYYR 5F8PA 1G8XA 5LJMA 5LP6E 5TAOA 2Y57A 3KV9A 4TWDA 2W2UA 1YKHB 2BKPA 2XSBA 2DNXA 5JDQA 3J7Yq 1QSDA 1T7SA 1SA0E 2A9UA 3PUGA 2P9BA 4EXTA 4U7IA 1S35A 3ZYLA 4DR5T 3HKBE 2BR7A 5BP0A 3EI0A 5HXEA 3ZLIA 3N9MA 4TNVA 4OFZA 3PUWF 3FBZA 4KI0F 5LBMA 4NZBA 3PUAA 2BG9A 3AAIA 2XAHB 4LF5T 2V7JA 2IC6A 4N78D 3PTRB 5L3CB 2WSSV 1WLXA 3ZDHA 2RA1A 3T4MA 4IDPA 2EHOA 1SUMB 2D0TA 4IE4A 2SPCA 5FY7A 1D0YA 3P7IA 2UXCT 2E9XC 4JI2T 2XY8B 1Y01A 3EVYA 3N2OA 4ZZBA 4ZS3A 4DV2T 4WBOA 5CO5A 3ZC1A 2LM9A 3ZMSB 3UFEA 3C98B 3OBVE 1D0ZA 4WW0A 4EZ1A 2V8SV 1V9DA 3IHRA 2V5DA 5ETWA 5FL0A 3P4RA 3KVBA 5TVCA 2VB6A 2JPFA 5HYAA 4AIUA 4HN9A 2WNLA 4YTMA 3H37A 3RGLA 1HS7A 4I55E 2LLYA 2L3LA 2IW5B 2ACXA 4X20E 1ZKEA 4NUUA 2I6HA 3RC3A 3RYHE 4GK5E 2X66A 2WN9A 4QACA 2BYSA 4P0BA 2PG8A 4IE5A 2BG9B 4KHPT 4ZHQE 2WY2A 1MIVA 2LSJA 4DV1T 5J0ZA 3AA0B 1D0XA 2LRLA 1MIYA 1BR4A 4CXXA 1Y64B 1XMQT 2W0GA 2LSYA 4LF6T 2EHOB 4ZEYA 1UX2A 2WB5A 1I6ZA 2X9WA 4ZR6A 3AE8A 2E9XD 5BRXA 4IE0A 3U8MA 2VWAA 4AXPA 1HTJF 4YY3T 1MMAA 3RIUA 3T8OA 5LA6E 2YDRA 2BBHA 1HNWT 5JR9A 4AQGA 4IGUA 1GQEA 2YMEA 4PAGA 4H9NC 4CXWA 3VRAA 2IIUA 1CHUA 1LVKA 1SE7A 3U8NA 1KFYA 3ZN1B 1D1BA 5LGUB 3B5MA 4QXCB 2WU5A 3Q5DA 3FZLB 4QXBB 4YT0A 5DQWA 1VCTA 2X0HA 3SQ9A 3HA4A 5JMEA 3BQKA 4HFVA 3FBLA 4AFGA 1XNQT 4AFHA 3LK2B 3RRCA 5HCJA 2V7KA 3LSVA 4EOZB 4Z91A 5EZYE 5AQPB 5BR8T 2QC1B 2KT9A 1UCUA 5EK4A 1LKXA 3RPUA 3UTKA 2KINB 4P1NA 3QC9A 2H88A 2IC9A 3BQLA 2DLRA 3C79A 3RI5A 2VL8A 3RKGA 4CN1A 5J2UE 2PBIA 5FMNA 4LF9T 2Y54A 3PE0A 2ODVA 2XASB 2E5VA 2Y7YA 3LK42 2ZMAA 5JR9B 4M1PA 2BVMA 1QUUA 3QOFA 4ALXA 4DR7T 2X0LB 1VOMA 4U2YA 4FRRA 4TNWA 5AFNA 1WYCA 3I0OA 5J5GA 5AFKA 3UU4A 2XHEB 4B3TT 2VKJA 2HHHT 1T98A 2H7OA 1WRDA 4DV6T 4H9PC 4A97A 5HWXA 2LSIA 1IBMT 3MJXA 3LG7A 3ONLC 3ZYMA 1HG2A 2WDQA 2HN1A 3I0QA 1YQ4A 3AVRA 3RKOA 3ZJ1A 4CXYA 2KWIB 3CQGB 3P4SA 2DL1A 4PW8A 4DO0A 4YLHA 1KNRA 5H6RB 4CI3B 4EEDA 3WAKA 4JLEA 4JV5T 3MK7C 3HKEE 4JYAT 4K0UA 4QH1A 3CKDA 4YJ3E 4QX7B 4LFAT 3ANWA 3E08A 4O8SA 2Q9QB
chains in the Genus database with same CATH topology
2Y58A 4ILCA 3RQUA 4UM3P 2XNUA 2WNCA 2XQ9A 4HFEA 3UQ7A 2XNVA 3U8LA 5J5IA 3TLVA 5AFMB 2BYNA 2BYQA 3WTKA 4PIRA 4UY2A 2WNJA 3JAEA 3C79A 3ZDHA 3ZDGA 3RI5A 3UUBA 5AINA 2MAWA 2KSRA 1UX2A 3T4MA 2XQ4A 3U8KA 4D01A 4ZR6A 3TLTA 5LG3A 2UZ6A 5L47A 5BW2A 3RHWA 2Y54A 4TWHA 5AFHA 5BRXA 5LXBA 4Z90A 4B5DA 5HEJA 4ZRUA 2WZYA 3U8MA 2XQ7A 2Y7YA 2LKGA 4UM3A 3EAMA 5AFLA 4HFCA 4ZZBA 3TLUA 3UU8A 5KZUA 2BG9E 3WTHA 5IUXA 4ALXA 3C84A 4IL9A 2W8FA 4NPPA 4FRRA 5CO5A 2M6BA 3WIPA 5KE4A 4TNWA 2BYPA 5AFNA 5J5GA 5L4HA 4LMJA 4X5TA 5AFMA 2XQAA 1OEDC 4AFTA 4EZ1A 5HEGA 2XZ5A 3SIOA 4ILBA 4QH5A 2YMEA 3WTJA 3WTLA 2BR8A 5AFKA 4LMLA 3RIFA 4ZZCA 3GUAA 1OEDB 5TVCA 5CFBA 1I9BA 3UU4A 2YMDA 4UXUA 3RIAA 4BQTA 3IGQA 3WTMA 2XNTA 2XQ3A 2Y57A 3ZKRA 1OEDA 3PEOA 2BYRA 3U8NA 4HFIA 4BFQA 4A97A 2WNLA 2PGZA 2XQ8A 4TWDA 5HCMA 5HEOA 2XZ6A 2Y56A 3RQWA 4DBMA 3UU3A 2VL0A 2LLYA 5HEUA 3PMZA 4UM3S 5HEHA 4F8HA 2ZJUA 2BJ0A 3P4WA 2M6IA 3WTNA 3SQ9A 5J5HA 4IREA 3WTIA 4UM1A 3UQ4A 3SQ6A 4QH4A 4ZK1A 5JMEA 2XQ5A 4TWFA 4QABA 2XYTA 3SH1A 2ZJVA 5J5FA 1UV6A 5AFJA 5L4EA 3TLWA 2X00A 4HFBA 4AFGA 2WN9A 2LM2A 4QACA 3TLSA 4IL4A 2W8GA 4HFHA 4AFHA 2BYSA 2YN6A 5HCJA 2X00D 3JAFA 2BR7A 3EI0A 1OEDE 4HFDA 3UU6A 4HQPA 2BG9C 5BP0A 2C9TA 3EHZA 4ILAA 4TNVA 4WV9A 2YKSA 3LSVA 4Z91A 4COFA 4LMKA 1UW6A 2QC1B 4XHEA 2YOEA 2PH9A 3WTOA 2BG9B 4QH1A 3UU5A 5FJVA 4ZJSA 4NZBA 3U8JA 4A98A 3JADA 4ZJTA 4XK9A 4QAAA 4ZK4A 2LKHA 3P50A 2XYSA 2BG9A 5J0ZA 2XQ6A 5SYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y58 A;  4ILC A;  3RQU A;  4UM3 P;  2XNU A;  2WNC A;  2XQ9 A;  4HFE A;  3UQ7 A;  2XNV A;  3U8L A;  5J5I A;  3TLV A;  5AFM B;  2BYN A;  2BYQ A;  3WTK A;  4PIR A;  4UY2 A;  2WNJ A;  3JAE A;  3C79 A;  3ZDH A;  3ZDG A;  3RI5 A;  3UUB A;  5AIN A;  2MAW A;  2KSR A;  1UX2 A;  3T4M A;  2XQ4 A;  3U8K A;  4D01 A;  4ZR6 A;  3TLT A;  5LG3 A;  2UZ6 A;  5L47 A;  5BW2 A;  3RHW A;  2Y54 A;  4TWH A;  5AFH A;  5BRX A;  5LXB A;  4Z90 A;  4B5D A;  5HEJ A;  4ZRU A;  2WZY A;  3U8M A;  2XQ7 A;  2Y7Y A;  2LKG A;  4UM3 A;  3EAM A;  5AFL A;  4HFC A;  4ZZB A;  3TLU A;  3UU8 A;  5KZU A;  2BG9 E;  3WTH A;  5IUX A;  4ALX A;  3C84 A;  4IL9 A;  2W8F A;  4NPP A;  4FRR A;  5CO5 A;  2M6B A;  3WIP A;  5KE4 A;  4TNW A;  2BYP A;  5AFN A;  5J5G A;  5L4H A;  4LMJ A;  4X5T A;  5AFM A;  2XQA A;  1OED C;  4AFT A;  4EZ1 A;  5HEG A;  2XZ5 A;  3SIO A;  4ILB A;  4QH5 A;  2YME A;  3WTJ A;  3WTL A;  2BR8 A;  5AFK A;  4LML A;  3RIF A;  4ZZC A;  3GUA A;  1OED B;  5TVC A;  5CFB A;  1I9B A;  3UU4 A;  2YMD A;  4UXU A;  3RIA A;  4BQT A;  3IGQ A;  3WTM A;  2XNT A;  2XQ3 A;  2Y57 A;  3ZKR A;  1OED A;  3PEO A;  2BYR A;  3U8N A;  4HFI A;  4BFQ A;  4A97 A;  2WNL A;  2PGZ A;  2XQ8 A;  4TWD A;  5HCM A;  5HEO A;  2XZ6 A;  2Y56 A;  3RQW A;  4DBM A;  3UU3 A;  2VL0 A;  2LLY A;  5HEU A;  3PMZ A;  4UM3 S;  5HEH A;  4F8H A;  2ZJU A;  2BJ0 A;  3P4W A;  2M6I A;  3WTN A;  3SQ9 A;  5J5H A;  4IRE A;  3WTI A;  4UM1 A;  3UQ4 A;  3SQ6 A;  4QH4 A;  4ZK1 A;  5JME A;  2XQ5 A;  4TWF A;  4QAB A;  2XYT A;  3SH1 A;  2ZJV A;  5J5F A;  1UV6 A;  5AFJ A;  5L4E A;  3TLW A;  2X00 A;  4HFB A;  4AFG A;  2WN9 A;  2LM2 A;  4QAC A;  3TLS A;  4IL4 A;  2W8G A;  4HFH A;  4AFH A;  2BYS A;  2YN6 A;  5HCJ A;  2X00 D;  3JAF A;  2BR7 A;  3EI0 A;  1OED E;  4HFD A;  3UU6 A;  4HQP A;  2BG9 C;  5BP0 A;  2C9T A;  3EHZ A;  4ILA A;  4TNV A;  4WV9 A;  2YKS A;  3LSV A;  4Z91 A;  4COF A;  4LMK A;  1UW6 A;  2QC1 B;  4XHE A;  2YOE A;  2PH9 A;  3WTO A;  2BG9 B;  4QH1 A;  3UU5 A;  5FJV A;  4ZJS A;  4NZB A;  3U8J A;  4A98 A;  3JAD A;  4ZJT A;  4XK9 A;  4QAA A;  4ZK4 A;  2LKH A;  3P50 A;  2XYS A;  2BG9 A;  5J0Z A;  2XQ6 A;  5SYO A; 
#chains in the Genus database with same CATH topology
 3ZJ2 A;  2J4G A;  1NEN A;  4UM3 P;  3UQ7 A;  5J5I A;  2VKH A;  4HTE A;  1E2A A;  4PK6 A;  1BR1 A;  2WWU A;  4BAY B;  5LG3 A;  2UZ6 A;  2K3W A;  1WCR A;  4B6X A;  2FBW A;  1W0B A;  2XZE A;  3NKZ A;  3R84 B;  5HXS A;  2GK9 A;  2UU9 T;  2JRK A;  2D2S A;  4HWC A;  3SFE A;  2CLY C;  3RYF E;  3WIP A;  3CVR A;  3GWH A;  2E9X A;  4DV3 T;  3N9N A;  2QGS A;  3SIO A;  4QH5 A;  4A5X A;  3GUA A;  2I0M A;  5AQR B;  2LOS A;  1ZHC A;  5C2T A;  1FMW A;  4QWN B;  5FVK A;  3RH3 A;  4IST A;  4JUY A;  2FJE A;  5F3J A;  1CUN A;  2PGZ A;  1UX4 A;  2CE7 A;  4EIW A;  3X1D A;  3HL6 A;  2B76 A;  4F8H A;  2XM2 A;  2KZ7 B;  2IML A;  2KMF A;  2CWO A;  4TUY E;  3ZMV B;  3VR9 A;  2K24 A;  4IDZ A;  3A5X A;  3PV0 F;  1HNZ T;  4HFH A;  3CX7 B;  1JNZ A;  2C0S A;  3JAF A;  4H9S E;  5KX5 E;  3ANW B;  4KUM B;  3ZMT B;  3UU5 A;  2J1D G;  4CI2 B;  1FEW A;  1WYB A;  2IUB A;  2XYS A;  3KDS E;  1E1H B;  2C5K T;  4EYU A;  5FL1 A;  1ZEE A;  5LGN B;  2B1E A;  4DR2 T;  4J2C A;  4MFR A;  2KSR A;  2WWV A;  3N9Q A;  1MMN A;  2CBJ A;  4JEH B;  3FZF B;  4TWH A;  5LXB A;  3AVS A;  3IEE A;  2XJ7 A;  5JQG E;  4UM3 A;  3AAE B;  4B3R T;  2V7L A;  3TLU A;  5CGM A;  5AQS B;  2E9X B;  2N2N A;  1UGO A;  2W8F A;  3ZMZ B;  1XDO A;  3KV5 A;  3G06 A;  4TZ4 C;  2X9H A;  3ESL A;  3NZQ A;  3N9O A;  2BR8 A;  1YD8 G;  4LML A;  2HPJ A;  3SWH A;  4OYJ A;  5AQV B;  5FXX A;  1J5W A;  4O2B E;  1HX1 B;  5JRE A;  3ZKR A;  3LBX A;  2X68 A;  1KNP A;  3EDU A;  1HFA A;  2A2F X;  1XWM A;  4H9R C;  1X9B A;  4UM3 S;  5AQO B;  4OK0 A;  5LBQ B;  2CCQ A;  4AKH A;  2XQ5 A;  4QAB A;  2XYT A;  2MPK A;  5AQG B;  4MLK A;  3AE1 A;  2VK9 A;  5JTG A;  1W0A A;  1O3X A;  2Y48 B;  4XZC A;  2YN6 A;  2JJ9 A;  4YFS A;  2NTY A;  1IZN B;  3GMI A;  4JI0 T;  4ZJS A;  3U8J A;  2W00 A;  3NVO A;  1N32 T;  4P0A A;  4ZI3 C;  2JMH A;  2WNC A;  4UXN B;  3TLV A;  4ILU A;  1XMO T;  2BYQ A;  4DV0 T;  4NXN T;  2CHO A;  1D1A A;  2Q9Q D;  4PJN A;  1ZP0 A;  4B5D A;  5HEJ A;  4IDQ A;  3UT5 E;  4AQF C;  2CXD A;  5IUX A;  5KDM C;  1FIO A;  2XQY A;  3QK6 A;  2CA5 A;  4UEL A;  2XZ5 A;  5L3G B;  4CN4 A;  3PJA J;  1KF6 A;  1UUS A;  4UXU A;  3LBX B;  4ZS2 A;  5L3E B;  2WBL A;  5GON E;  4MHC A;  4DR6 T;  3C4Z A;  4HWF A;  4AKG A;  4BJN A;  5DQV A;  3MXZ A;  3QNU A;  4JI8 T;  3AE2 A;  2OLT A;  4KP3 C;  5L4E A;  5AQM B;  4LF4 T;  3TLS A;  2WMN A;  2WP9 A;  2E8I A;  5LB7 B;  3RYI E;  4HQP A;  5JVD E;  4TV9 E;  4COF A;  4YXD A;  2F4V T;  4A98 A;  5JDM A;  1I94 T;  3E0Z A;  2FJD A;  3VU7 H;  2WZI A;  1ZOY A;  5AQJ B;  4P09 A;  4UV9 B;  2WDV A;  2NW7 A;  2VUR A;  4IDN A;  2YU2 A;  4DBQ A;  2IAK A;  4UY2 A;  2BDE A;  5HXR A;  2MAW A;  4UVB B;  2JQ9 A;  3U8K A;  4DR3 T;  3RHW A;  2Y6X A;  4B3M T;  2NR4 A;  2WZY A;  1H7C A;  4X1Y E;  4ISS A;  1D1C A;  3C84 A;  5AQL B;  5DAB A;  5FYM A;  3ETU A;  4GKK T;  2L9Q A;  3CIR A;  4X5T A;  3S4U A;  4WNK A;  3VKH A;  5LOV E;  3AEG A;  3AAA B;  4U74 A;  5CFB A;  2Y8D A;  1HG5 A;  2NTX A;  5AQN B;  2WAU A;  4IDO A;  2NW8 A;  2XQ8 A;  3JC6 C;  5JDN A;  2C5J A;  2ZJU A;  3AE5 A;  3Q9D A;  5J5H A;  3F57 A;  2Z6E A;  5AFU L;  5AQI B;  3AE9 A;  4TWF A;  1M62 A;  3NZP A;  3SH1 A;  3P4Q A;  3AED A;  5AFJ A;  1QLB A;  3CK6 A;  4HFB A;  3O1H A;  2W4X A;  4JI1 T;  1OED E;  3UU6 A;  2LT3 A;  2C5I T;  3R6N A;  5CA1 E;  3OJA A;  4FI5 A;  2VVN A;  2J62 A;  3SFD A;  2W66 A;  3GA8 A;  4YTP A;  3NRY A;  3ZPO A;  1N33 T;  3QUJ A;  3KBU A;  3CQX C;  3HKD E;  2LEH A;  2YIN A;  4HEA A;  4KMC A;  3MKD A;  3V5S A;  2QA7 A;  2MBG A;  1U5P A;  5BW2 A;  3OYX A;  2VQE T;  4Z8X A;  2KND A;  2YU1 A;  3N2K E;  2XPK A;  1R8I A;  3I9Y A;  2Q9Q A;  5KE4 A;  2CLY B;  1N34 T;  5EK3 A;  3OYZ A;  1OED C;  2N1G A;  4ILB A;  1LRZ A;  3WTJ A;  2IHR 1;  4U2Z A;  4WYV A;  2X51 A;  3M3Z B;  3RC8 A;  2WZH A;  2V26 A;  1WR6 A;  3WTM A;  1UUR A;  4HWH A;  4B3S T;  4X1I E;  3SOL A;  3JC6 D;  3M65 A;  3IBP A;  2JIW A;  2AE9 A;  2VAS A;  2VL0 A;  4GIW A;  4TV8 E;  5LHH B;  5LHG B;  3PUV F;  4AQY T;  3SRZ A;  2K48 A;  4L9I A;  2XAG B;  4JI4 T;  3K3O A;  3KVA A;  2R6G F;  4DV5 T;  1M7K A;  5KMG P;  2UXX B;  2VKO A;  2DHR A;  3I9W A;  2WQY A;  2X0Y A;  2BS4 A;  5LJN A;  2H3R A;  3ZT6 A;  4ERR A;  5LMU T;  4ILA A;  2DCF A;  4YJ2 E;  2YOE A;  4GYS A;  2PH9 A;  4O4I E;  5CA0 E;  4ZOL E;  5FJV A;  3KIN B;  4DR4 T;  4TX5 A;  2MTQ A;  4ZJT A;  3P50 A;  2V6X A;  4FJO A;  5BMV E;  3DP7 A;  4HFE A;  2X9Y A;  2WNJ A;  3UFG A;  3ZDG A;  3UUX B;  3AEB A;  4QXH B;  4PNI A;  2CMR A;  2XQ7 A;  3HR0 A;  3EAM A;  2E5L T;  3AEC A;  3LDQ B;  4YSY A;  1IAP A;  2YK0 A;  2BYP A;  2PJQ A;  4C90 A;  2LSK A;  4AQF A;  5C3J A;  4AI6 A;  4YHH T;  4UF0 A;  2LSG A;  3HKC E;  2QRX A;  4ADZ A;  4EZ4 A;  1MMD A;  3ZSS A;  4O2A E;  4I4T E;  5FKY A;  2XNT A;  1J1J A;  1L0V A;  4Q25 A;  5HCM A;  1AJ3 A;  3D0T A;  2OV9 A;  5FP3 A;  3KV6 A;  2M6I A;  3FZH B;  5FVL A;  1MMG A;  4G63 A;  2ZJV A;  3PUX F;  4TN7 B;  1UV6 A;  2LM2 A;  2UUC T;  3TKL B;  3ZST A;  4HFD A;  2D0U A;  3RIU C;  4WV9 A;  4ASK A;  5L3D B;  5IWA T;  4A56 A;  2OA5 A;  3B57 A;  3FHN A;  2HPL A;  4HE8 A;  1YQ3 A;  4PJL A;  4K0K T;  2NP9 A;  4ILC A;  2W61 A;  3RQU A;  4KHZ F;  5AFM B;  3WTK A;  2V5C A;  4L0R A;  5ABH A;  4UVA B;  5LYJ E;  4EV6 A;  3PUR A;  2NW9 A;  2VKD A;  3N9L A;  3UUM A;  5LHI B;  2PTF A;  4U31 A;  5ABF A;  2W62 A;  4CZZ B;  4ZI2 C;  2M6B A;  3PUQ A;  4UF0 B;  4LFB T;  2XQA A;  4E7S A;  2E2A A;  3C64 A;  3U3I A;  3RRW A;  5JRC B;  5ABG A;  3RIA A;  4MBQ A;  3PEO A;  4IHJ E;  2BYR A;  4PFO A;  4JI6 T;  4GYR A;  4YSX A;  3PUY F;  5HEH A;  1NWM X;  5FXW A;  1JNR A;  4UIG A;  5LMN T;  2L8K A;  2WM9 A;  3ZEF B;  4F6R C;  2YEV C;  3ZYK A;  4JI3 T;  3FXE B;  4AKR B;  2JQQ A;  4HWD A;  4X66 T;  3H3M A;  2K5B B;  2YKS A;  5M4Y A;  3L8R A;  3AEA A;  2G0U A;  3ABV A;  5AQH B;  4DMW A;  1XZY A;  3BQI A;  2LKH A;  4GKJ T;  4X1K E;  4JI7 T;  2Y58 A;  3FXD B;  4U7Y A;  3F31 A;  2XNU A;  2XNV A;  4CQI A;  4O4L E;  4O4H E;  3IF8 B;  2DWG A;  2LOP A;  1WR0 A;  2CM0 A;  1MIW A;  3L3P A;  2RP4 A;  5L47 A;  1S94 A;  5ABF B;  2H89 A;  4JBW F;  5AFL A;  3C4X A;  4ZI2 D;  2LE8 A;  3WI3 A;  3FZM B;  4PFP A;  3ZT5 A;  2JMK A;  3W15 B;  2BBJ A;  3LFM A;  3AXJ A;  2NOX A;  5ADX L;  4UEM A;  3VHL A;  1YXR A;  5HEG A;  3O1J A;  5LGT B;  1Z8U A;  3RF1 A;  4ZZC A;  3IGQ A;  3AEE A;  1OED A;  1BR2 A;  3CWZ B;  3Q5X A;  3I1A A;  1SHZ C;  3PU8 A;  5HEO A;  5LXT E;  2Y56 A;  2X9X A;  5CJ5 A;  5HEU A;  4KX6 A;  5CB4 E;  2FUP A;  5F5W A;  3NRX A;  3ZMU B;  3VKG A;  2XTL A;  3CPZ A;  4QH4 A;  1N36 T;  4QKN A;  3OPC A;  3LK3 B;  4NUV A;  4DMV A;  2KWH A;  1KEY A;  5HXC A;  4NIQ A;  5JDL A;  1HR0 T;  2X00 D;  3HI2 A;  4JEU B;  3A7M A;  3EHZ A;  1UW6 A;  4DR1 T;  3WTO A;  2D5U A;  1B7T A;  2UXB T;  3ZN0 B;  2MYS A;  4PK5 A;  3K8P C;  5SYO A;  5EK2 A;  4XAX B;  3P8C D;  2DWK A;  2XQ9 A;  4JI5 T;  3U8L A;  3ONX A;  4CI1 B;  2VQF T;  2KXP B;  4DV7 T;  3K3N A;  2XAQ B;  5L3B B;  2ZM8 A;  5JDH A;  3OTO T;  2W63 A;  3MAC A;  4OX9 T;  2XQ4 A;  5HAX A;  5A1L A;  1MND A;  3ETV A;  4ZI3 D;  4UVC B;  4ZI7 E;  2A3D A;  3WTH A;  3AXJ B;  2IDO B;  4H9O C;  4NPP A;  2LRK A;  3AEF A;  2CBI A;  4X65 T;  5C8Y E;  4YSZ A;  3AA1 B;  4AFT A;  3Q2M A;  4WBN E;  1OED B;  2M67 A;  3QB5 A;  4IIJ E;  2X67 A;  2AXD S;  4BFQ A;  5LNK A;  2XZ6 A;  3ZT7 A;  2MOZ A;  4GOU A;  3UU3 A;  2V1D B;  2VVS A;  4KBM B;  5IYZ E;  2BS2 A;  1VRB A;  4ZK1 A;  2LHN A;  3F2E A;  1HX8 A;  3UUL A;  3T1Y T;  1FMV A;  3TLW A;  4LFC T;  3EAB A;  4IL4 A;  4UV8 B;  1UX5 A;  2XSA A;  2ACZ A;  3ZC0 A;  2YDQ A;  4H63 H;  2CHN A;  3JAD A;  2WU2 A;  5FNV E;  1X79 A;  1W09 A;  3E22 E;  2UXD T;  5J2T E;  4DND A;  4HGA A;  4DBR A;  3UUB A;  5AIN A;  3N9P A;  2CPT A;  2JQK A;  5FY1 A;  2BZB A;  1E7P A;  2LKG A;  3PU3 A;  1EZ3 A;  3ZCJ A;  5KZU A;  2BG9 E;  2WDR A;  1KK7 A;  4IL9 A;  3VRB A;  5AQT B;  5L2L A;  3JCF A;  3Q5E A;  4V1A v;  5J1G A;  4DID B;  4G2A A;  2QVA A;  1ZV4 X;  1YKE B;  2WMO A;  4BJM A;  1US7 B;  4MAL A;  2UUB T;  2WS3 A;  4EAH A;  4WZX A;  3NWI A;  4HKA A;  5HWY A;  3P4P A;  3SS1 A;  3CX8 B;  3PUZ F;  2CEA A;  4AKI A;  2BS3 A;  5JDG A;  3EDV A;  3AE3 A;  4IRE A;  3RX6 A;  4U3C A;  1G73 A;  2ZLY A;  4AKL A;  4EEB A;  5J5F A;  2CWY A;  1LVF A;  3FB2 A;  3KFW X;  1IBL T;  1FJG T;  1XNR T;  3N2G E;  2UUA T;  3OVU A;  3O1I A;  4U72 A;  2BG9 C;  2C9T A;  1MNE A;  3AA7 B;  2V7M A;  4LMK A;  2HH7 A;  5LG4 A;  2ZM2 A;  2BVL A;  3AB3 B;  5IHY A;  3O4X E;  4XK9 A;  2UXN B;  1J5E T;  2BKN A;  3PDY A;  2X00 A;  3LJC A;  2EHO C;  3KBT A;  2BYN A;  5L3F B;  4PIR A;  4IE6 A;  3AE7 A;  3JAE A;  4QHO A;  4UR9 A;  3C4W A;  2FJA A;  3FZK B;  1OXZ A;  3B13 A;  4DUZ T;  3T1H T;  4PJM A;  3UU8 A;  3PJA A;  5E0O A;  3VR8 A;  3Q5W A;  2CXL A;  4I50 E;  2BKO A;  5L4H A;  5AFM A;  1YW0 A;  1NAF A;  2QYW A;  5FY0 A;  5FXV A;  1KNZ A;  3RIF A;  3N5L A;  1I9B A;  2YMD A;  4BQT A;  3AE6 A;  5JDF A;  2XQ3 A;  3C51 A;  3J9X 1;  1IJ6 A;  4OYK A;  3CML A;  1OWA A;  4DBM A;  2HN2 A;  3PMZ A;  3NBX X;  2FJB A;  3L39 A;  2BJ0 A;  3P4W A;  2ES0 A;  3MA9 A;  4UM1 A;  3UQ4 A;  3SQ6 A;  5ABE A;  2XAF B;  5FXZ A;  5DJQ C;  4H63 V;  5AQU B;  3EUH A;  4DVD A;  3V5U A;  4ZXL A;  5JRC A;  1VCS A;  5H6Q B;  2N9D A;  1XDP A;  1W9R A;  1T8B A;  4DV4 T;  2K9A A;  3MZK B;  3PUS A;  4OHF A;  3A8Y C;  2W67 A;  4PJJ A;  4X64 T;  1T72 A;  4QAA A;  1DU2 A;  2V6Y A;  2EHO D;  1UK5 A;  2LJL A;  4LF8 T;  4XBF B;  4CN6 A;  3DJB A;  1WFD A;  3C50 A;  3GN5 A;  1BR0 A;  4D01 A;  3TLT A;  1IJ5 A;  3RYC E;  3L09 A;  5JR9 C;  5AFH A;  4I43 B;  1NEK A;  4HFC A;  4LF7 T;  4AIS A;  2CRB A;  4YTN A;  4E7Z A;  2RPA A;  4LMJ A;  5LCY A;  2V7I A;  4GK0 E;  5HXH A;  4U33 A;  5AQQ B;  1HNX T;  2YDS A;  4EGW A;  4HFI A;  4YHJ A;  5AQF B;  3ZCI A;  2KLQ A;  3RQW A;  5KXJ A;  2XUE A;  5JH7 E;  2ODU A;  4PK4 A;  3WTN A;  3U78 A;  4I0U A;  3WTI A;  4EZH A;  2XAJ B;  4HWI B;  2ZM0 A;  1U4Q A;  3DTO A;  1HCI A;  3UUN A;  4L5G A;  4H9Q C;  2W8G A;  2DI4 A;  4BA9 A;  2JQH A;  4XHE A;  2Q9Q C;  2V6Y B;  3O9X A;  2J47 A;  4ZK4 A;  3ONJ A;  3H3A A;  3BK9 A;  2H7V C;  2XQ6 A;  2PFV A;  4IT4 A;  2LHR A;  3AE4 A;  3WAJ A;  2A72 A;  3AA6 B;  3K3Q C;  3K1S A;  4O4J E;  3GN5 B;  2WCA A;  4NXM T;  5AQK B;  1Z0P A;  4X62 T;  4QX8 B;  4DUY T;  2CXF A;  3RLF F;  4Z90 A;  4C91 A;  2ZM6 T;  1HF8 A;  4ZRU A;  3CQC B;  3KV4 A;  2XM1 A;  2NWB A;  3CX6 B;  4EB6 E;  3OKQ A;  3QB5 K;  1IBK T;  4ANJ A;  2D9D A;  2I59 A;  4IE7 A;  3WTL A;  3IA3 A;  4EYY R;  5F8P A;  1G8X A;  5LJM A;  5LP6 E;  5TAO A;  2Y57 A;  3KV9 A;  4TWD A;  2W2U A;  1YKH B;  2BKP A;  2XSB A;  2DNX A;  5JDQ A;  3J7Y q;  1QSD A;  1T7S A;  1SA0 E;  2A9U A;  3PUG A;  2P9B A;  4EXT A;  4U7I A;  1S35 A;  3ZYL A;  4DR5 T;  3HKB E;  2BR7 A;  5BP0 A;  3EI0 A;  5HXE A;  3ZLI A;  3N9M A;  4TNV A;  4OFZ A;  3PUW F;  3FBZ A;  4KI0 F;  5LBM A;  4NZB A;  3PUA A;  2BG9 A;  3AAI A;  2XAH B;  4LF5 T;  2V7J A;  2IC6 A;  4N78 D;  3PTR B;  5L3C B;  2WSS V;  1WLX A;  3ZDH A;  2RA1 A;  3T4M A;  4IDP A;  2EHO A;  1SUM B;  2D0T A;  4IE4 A;  2SPC A;  5FY7 A;  1D0Y A;  3P7I A;  2UXC T;  2E9X C;  4JI2 T;  2XY8 B;  1Y01 A;  3EVY A;  3N2O A;  4ZZB A;  4ZS3 A;  4DV2 T;  4WBO A;  5CO5 A;  3ZC1 A;  2LM9 A;  3ZMS B;  3UFE A;  3C98 B;  3OBV E;  1D0Z A;  4WW0 A;  4EZ1 A;  2V8S V;  1V9D A;  3IHR A;  2V5D A;  5ETW A;  5FL0 A;  3P4R A;  3KVB A;  5TVC A;  2VB6 A;  2JPF A;  5HYA A;  4AIU A;  4HN9 A;  2WNL A;  4YTM A;  3H37 A;  3RGL A;  1HS7 A;  4I55 E;  2LLY A;  2L3L A;  2IW5 B;  2ACX A;  4X20 E;  1ZKE A;  4NUU A;  2I6H A;  3RC3 A;  3RYH E;  4GK5 E;  2X66 A;  2WN9 A;  4QAC A;  2BYS A;  4P0B A;  2PG8 A;  4IE5 A;  2BG9 B;  4KHP T;  4ZHQ E;  2WY2 A;  1MIV A;  2LSJ A;  4DV1 T;  5J0Z A;  3AA0 B;  1D0X A;  2LRL A;  1MIY A;  1BR4 A;  4CXX A;  1Y64 B;  1XMQ T;  2W0G A;  2LSY A;  4LF6 T;  2EHO B;  4ZEY A;  1UX2 A;  2WB5 A;  1I6Z A;  2X9W A;  4ZR6 A;  3AE8 A;  2E9X D;  5BRX A;  4IE0 A;  3U8M A;  2VWA A;  4AXP A;  1HTJ F;  4YY3 T;  1MMA A;  3RIU A;  3T8O A;  5LA6 E;  2YDR A;  2BBH A;  1HNW T;  5JR9 A;  4AQG A;  4IGU A;  1GQE A;  2YME A;  4PAG A;  4H9N C;  4CXW A;  3VRA A;  2IIU A;  1CHU A;  1LVK A;  1SE7 A;  3U8N A;  1KFY A;  3ZN1 B;  1D1B A;  5LGU B;  3B5M A;  4QXC B;  2WU5 A;  3Q5D A;  3FZL B;  4QXB B;  4YT0 A;  5DQW A;  1VCT A;  2X0H A;  3SQ9 A;  3HA4 A;  5JME A;  3BQK A;  4HFV A;  3FBL A;  4AFG A;  1XNQ T;  4AFH A;  3LK2 B;  3RRC A;  5HCJ A;  2V7K A;  3LSV A;  4EOZ B;  4Z91 A;  5EZY E;  5AQP B;  5BR8 T;  2QC1 B;  2KT9 A;  1UCU A;  5EK4 A;  1LKX A;  3RPU A;  3UTK A;  2KIN B;  4P1N A;  3QC9 A;  2H88 A;  2IC9 A;  3BQL A;  2DLR A;  3C79 A;  3RI5 A;  2VL8 A;  3RKG A;  4CN1 A;  5J2U E;  2PBI A;  5FMN A;  4LF9 T;  2Y54 A;  3PE0 A;  2ODV A;  2XAS B;  2E5V A;  2Y7Y A;  3LK4 2;  2ZMA A;  5JR9 B;  4M1P A;  2BVM A;  1QUU A;  3QOF A;  4ALX A;  4DR7 T;  2X0L B;  1VOM A;  4U2Y A;  4FRR A;  4TNW A;  5AFN A;  1WYC A;  3I0O A;  5J5G A;  5AFK A;  3UU4 A;  2XHE B;  4B3T T;  2VKJ A;  2HHH T;  1T98 A;  2H7O A;  1WRD A;  4DV6 T;  4H9P C;  4A97 A;  5HWX A;  2LSI A;  1IBM T;  3MJX A;  3LG7 A;  3ONL C;  3ZYM A;  1HG2 A;  2WDQ A;  2HN1 A;  3I0Q A;  1YQ4 A;  3AVR A;  3RKO A;  3ZJ1 A;  4CXY A;  2KWI B;  3CQG B;  3P4S A;  2DL1 A;  4PW8 A;  4DO0 A;  4YLH A;  1KNR A;  5H6R B;  4CI3 B;  4EED A;  3WAK A;  4JLE A;  4JV5 T;  3MK7 C;  3HKE E;  4JYA T;  4K0U A;  4QH1 A;  3CKD A;  4YJ3 E;  4QX7 B;  4LFA T;  3ANW A;  3E08 A;  4O8S A;  2Q9Q B; 
#chains in the Genus database with same CATH homology
 2Y58 A;  4ILC A;  3RQU A;  4UM3 P;  2XNU A;  2WNC A;  2XQ9 A;  4HFE A;  3UQ7 A;  2XNV A;  3U8L A;  5J5I A;  3TLV A;  5AFM B;  2BYN A;  2BYQ A;  3WTK A;  4PIR A;  4UY2 A;  2WNJ A;  3JAE A;  3C79 A;  3ZDH A;  3ZDG A;  3RI5 A;  3UUB A;  5AIN A;  2MAW A;  2KSR A;  1UX2 A;  3T4M A;  2XQ4 A;  3U8K A;  4D01 A;  4ZR6 A;  3TLT A;  5LG3 A;  2UZ6 A;  5L47 A;  5BW2 A;  3RHW A;  2Y54 A;  4TWH A;  5AFH A;  5BRX A;  5LXB A;  4Z90 A;  4B5D A;  5HEJ A;  4ZRU A;  2WZY A;  3U8M A;  2XQ7 A;  2Y7Y A;  2LKG A;  4UM3 A;  3EAM A;  5AFL A;  4HFC A;  4ZZB A;  3TLU A;  3UU8 A;  5KZU A;  2BG9 E;  3WTH A;  5IUX A;  4ALX A;  3C84 A;  4IL9 A;  2W8F A;  4NPP A;  4FRR A;  5CO5 A;  2M6B A;  3WIP A;  5KE4 A;  4TNW A;  2BYP A;  5AFN A;  5J5G A;  5L4H A;  4LMJ A;  4X5T A;  5AFM A;  2XQA A;  1OED C;  4AFT A;  4EZ1 A;  5HEG A;  2XZ5 A;  3SIO A;  4ILB A;  4QH5 A;  2YME A;  3WTJ A;  3WTL A;  2BR8 A;  5AFK A;  4LML A;  3RIF A;  4ZZC A;  3GUA A;  1OED B;  5TVC A;  5CFB A;  1I9B A;  3UU4 A;  2YMD A;  4UXU A;  3RIA A;  4BQT A;  3IGQ A;  3WTM A;  2XNT A;  2XQ3 A;  2Y57 A;  3ZKR A;  1OED A;  3PEO A;  2BYR A;  3U8N A;  4HFI A;  4BFQ A;  4A97 A;  2WNL A;  2PGZ A;  2XQ8 A;  4TWD A;  5HCM A;  5HEO A;  2XZ6 A;  2Y56 A;  3RQW A;  4DBM A;  3UU3 A;  2VL0 A;  2LLY A;  5HEU A;  3PMZ A;  4UM3 S;  5HEH A;  4F8H A;  2ZJU A;  2BJ0 A;  3P4W A;  2M6I A;  3WTN A;  3SQ9 A;  5J5H A;  4IRE A;  3WTI A;  4UM1 A;  3UQ4 A;  3SQ6 A;  4QH4 A;  4ZK1 A;  5JME A;  2XQ5 A;  4TWF A;  4QAB A;  2XYT A;  3SH1 A;  2ZJV A;  5J5F A;  1UV6 A;  5AFJ A;  5L4E A;  3TLW A;  2X00 A;  4HFB A;  4AFG A;  2WN9 A;  2LM2 A;  4QAC A;  3TLS A;  4IL4 A;  2W8G A;  4HFH A;  4AFH A;  2BYS A;  2YN6 A;  5HCJ A;  2X00 D;  3JAF A;  2BR7 A;  3EI0 A;  1OED E;  4HFD A;  3UU6 A;  4HQP A;  2BG9 C;  5BP0 A;  2C9T A;  3EHZ A;  4ILA A;  4TNV A;  4WV9 A;  2YKS A;  3LSV A;  4Z91 A;  4COF A;  4LMK A;  1UW6 A;  2QC1 B;  4XHE A;  2YOE A;  2PH9 A;  3WTO A;  2BG9 B;  4QH1 A;  3UU5 A;  5FJV A;  4ZJS A;  4NZB A;  3U8J A;  4A98 A;  3JAD A;  4ZJT A;  4XK9 A;  4QAA A;  4ZK4 A;  2LKH A;  3P50 A;  2XYS A;  2BG9 A;  5J0Z A;  2XQ6 A;  5SYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...