5HEHA

Pentameric ligand-gated ion channel glic mutant p246a
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLAKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Signal Transduction at the Domain Interface of Prokaryotic Pentameric Ligand-Gated Ion Channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Transport protein
molecule keywords Proton-gated ion channel
total genus 85
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5hehA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5hehA01
3JAEA 3RIAA 3ZDHA 4LMJA 5AFMA 5AINA 2PGZA 5HCMA 5AFKA 2BJ0A 3WTLA 4TWHA 1OEDE 5HEGA 2WNLA 3U8JA 4A97A 4HFCA 4QABA 5AFHA 5BRXA 4ZK1A 3ZDGA 4X5TA 3WTMA 5JMEA 2LM2A 4ZZCA 5FJVA 4QACA 2BG9B 3EAMA 3RI5A 1UW6A 3SQ9A 3RQWA 4UM3A 2C9TA 2Y57A 1UX2A 2QC1B 2W8FA 2Y54A 2XQ9A 4A98A 4Z90A 3SH1A 2X00A 3WIPA 3C84A 5HEHA 2BYPA 5KZUA 2M6BA 2YN6A 3PMZA 4XHEA 4HFDA 3UU3A 3WTHA 2UZ6A 5HEUA 5CFBA 4UY2A 2YMDA 2Y58A 4ZR6A 4UXUA 5KE4A 4NZBA 1OEDC 2BYRA 2XQ8A 2Y7YA 1OEDA 5L4HA 3U8LA 4ALXA 2XQ3A 2WZYA 3TLWA 3P4WA 3WTKA 3C79A 2YOEA 4DBMA 4FRRA 4BFQA 4TWDA 4ZJSA 2BG9A 3TLVA 4F8HA 4ZZBA 4WV9A 4HFBA 2XNTA 2WNJA 5L47A 1UV6A 3JADA 2ZJUA 5AFJA 4IL4A 2ZJVA 4Z91A 3WTJA 4UM3S 5AFMB 2YKSA 3EI0A 3UUBA 2BR8A 4TNVA 4AFHA 5J5GA 3U8MA 2BR7A 3TLTA 4IL9A 2LLYA 2YMEA 4ZRUA 4HQPA 4COFA 2BYNA 3EHZA 2BG9C 3UU4A 2WN9A 4B5DA 3IGQA 4UM1A 3UU5A 2LKHA 4HFEA 3TLSA 5J5FA 4BQTA 2XQ5A 3LSVA 3U8KA 4HFHA 3UQ7A 4QH5A 4IREA 3ZKRA 2XZ5A 2XQAA 3P50A 4QH4A 4PIRA 4TWFA 3JAFA 2X00D 2XYSA 2M6IA 3U8NA 2XQ7A 2BYSA 5J5IA 4EZ1A 4ILBA 5J5HA 5HEJA 5LG3A 2WNCA 4ILCA 4HFIA 2XNUA 5SYOA 2XZ6A 3GUAA 3UQ4A 4ZJTA 4AFGA 3WTNA 5LXBA 3WTIA 2VL0A 2MAWA 3SQ6A 3PEOA 5HCJA 2XYTA 5TVCA 2XNVA 2PH9A 1OEDB 4TNWA 5IUXA 4QAAA 5BW2A 2LKGA 3RQUA 4XK9A 4LMLA 2XQ4A 3TLUA 5BP0A 3T4MA 1I9BA 4ZK4A 3WTOA 2XQ6A 4D01A 3RHWA 4AFTA 5AFLA 3SIOA 5AFNA 4NPPA 2BYQA 2W8GA 4QH1A 3UU8A 5HEOA 2KSRA 5L4EA 4ILAA 2BG9E 4LMKA 2Y56A 4UM3P 3RIFA 5J0ZA 5CO5A 3UU6A
chains in the Genus database with same CATH superfamily
2E9XA 5AQHB 2H88A 3MXZA 4A56A 4EEDA 4YSZA 3U8JA 3I1AA 4HFCA 4DR6T 3N9OA 4UF0A 3EAMA 3RQWA 3I0OA 4O4IE 2QC1B 1D1CA 1M62A 3OYXA 3VRBA 5JDQA 5JDGA 3CX7B 4CI1B 4CXXA 5EK3A 5LMNT 2IC9A 3C98B 2LSJA 5LMUT 1MIVA 2HN1A 3S4UA 5KX5E 4JI6T 1BR4A 2H3RA 5FY0A 4JI8T 2SPCA 4HGAA 4HWFA 1KEYA 3UU4A 4LF7T 3C51A 5AQMB 4C90A 3OBVE 2VK9A 2NOXA 3FZHB 3P4QA 4IREA 4HEAA 4H9PC 5DQWA 2X0LB 5HXSA 2X66A 3ZC1A 3WAKA 2LJLA 5J5IA 1B7TA 2NR4A 5L3GB 4HFVA 2ZLYA 2XNVA 1WFDA 4DUYT 5BW2A 3N9QA 4D01A 2BBHA 2JMKA 5JDLA 2WS3A 2X0YA 2W8GA 3AE2A 4YJ2E 3FBLA 2ZMAA 4H63V 4OYKA 3ZC0A 3P4SA 2FBWA 5J2UE 4V1Av 5AINA 2WP9A 2JQ9A 3QK6A 4X62T 3CIRA 4L9IA 4JLEA 2ODVA 3WIPA 2X9YA 2M6BA 2N9DA 5KDMC 2NW9A 4KP3C 1BR2A 2NP9A 5F3JA 2PTFA 3JC6C 1U4QA 2YOEA 2W63A 3NBXX 3LDQB 4ILUA 4DV2T 4XZCA 5LBMA 2WNJA 2X9WA 4QXCB 3K1SA 4O8SA 2XM2A 1FIOA 2MYSA 4IL4A 4X1IE 3M3ZB 2WAUA 4H9NC 4B5DA 4UM1A 3SFDA 2V5CA 3G06A 2VWAA 3E22E 2X9XA 4ADZA 4QX7B 5LJNA 2LOSA 3AECA 2MPKA 1J1JA 4EZ1A 5LGUB 5L3CB 4HFIA 3WTNA 1HTJF 3PEOA 4E7SA 4JI4T 1W09A 1ZKEA 2XAJB 5ADXL 2V6XA 4HN9A 5HEOA 2KSRA 2E5VA 1N33T 5J0ZA 2KXPB 3RIAA 4QABA 3FZFB 1HFAA 4ZK1A 1D0YA 2WBLA 2WSSV 1FJGT 1MIYA 2OV9A 2XQ9A 3BQLA 1J5ET 1CUNA 3FXDB 2V6YB 2BYRA 5L4HA 2B76A 4HWCA 2C5IT 2CBJA 3RH3A 4XAXB 2VVNA 4O4JE 4HWDA 3ETVA 4IE6A 3WAJA 2Z6EA 3KV5A 3N2OA 3EI0A 2LSYA 3LBXA 3U8MA 4ZRUA 3FHNA 3RKOA 3D0TA 2BYNA 2JQHA 4PK4A 4IDOA 3KFWX 3F2EA 3ZT7A 4P1NA 3U8KA 1IAPA 1JNRA 3BK9A 3PUQA 3ZYLA 5J5HA 3Q5XA 2XZ6A 1YQ4A 3LJCA 2X67A 2GK9A 5TVCA 4YHHT 4QAAA 2IHR1 4CZZB 4DV6T 2NWBA 3MACA 2WCAA 2CE7A 3AE1A 3AEDA 4IE4A 2X51A 4DMVA 3CK6A 4DV4T 4BAYB 4LMJA 4CXYA 1ZOYA 5FL1A 4DBQA 5E0OA 5HEGA 3V5SA 5AFHA 4JEUB 2HHHT 3ZCJA 1LKXA 3VR9A 2W8FA 3K3NA 5JDMA 2XAGB 3HR0A 4H9SE 2WDRA 2QVAA 2C0SA 4OHFA 1KNRA 4QWNB 3PU8A 4U74A 4DR3T 4EGWA 4CN6A 3T1HT 4I55E 5JTGA 4YFSA 2IUBA 4IE0A 4JV5T 5JQGE 1X79A 3ZMTB 1E1HB 4DR7T 4J2CA 3FXEB 5AFJA 1I6ZA 4UM3S 5IHYA 4AFHA 3AEEA 3TLTA 2BKPA 3P7IA 5KXJA 3TLSA 4WW0A 5FKYA 1XMQT 2HN2A 1MMGA 4QH5A 5FXVA 4TX5A 2V6YA 3T1YT 2CWOA 1R8IA 4ZI2D 5LNKA 4ZJTA 5TAOA 3OPCA 3QOFA 3L39A 4L0RA 2L8KA 1D0ZA 5CA0E 1VCSA 3VKGA 2IAKA 2IW5B 2HPJA 4I4TE 2V5DA 4ILAA 2W2UA 3FBZA 3I0QA 4DMWA 1KNPA 4IHJE 2PGZA 5AFKA 3IEEA 2K9AA 4FI5A 2PJQA 2KZ7B 4EXTA 2JMHA 5IYZE 1UW6A 1HG5A 2BKOA 2NW8A 2Y6XA 5LOVE 5KE4A 3KV9A 4YTMA 3DJBA 3C4XA 3U8LA 3EUHA 1MMDA 2LHNA 3P4WA 5BR8T 3N9NA 3KVAA 3NZPA 4ZZBA 2Q9QA 3O1JA 2E9XC 2ZJUA 3AE8A 3WTJA 5AFMB 2CLYB 3QNUA 3HKBE 4IL9A 2VKOA 4HQPA 3ONJA 3IGQA 3X1DA 4NIQA 2Q9QB 5HYAA 4UIGA 4DO0A 1D0XA 5H6QB 1L0VA 4HFHA 2WU5A 3ZSTA 1HX1B 5LP6E 2XZEA 5JRCA 4EYYR 3ZN0B 3MA9A 1WYCA 2H89A 2XY8B 2XNUA 4ILCA 2DL1A 4IE7A 3UTKA 1XZYA 3ZMUB 2VURA 3A5XA 5IUXA 2LKGA 3PUYF 1U5PA 3IF8B 3CPZA 1I9BA 3AXJA 3Q2MA 2Q9QC 3RIUC 1ZHCA 5L4EA 4KHPT 4LFBT 4AI6A 2LRLA 1KF6A 3CWZB 1IBLT 4JUYA 4QACA 3RRWA 3PUWF 3LK42 3Q5EA 5JREA 4EZ4A 4AKLA 1O3XA 4UXUA 2A72A 5BMVE 2JQQA 3H37A 2DWGA 2BS3A 2F4VT 3M65A 4CXWA 3E08A 3FZKB 5DABA 5DQVA 2WWVA 5M4YA 4GK5E 3AE7A 1UV6A 1YD8G 4X1YE 1SA0E 3PUXF 2BR8A 2N1GA 4YJ3E 2WN9A 1T98A 4PAGA 3EDUA 2D0TA 2XQ5A 5L3FB 3AEFA 2KMFA 1NWMX 3K3OA 3ZKRA 2XZ5A 4ZI3D 2XQAA 3U8NA 5JDFA 2XJ7A 4UELA 5DJQC 3FZLB 3SQ6A 2W4XA 1AJ3A 4ZI3C 3CX6B 4LMLA 2V1DB 1XDPA 2K24A 2LSIA 5AFLA 2UXBT 4PFOA 2QRXA 4WZXA 3ZMZB 2YDSA 4P0BA 4G2AA 4AQGA 4LF9T 4IDPA 4CI3B 4ZI2C 2L3LA 2MTQA 1IBKT 2H7VC 3AA1B 3AE4A 4EEBA 3HA4A 2FJEA 5L3BB 3UU3A 3OJAA 3A8YC 5AQIB 1UUSA 2XQ8A 3SFEA 2AE9A 2Y7YA 3EDVA 5HWYA 2ACZA 5HWXA 4DR1T 1WR6A 3GA8A 5AQJB 5AQKB 1YKEB 2V7IA 3TLVA 4F8HA 4JI1T 2YDQA 2WQYA 5FXZA 5J5GA 5LYJE 3JCFA 4JI0T 2LLYA 2YMEA 2A9UA 2XAQB 1CHUA 5FXXA 3RRCA 4YSXA 3QUJA 2CHOA 2Q9QD 4O4LE 2A2FX 5ETWA 3PV0F 2QYWA 3ZT5A 4EB6E 3VU7H 2WMNA 3P50A 5EK4A 5J2TE 2XYSA 2BYSA 3PUSA 4EOZB 5FMNA 5SYOA 4GKJT 2CHNA 4YTPA 5AQLB 3PE0A 5LHIB 4DUZT 5FVKA 2DI4A 5JR9B 5ABFA 4DVDA 5AQGB 4AFTA 3P4PA 4LMKA 3KBTA 4UM3P 3UU6A 3JAFA 3ANWA 2XSAA 3N2GE 5AQOB 2Y48B 3WTLA 2WNLA 3LFMA 4KHZF 2A3DA 3ZDGA 3WTMA 4H9RC 3VRAA 2BG9B 4GYSA 4UM3A 1Z0PA 2Y54A 3R84B 2HPLA 3C84A 3SOLA 2YN6A 2QGSA 4AKRB 2LE8A 4KI0F 4MBQA 5AQRB 3PUGA 2M67A 2IIUA 2W67A 3UT5E 3TLWA 2NW7A 2E9XD 4PJNA 3K8PC 4WNKA 2BG9A 4BJNA 2LHRA 3AE9A 1UCUA 2FUPA 2WMOA 4TNVA 3SRZA 2CXFA 4ZOLE 4C91A 4PK6A 2UXDT 3AB3B 3J9X1 2BZBA 1T8BA 1XNRT 4ISTA 4X65T 2UXXB 4JI7T 2UUBT 5J5FA 2CA5A 4CI2B 3RGLA 3UQ7A 3AXJB 4JYAT 3N9MA 1DU2A 5AQUB 5FP3A 3P4RA 1JNZA 2E9XB 4I43B 2WDQA 2XYTA 2KINB 2L9QA 2XAFB 1HR0T 1W0AA 3NRXA 2D9DA 4N78D 5F8PA 3SIOA 2BYQA 4YXDA 3GN5A 3RYIE 2BVLA 5LB7B 4E7ZA 1BR0A 1IBMT 2JQKA 3C64A 4H63H 2C5KT 2JIWA 4A98A 4Z90A 2DHRA 4ZS3A 1T7SA 5HEUA 3PU3A 4AKHA 3MKDA 4ZI7E 5F5WA 3KDSE 4IIJE 4FRRA 3B13A 4PJLA 2IC6A 1UX4A 3AEBA 3U3IA 2VB6A 2WY2A 5EZYE 3ZSSA 4MFRA 3AE5A 4Z91A 4CN4A 5ABFB 2K5BB 3IBPA 5ABHA 2BR7A 4KUMB 1V9DA 3RYFE 2PG8A 2YU1A 4BQTA 2V8SV 1EZ3A 2JPFA 2K48A 2CXDA 4TV8E 2E2AA 4DV5T 1IZNB 1M7KA 2ZM6T 1N34T 3GWHA 4PJMA 3GUAA 4MHCA 4AFGA 4GOUA 2BDEA 4GKKT 3ZT6A 3NZQA 1MMAA 5BP0A 2LSGA 4I50E 2J1DG 3RHWA 2KWHA 4BA9A 2XPKA 1MNEA 2BG9E 5CA1E 1Y01A 3AA0B 4DR4T 2ES0A 3OVUA 4EAHA 3MK7C 2ZM0A 1W9RA 4ZZCA 2C9TA 2W66A 3O1HA 2PBIA 2ODUA 2Y8DA 4U7YA 1BR1A 5JDHA 4NZBA 1VRBA 1IJ6A 1FEWA 4AQFC 1WR0A 3C79A 4DBMA 3AE3A 2H7OA 4TV9E 3T8OA 5AQSB 4YSYA 2ZJVA 3UUBA 5C8YE 1ZV4X 2I6HA 2FJAA 2UU9T 4DV0T 4COFA 3EHZA 4EZHA 4OX9T 2OA5A 2WZHA 4JI2T 4ZXLA 2IMLA 2W0GA 2R6GF 4TWFA 4UVBB 2VASA 3ONLC 4U72A 2QA7A 5ABEA 1HNWT 2WU2A 3CQXC 3PTRB 4Z8XA 3F31A 3PUVF 3C4ZA 1N36T 2XQ6A 3GMIA 3HI2A 2LRKA 2EHOB 2V7JA 5JRCB 4DV3T 5LA6E 3IHRA 4LFCT 3CQGB 3ZYMA 4H9QC 4NXMT 2WDVA 3RC3A 4YHJA 1OEDE 2NTXA 3PJAJ 5FJVA 3RI5A 3SQ9A 4ISSA 3E0ZA 1NEKA 1VOMA 2X00A 1XDOA 3HKDE 2UZ6A 5JR9C 4IDQA 1OEDA 3ZLIA 3AEGA 2CBIA 4P0AA 5JR9A 3WTKA 3Q5DA 2J4GA 2CWYA 3PURA 3OYZA 2I0MA 1QUUA 5LGNB 1Y64B 4EIWA 5GONE 4AQFA 2W61A 5AQFB 3FZMB 3AA7B 3IA3A 3KBUA 4MLKA 4WBNE 5LHGB 2MOZA 4K0UA 1XMOT 4H9OC 2X0HA 2J47A 3BQIA 4PIRA 5CGMA 2LSKA 1KNZA 4UVCB 5HEJA 5LG3A 4EYUA 1SUMB 2CRBA 1OXZA 5KMGP 5LXBA 3QB5A 3NKZA 5HCJA 2BBJA 2LT3A 4TNWA 5EK2A 2D5UA 5JVDE 2XASB 2YINA 3ZJ2A 1HX8A 1ZP0A 3K3QC 1H7CA 4KBMB 1YQ3A 5AQQB 3LK3B 5C2TA 3L3PA 3MZKB 3W15B 2BJ0A 4P09A 5AFUL 5HXEA 5BRXA 4HWHA 4U7IA 5FY7A 4K0KT 3I9WA 3SH1A 4PK5A 2XHEB 3PMZA 4ZS2A 3QC9A 3EABA 2VQET 3RLFF 3O4XE 2D2SA 4I0UA 4UXNB 4CN1A 5L2LA 1QSDA 3KV6A 2P9BA 2RP4A 2RPAA 1NENA 1G8XA 4IE5A 3AAEB 2XNTA 5LBQB 3ZMVB 4U3CA 3V5UA 2UUAT 4JBWF 4HTEA 4B3TT 3C50A 3RF1A 3PJAA 3UULA 3ABVA 4PFPA 1HNZT 4FJOA 5HXRA 2VVSA 4B3RT 4X20E 3KVBA 2XTLA 3PDYA 5ABGA 4QH4A 2X9HA 3UUXB 5J1GA 1N32T 5LHHB 4DNDA 3JC6D 1WRDA 2HH7A 2K3WA 3UQ4A 3WTIA 2VL0A 1ZEEA 1OEDB 3PUZF 2XAHB 5LJMA 4XK9A 3RPUA 3WTOA 4GK0E 2AXDS 3AAIA 2XM1A 2G0UA 4QH1A 3C4WA 5L3EB 2EHOA 2YEVC 4OFZA 1NAFA 1UK5A 4UVAB 2CLYC 3UUNA 2MBGA 3HKEE 1UX5A 3AVSA 4HKAA 4NUUA 2I59A 3P8CD 1T72A 4PW8A 3O9XA 4TUYE 2NTYA 2WWUA 1UX2A 5IWAT 3DTOA 4BJMA 3NVOA 5KZUA 4XHEA 3WTHA 5AQNB 3B57A 4UY2A 2YMDA 1FMVA 3OKQA 2UXNB 3EVYA 2WZYA 3Q5WA 2RA1A 2CPTA 4AKIA 4TWDA 2VL8A 4HFBA 4L5GA 1FMWA 1S94A 1YKHB 3ZPOA 2UXCT 4IT4A 3ZCIA 3LBXB 2ACXA 4U31A 3UUMA 2BG9C 2VKJA 4IDNA 4UV9B 3UU5A 2LKHA 2YK0A 2BS2A 4YTNA 3LSVA 3N5LA 5HXHA 2XUEA 1LRZA 3N2KE 2CMRA 2LEHA 3AVRA 5A1LA 1GQEA 2XQYA 4GIWA 3UFGA 2MAWA 2CXLA 4F6RC 5AQVB 2E5LT 2W00A 2EHOD 2XQ4A 3TLUA 2LM9A 4ZK4A 3RC8A 3VR8A 4NPPA 5AFNA 4LF5T 4DV7T 3AE6A 3H3MA 1IJ5A 2JRKA 2LOPA 2KLQA 3AA6B 5JH7E 5JMEA 2ZM8A 4O2AE 4CQIA 4X64T 2DWKA 1OEDC 5LG4A 2KNDA 4AKGA 4X1KE 3CKDA 4ALXA 1J5WA 4AQYT 4WYVA 5FXWA 4ASKA 1HCIA 4ZJSA 1HG2A 4WV9A 4U2YA 1YXRA 2YKSA 1WCRA 5FL0A 4UR9A 4DV1T 2VKHA 2OLTA 2VQFT 3SS1A 3ONXA 4QXHB 3U78A 1G73A 2C5JA 2V7LA 1LVFA 1X9BA 4ILBA 5H6RB 1E7PA 2WNCA 3SWHA 1UURA 5L3DB 3LK2B 5C3JA 4QKNA 1HNXT 1HF8A 1KK7A 1KFYA 3I9YA 5HXCA 4ERRA 5FYMA 3UU8A 4QXBB 2YDRA 4ZHQE 4B6XA 3NRYA 3RIFA 5AQTB 4U33A 2XSBA 4QX8B 5AFMA 2DCFA 3CQCB 2V26A 4ZEYA 4YT0A 4X5TA 3H3AA 2LM2A 4NXNT 4YLHA 1MNDA 3KINB 4O2BE 1XWMA 5HAXA 4AIUA 3R6NA 2FJDA 2CM0A 1W0BA 3F57A 2BVMA 1HS7A 4HFDA 3MJXA 4ZR6A 3O1IA 5FNVE 4M1PA 4QHOA 3WI3A 2DNXA 4LFAT 4TZ4C 4HWIB 3RYHE 3CVRA 2XQ3A 2YU2A 3J7Yq 5LXTE 4BFQA 4A5XA 2E8IA 4UEMA 4DR2T 3L8RA 3JADA 1VCTA 2CCQA 1WLXA 3CX8B 2EHOC 5LGTB 1QLBA 4HE8A 1SHZC 1D1BA 3ETUA 4TN7B 1LVKA 3GN5B 2N2NA 2WZIA 3VKHA 3KV4A 1YW0A 4IDZA 2X00D 2XQ7A 4LF4T 1MIWA 4PJJA 3ZEFB 3B5MA 3RQUA 4ANJA 3LG7A 5LCYA 5AQPB 4DBRA 4O4HE 5FVLA 2D0UA 2Y56A 3T4MA 3AAAB 3FB2A 3RIUA 3BQKA 3JAEA 3N9PA 2PFVA 3ZDHA 1MMNA 4KX6A 4UV8B 5HCMA 4TWHA 4YY3T 4A97A 4UF0B 3CMLA 3QB5K 1S35A 2Y57A 3N9LA 4LF6T 4OYJA 1SE7A 5HEHA 2BYPA 2V7MA 4GYRA 2UUCT 3NWIA 4AISA 5CFBA 4LF8T 2CEAA 3VHLA 2Y58A 3ANWB 3HKCE 4U2ZA 4DR5T 3ZN1B 4MALA 2VKDA 3Q9DA 4JEHB 2BS4A 3RX6A 1US7B 2WM9A 2BKNA 3AEAA 2KWIB 4JI3T 5L47A 4WBOA 2JJ9A 3UFEA 3ZJ1A 3L09A 4OK0A 4JI5T 5JDNA 4KMCA 4Q25A 1UGOA 2B1EA 3ESLA 1XNQT 2ZM2A 3RKGA 2FJBA 4PNIA 4DIDB 2V7KA 2KT9A 3TKLB 4NUVA 5CB4E 4HFEA 4IGUA 2J62A 1WYBA 4EV6A 3OTOT 2M6IA 4B3ST 1D1AA 4AXPA 3DP7A 4X66T 3A7MA 3PUAA 2W62A 3RYCE 2DLRA 4XBFB 2IDOB 2PH9A 1Z8UA 5FY1A 2WB5A 4G63A 1OWAA 3HL6A 3ZYKA 5CJ5A 4B3MT 1E2AA 2X68A 3ZMSB 1I94T 5CO5A
chains in the Genus database with same CATH topology
3JAEA 3RIAA 3ZDHA 4LMJA 5AFMA 5AINA 2PGZA 5HCMA 5AFKA 2BJ0A 3WTLA 4TWHA 1OEDE 5HEGA 2WNLA 3U8JA 4A97A 4HFCA 4QABA 5AFHA 5BRXA 4ZK1A 3ZDGA 4X5TA 3WTMA 5JMEA 2LM2A 4ZZCA 5FJVA 4QACA 2BG9B 3EAMA 3RI5A 1UW6A 3SQ9A 3RQWA 4UM3A 2C9TA 2Y57A 1UX2A 2QC1B 2W8FA 2Y54A 2XQ9A 4A98A 4Z90A 3SH1A 2X00A 3WIPA 3C84A 5HEHA 2BYPA 5KZUA 2M6BA 2YN6A 3PMZA 4XHEA 4HFDA 3UU3A 3WTHA 2UZ6A 5HEUA 5CFBA 4UY2A 2YMDA 2Y58A 4ZR6A 4UXUA 5KE4A 4NZBA 1OEDC 2BYRA 2XQ8A 2Y7YA 1OEDA 5L4HA 3U8LA 4ALXA 2XQ3A 2WZYA 3TLWA 3P4WA 3WTKA 3C79A 2YOEA 4DBMA 4FRRA 4BFQA 4TWDA 4ZJSA 2BG9A 3TLVA 4F8HA 4ZZBA 4WV9A 4HFBA 2XNTA 2WNJA 5L47A 1UV6A 3JADA 2ZJUA 5AFJA 4IL4A 2ZJVA 4Z91A 3WTJA 4UM3S 5AFMB 2YKSA 3EI0A 3UUBA 2BR8A 4TNVA 4AFHA 5J5GA 3U8MA 2BR7A 3TLTA 4IL9A 2LLYA 2YMEA 4ZRUA 4HQPA 4COFA 2BYNA 3EHZA 2BG9C 3UU4A 2WN9A 4B5DA 3IGQA 4UM1A 3UU5A 2LKHA 4HFEA 3TLSA 5J5FA 4BQTA 2XQ5A 3LSVA 3U8KA 4HFHA 3UQ7A 4QH5A 4IREA 3ZKRA 2XZ5A 2XQAA 3P50A 4QH4A 4PIRA 4TWFA 3JAFA 2X00D 2XYSA 2M6IA 3U8NA 2XQ7A 2BYSA 5J5IA 4EZ1A 4ILBA 5J5HA 5HEJA 5LG3A 2WNCA 4ILCA 4HFIA 2XNUA 5SYOA 2XZ6A 3GUAA 3UQ4A 4ZJTA 4AFGA 3WTNA 5LXBA 3WTIA 2VL0A 2MAWA 3SQ6A 3PEOA 5HCJA 2XYTA 5TVCA 2XNVA 2PH9A 1OEDB 4TNWA 5IUXA 4QAAA 5BW2A 2LKGA 3RQUA 4XK9A 4LMLA 2XQ4A 3TLUA 5BP0A 3T4MA 1I9BA 4ZK4A 3WTOA 2XQ6A 4D01A 3RHWA 4AFTA 5AFLA 3SIOA 5AFNA 4NPPA 2BYQA 2W8GA 4QH1A 3UU8A 5HEOA 2KSRA 5L4EA 4ILAA 2BG9E 4LMKA 2Y56A 4UM3P 3RIFA 5J0ZA 5CO5A 3UU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAE A;  3RIA A;  3ZDH A;  4LMJ A;  5AFM A;  5AIN A;  2PGZ A;  5HCM A;  5AFK A;  2BJ0 A;  3WTL A;  4TWH A;  1OED E;  5HEG A;  2WNL A;  3U8J A;  4A97 A;  4HFC A;  4QAB A;  5AFH A;  5BRX A;  4ZK1 A;  3ZDG A;  4X5T A;  3WTM A;  5JME A;  2LM2 A;  4ZZC A;  5FJV A;  4QAC A;  2BG9 B;  3EAM A;  3RI5 A;  1UW6 A;  3SQ9 A;  3RQW A;  4UM3 A;  2C9T A;  2Y57 A;  1UX2 A;  2QC1 B;  2W8F A;  2Y54 A;  2XQ9 A;  4A98 A;  4Z90 A;  3SH1 A;  2X00 A;  3WIP A;  3C84 A;  5HEH A;  2BYP A;  5KZU A;  2M6B A;  2YN6 A;  3PMZ A;  4XHE A;  4HFD A;  3UU3 A;  3WTH A;  2UZ6 A;  5HEU A;  5CFB A;  4UY2 A;  2YMD A;  2Y58 A;  4ZR6 A;  4UXU A;  5KE4 A;  4NZB A;  1OED C;  2BYR A;  2XQ8 A;  2Y7Y A;  1OED A;  5L4H A;  3U8L A;  4ALX A;  2XQ3 A;  2WZY A;  3TLW A;  3P4W A;  3WTK A;  3C79 A;  2YOE A;  4DBM A;  4FRR A;  4BFQ A;  4TWD A;  4ZJS A;  2BG9 A;  3TLV A;  4F8H A;  4ZZB A;  4WV9 A;  4HFB A;  2XNT A;  2WNJ A;  5L47 A;  1UV6 A;  3JAD A;  2ZJU A;  5AFJ A;  4IL4 A;  2ZJV A;  4Z91 A;  3WTJ A;  4UM3 S;  5AFM B;  2YKS A;  3EI0 A;  3UUB A;  2BR8 A;  4TNV A;  4AFH A;  5J5G A;  3U8M A;  2BR7 A;  3TLT A;  4IL9 A;  2LLY A;  2YME A;  4ZRU A;  4HQP A;  4COF A;  2BYN A;  3EHZ A;  2BG9 C;  3UU4 A;  2WN9 A;  4B5D A;  3IGQ A;  4UM1 A;  3UU5 A;  2LKH A;  4HFE A;  3TLS A;  5J5F A;  4BQT A;  2XQ5 A;  3LSV A;  3U8K A;  4HFH A;  3UQ7 A;  4QH5 A;  4IRE A;  3ZKR A;  2XZ5 A;  2XQA A;  3P50 A;  4QH4 A;  4PIR A;  4TWF A;  3JAF A;  2X00 D;  2XYS A;  2M6I A;  3U8N A;  2XQ7 A;  2BYS A;  5J5I A;  4EZ1 A;  4ILB A;  5J5H A;  5HEJ A;  5LG3 A;  2WNC A;  4ILC A;  4HFI A;  2XNU A;  5SYO A;  2XZ6 A;  3GUA A;  3UQ4 A;  4ZJT A;  4AFG A;  3WTN A;  5LXB A;  3WTI A;  2VL0 A;  2MAW A;  3SQ6 A;  3PEO A;  5HCJ A;  2XYT A;  5TVC A;  2XNV A;  2PH9 A;  1OED B;  4TNW A;  5IUX A;  4QAA A;  5BW2 A;  2LKG A;  3RQU A;  4XK9 A;  4LML A;  2XQ4 A;  3TLU A;  5BP0 A;  3T4M A;  1I9B A;  4ZK4 A;  3WTO A;  2XQ6 A;  4D01 A;  3RHW A;  4AFT A;  5AFL A;  3SIO A;  5AFN A;  4NPP A;  2BYQ A;  2W8G A;  4QH1 A;  3UU8 A;  5HEO A;  2KSR A;  5L4E A;  4ILA A;  2BG9 E;  4LMK A;  2Y56 A;  4UM3 P;  3RIF A;  5J0Z A;  5CO5 A;  3UU6 A; 
#chains in the Genus database with same CATH topology
 2E9X A;  5AQH B;  2H88 A;  3MXZ A;  4A56 A;  4EED A;  4YSZ A;  3U8J A;  3I1A A;  4HFC A;  4DR6 T;  3N9O A;  4UF0 A;  3EAM A;  3RQW A;  3I0O A;  4O4I E;  2QC1 B;  1D1C A;  1M62 A;  3OYX A;  3VRB A;  5JDQ A;  5JDG A;  3CX7 B;  4CI1 B;  4CXX A;  5EK3 A;  5LMN T;  2IC9 A;  3C98 B;  2LSJ A;  5LMU T;  1MIV A;  2HN1 A;  3S4U A;  5KX5 E;  4JI6 T;  1BR4 A;  2H3R A;  5FY0 A;  4JI8 T;  2SPC A;  4HGA A;  4HWF A;  1KEY A;  3UU4 A;  4LF7 T;  3C51 A;  5AQM B;  4C90 A;  3OBV E;  2VK9 A;  2NOX A;  3FZH B;  3P4Q A;  4IRE A;  4HEA A;  4H9P C;  5DQW A;  2X0L B;  5HXS A;  2X66 A;  3ZC1 A;  3WAK A;  2LJL A;  5J5I A;  1B7T A;  2NR4 A;  5L3G B;  4HFV A;  2ZLY A;  2XNV A;  1WFD A;  4DUY T;  5BW2 A;  3N9Q A;  4D01 A;  2BBH A;  2JMK A;  5JDL A;  2WS3 A;  2X0Y A;  2W8G A;  3AE2 A;  4YJ2 E;  3FBL A;  2ZMA A;  4H63 V;  4OYK A;  3ZC0 A;  3P4S A;  2FBW A;  5J2U E;  4V1A v;  5AIN A;  2WP9 A;  2JQ9 A;  3QK6 A;  4X62 T;  3CIR A;  4L9I A;  4JLE A;  2ODV A;  3WIP A;  2X9Y A;  2M6B A;  2N9D A;  5KDM C;  2NW9 A;  4KP3 C;  1BR2 A;  2NP9 A;  5F3J A;  2PTF A;  3JC6 C;  1U4Q A;  2YOE A;  2W63 A;  3NBX X;  3LDQ B;  4ILU A;  4DV2 T;  4XZC A;  5LBM A;  2WNJ A;  2X9W A;  4QXC B;  3K1S A;  4O8S A;  2XM2 A;  1FIO A;  2MYS A;  4IL4 A;  4X1I E;  3M3Z B;  2WAU A;  4H9N C;  4B5D A;  4UM1 A;  3SFD A;  2V5C A;  3G06 A;  2VWA A;  3E22 E;  2X9X A;  4ADZ A;  4QX7 B;  5LJN A;  2LOS A;  3AEC A;  2MPK A;  1J1J A;  4EZ1 A;  5LGU B;  5L3C B;  4HFI A;  3WTN A;  1HTJ F;  3PEO A;  4E7S A;  4JI4 T;  1W09 A;  1ZKE A;  2XAJ B;  5ADX L;  2V6X A;  4HN9 A;  5HEO A;  2KSR A;  2E5V A;  1N33 T;  5J0Z A;  2KXP B;  3RIA A;  4QAB A;  3FZF B;  1HFA A;  4ZK1 A;  1D0Y A;  2WBL A;  2WSS V;  1FJG T;  1MIY A;  2OV9 A;  2XQ9 A;  3BQL A;  1J5E T;  1CUN A;  3FXD B;  2V6Y B;  2BYR A;  5L4H A;  2B76 A;  4HWC A;  2C5I T;  2CBJ A;  3RH3 A;  4XAX B;  2VVN A;  4O4J E;  4HWD A;  3ETV A;  4IE6 A;  3WAJ A;  2Z6E A;  3KV5 A;  3N2O A;  3EI0 A;  2LSY A;  3LBX A;  3U8M A;  4ZRU A;  3FHN A;  3RKO A;  3D0T A;  2BYN A;  2JQH A;  4PK4 A;  4IDO A;  3KFW X;  3F2E A;  3ZT7 A;  4P1N A;  3U8K A;  1IAP A;  1JNR A;  3BK9 A;  3PUQ A;  3ZYL A;  5J5H A;  3Q5X A;  2XZ6 A;  1YQ4 A;  3LJC A;  2X67 A;  2GK9 A;  5TVC A;  4YHH T;  4QAA A;  2IHR 1;  4CZZ B;  4DV6 T;  2NWB A;  3MAC A;  2WCA A;  2CE7 A;  3AE1 A;  3AED A;  4IE4 A;  2X51 A;  4DMV A;  3CK6 A;  4DV4 T;  4BAY B;  4LMJ A;  4CXY A;  1ZOY A;  5FL1 A;  4DBQ A;  5E0O A;  5HEG A;  3V5S A;  5AFH A;  4JEU B;  2HHH T;  3ZCJ A;  1LKX A;  3VR9 A;  2W8F A;  3K3N A;  5JDM A;  2XAG B;  3HR0 A;  4H9S E;  2WDR A;  2QVA A;  2C0S A;  4OHF A;  1KNR A;  4QWN B;  3PU8 A;  4U74 A;  4DR3 T;  4EGW A;  4CN6 A;  3T1H T;  4I55 E;  5JTG A;  4YFS A;  2IUB A;  4IE0 A;  4JV5 T;  5JQG E;  1X79 A;  3ZMT B;  1E1H B;  4DR7 T;  4J2C A;  3FXE B;  5AFJ A;  1I6Z A;  4UM3 S;  5IHY A;  4AFH A;  3AEE A;  3TLT A;  2BKP A;  3P7I A;  5KXJ A;  3TLS A;  4WW0 A;  5FKY A;  1XMQ T;  2HN2 A;  1MMG A;  4QH5 A;  5FXV A;  4TX5 A;  2V6Y A;  3T1Y T;  2CWO A;  1R8I A;  4ZI2 D;  5LNK A;  4ZJT A;  5TAO A;  3OPC A;  3QOF A;  3L39 A;  4L0R A;  2L8K A;  1D0Z A;  5CA0 E;  1VCS A;  3VKG A;  2IAK A;  2IW5 B;  2HPJ A;  4I4T E;  2V5D A;  4ILA A;  2W2U A;  3FBZ A;  3I0Q A;  4DMW A;  1KNP A;  4IHJ E;  2PGZ A;  5AFK A;  3IEE A;  2K9A A;  4FI5 A;  2PJQ A;  2KZ7 B;  4EXT A;  2JMH A;  5IYZ E;  1UW6 A;  1HG5 A;  2BKO A;  2NW8 A;  2Y6X A;  5LOV E;  5KE4 A;  3KV9 A;  4YTM A;  3DJB A;  3C4X A;  3U8L A;  3EUH A;  1MMD A;  2LHN A;  3P4W A;  5BR8 T;  3N9N A;  3KVA A;  3NZP A;  4ZZB A;  2Q9Q A;  3O1J A;  2E9X C;  2ZJU A;  3AE8 A;  3WTJ A;  5AFM B;  2CLY B;  3QNU A;  3HKB E;  4IL9 A;  2VKO A;  4HQP A;  3ONJ A;  3IGQ A;  3X1D A;  4NIQ A;  2Q9Q B;  5HYA A;  4UIG A;  4DO0 A;  1D0X A;  5H6Q B;  1L0V A;  4HFH A;  2WU5 A;  3ZST A;  1HX1 B;  5LP6 E;  2XZE A;  5JRC A;  4EYY R;  3ZN0 B;  3MA9 A;  1WYC A;  2H89 A;  2XY8 B;  2XNU A;  4ILC A;  2DL1 A;  4IE7 A;  3UTK A;  1XZY A;  3ZMU B;  2VUR A;  3A5X A;  5IUX A;  2LKG A;  3PUY F;  1U5P A;  3IF8 B;  3CPZ A;  1I9B A;  3AXJ A;  3Q2M A;  2Q9Q C;  3RIU C;  1ZHC A;  5L4E A;  4KHP T;  4LFB T;  4AI6 A;  2LRL A;  1KF6 A;  3CWZ B;  1IBL T;  4JUY A;  4QAC A;  3RRW A;  3PUW F;  3LK4 2;  3Q5E A;  5JRE A;  4EZ4 A;  4AKL A;  1O3X A;  4UXU A;  2A72 A;  5BMV E;  2JQQ A;  3H37 A;  2DWG A;  2BS3 A;  2F4V T;  3M65 A;  4CXW A;  3E08 A;  3FZK B;  5DAB A;  5DQV A;  2WWV A;  5M4Y A;  4GK5 E;  3AE7 A;  1UV6 A;  1YD8 G;  4X1Y E;  1SA0 E;  3PUX F;  2BR8 A;  2N1G A;  4YJ3 E;  2WN9 A;  1T98 A;  4PAG A;  3EDU A;  2D0T A;  2XQ5 A;  5L3F B;  3AEF A;  2KMF A;  1NWM X;  3K3O A;  3ZKR A;  2XZ5 A;  4ZI3 D;  2XQA A;  3U8N A;  5JDF A;  2XJ7 A;  4UEL A;  5DJQ C;  3FZL B;  3SQ6 A;  2W4X A;  1AJ3 A;  4ZI3 C;  3CX6 B;  4LML A;  2V1D B;  1XDP A;  2K24 A;  2LSI A;  5AFL A;  2UXB T;  4PFO A;  2QRX A;  4WZX A;  3ZMZ B;  2YDS A;  4P0B A;  4G2A A;  4AQG A;  4LF9 T;  4IDP A;  4CI3 B;  4ZI2 C;  2L3L A;  2MTQ A;  1IBK T;  2H7V C;  3AA1 B;  3AE4 A;  4EEB A;  3HA4 A;  2FJE A;  5L3B B;  3UU3 A;  3OJA A;  3A8Y C;  5AQI B;  1UUS A;  2XQ8 A;  3SFE A;  2AE9 A;  2Y7Y A;  3EDV A;  5HWY A;  2ACZ A;  5HWX A;  4DR1 T;  1WR6 A;  3GA8 A;  5AQJ B;  5AQK B;  1YKE B;  2V7I A;  3TLV A;  4F8H A;  4JI1 T;  2YDQ A;  2WQY A;  5FXZ A;  5J5G A;  5LYJ E;  3JCF A;  4JI0 T;  2LLY A;  2YME A;  2A9U A;  2XAQ B;  1CHU A;  5FXX A;  3RRC A;  4YSX A;  3QUJ A;  2CHO A;  2Q9Q D;  4O4L E;  2A2F X;  5ETW A;  3PV0 F;  2QYW A;  3ZT5 A;  4EB6 E;  3VU7 H;  2WMN A;  3P50 A;  5EK4 A;  5J2T E;  2XYS A;  2BYS A;  3PUS A;  4EOZ B;  5FMN A;  5SYO A;  4GKJ T;  2CHN A;  4YTP A;  5AQL B;  3PE0 A;  5LHI B;  4DUZ T;  5FVK A;  2DI4 A;  5JR9 B;  5ABF A;  4DVD A;  5AQG B;  4AFT A;  3P4P A;  4LMK A;  3KBT A;  4UM3 P;  3UU6 A;  3JAF A;  3ANW A;  2XSA A;  3N2G E;  5AQO B;  2Y48 B;  3WTL A;  2WNL A;  3LFM A;  4KHZ F;  2A3D A;  3ZDG A;  3WTM A;  4H9R C;  3VRA A;  2BG9 B;  4GYS A;  4UM3 A;  1Z0P A;  2Y54 A;  3R84 B;  2HPL A;  3C84 A;  3SOL A;  2YN6 A;  2QGS A;  4AKR B;  2LE8 A;  4KI0 F;  4MBQ A;  5AQR B;  3PUG A;  2M67 A;  2IIU A;  2W67 A;  3UT5 E;  3TLW A;  2NW7 A;  2E9X D;  4PJN A;  3K8P C;  4WNK A;  2BG9 A;  4BJN A;  2LHR A;  3AE9 A;  1UCU A;  2FUP A;  2WMO A;  4TNV A;  3SRZ A;  2CXF A;  4ZOL E;  4C91 A;  4PK6 A;  2UXD T;  3AB3 B;  3J9X 1;  2BZB A;  1T8B A;  1XNR T;  4IST A;  4X65 T;  2UXX B;  4JI7 T;  2UUB T;  5J5F A;  2CA5 A;  4CI2 B;  3RGL A;  3UQ7 A;  3AXJ B;  4JYA T;  3N9M A;  1DU2 A;  5AQU B;  5FP3 A;  3P4R A;  1JNZ A;  2E9X B;  4I43 B;  2WDQ A;  2XYT A;  2KIN B;  2L9Q A;  2XAF B;  1HR0 T;  1W0A A;  3NRX A;  2D9D A;  4N78 D;  5F8P A;  3SIO A;  2BYQ A;  4YXD A;  3GN5 A;  3RYI E;  2BVL A;  5LB7 B;  4E7Z A;  1BR0 A;  1IBM T;  2JQK A;  3C64 A;  4H63 H;  2C5K T;  2JIW A;  4A98 A;  4Z90 A;  2DHR A;  4ZS3 A;  1T7S A;  5HEU A;  3PU3 A;  4AKH A;  3MKD A;  4ZI7 E;  5F5W A;  3KDS E;  4IIJ E;  4FRR A;  3B13 A;  4PJL A;  2IC6 A;  1UX4 A;  3AEB A;  3U3I A;  2VB6 A;  2WY2 A;  5EZY E;  3ZSS A;  4MFR A;  3AE5 A;  4Z91 A;  4CN4 A;  5ABF B;  2K5B B;  3IBP A;  5ABH A;  2BR7 A;  4KUM B;  1V9D A;  3RYF E;  2PG8 A;  2YU1 A;  4BQT A;  2V8S V;  1EZ3 A;  2JPF A;  2K48 A;  2CXD A;  4TV8 E;  2E2A A;  4DV5 T;  1IZN B;  1M7K A;  2ZM6 T;  1N34 T;  3GWH A;  4PJM A;  3GUA A;  4MHC A;  4AFG A;  4GOU A;  2BDE A;  4GKK T;  3ZT6 A;  3NZQ A;  1MMA A;  5BP0 A;  2LSG A;  4I50 E;  2J1D G;  3RHW A;  2KWH A;  4BA9 A;  2XPK A;  1MNE A;  2BG9 E;  5CA1 E;  1Y01 A;  3AA0 B;  4DR4 T;  2ES0 A;  3OVU A;  4EAH A;  3MK7 C;  2ZM0 A;  1W9R A;  4ZZC A;  2C9T A;  2W66 A;  3O1H A;  2PBI A;  2ODU A;  2Y8D A;  4U7Y A;  1BR1 A;  5JDH A;  4NZB A;  1VRB A;  1IJ6 A;  1FEW A;  4AQF C;  1WR0 A;  3C79 A;  4DBM A;  3AE3 A;  2H7O A;  4TV9 E;  3T8O A;  5AQS B;  4YSY A;  2ZJV A;  3UUB A;  5C8Y E;  1ZV4 X;  2I6H A;  2FJA A;  2UU9 T;  4DV0 T;  4COF A;  3EHZ A;  4EZH A;  4OX9 T;  2OA5 A;  2WZH A;  4JI2 T;  4ZXL A;  2IML A;  2W0G A;  2R6G F;  4TWF A;  4UVB B;  2VAS A;  3ONL C;  4U72 A;  2QA7 A;  5ABE A;  1HNW T;  2WU2 A;  3CQX C;  3PTR B;  4Z8X A;  3F31 A;  3PUV F;  3C4Z A;  1N36 T;  2XQ6 A;  3GMI A;  3HI2 A;  2LRK A;  2EHO B;  2V7J A;  5JRC B;  4DV3 T;  5LA6 E;  3IHR A;  4LFC T;  3CQG B;  3ZYM A;  4H9Q C;  4NXM T;  2WDV A;  3RC3 A;  4YHJ A;  1OED E;  2NTX A;  3PJA J;  5FJV A;  3RI5 A;  3SQ9 A;  4ISS A;  3E0Z A;  1NEK A;  1VOM A;  2X00 A;  1XDO A;  3HKD E;  2UZ6 A;  5JR9 C;  4IDQ A;  1OED A;  3ZLI A;  3AEG A;  2CBI A;  4P0A A;  5JR9 A;  3WTK A;  3Q5D A;  2J4G A;  2CWY A;  3PUR A;  3OYZ A;  2I0M A;  1QUU A;  5LGN B;  1Y64 B;  4EIW A;  5GON E;  4AQF A;  2W61 A;  5AQF B;  3FZM B;  3AA7 B;  3IA3 A;  3KBU A;  4MLK A;  4WBN E;  5LHG B;  2MOZ A;  4K0U A;  1XMO T;  4H9O C;  2X0H A;  2J47 A;  3BQI A;  4PIR A;  5CGM A;  2LSK A;  1KNZ A;  4UVC B;  5HEJ A;  5LG3 A;  4EYU A;  1SUM B;  2CRB A;  1OXZ A;  5KMG P;  5LXB A;  3QB5 A;  3NKZ A;  5HCJ A;  2BBJ A;  2LT3 A;  4TNW A;  5EK2 A;  2D5U A;  5JVD E;  2XAS B;  2YIN A;  3ZJ2 A;  1HX8 A;  1ZP0 A;  3K3Q C;  1H7C A;  4KBM B;  1YQ3 A;  5AQQ B;  3LK3 B;  5C2T A;  3L3P A;  3MZK B;  3W15 B;  2BJ0 A;  4P09 A;  5AFU L;  5HXE A;  5BRX A;  4HWH A;  4U7I A;  5FY7 A;  4K0K T;  3I9W A;  3SH1 A;  4PK5 A;  2XHE B;  3PMZ A;  4ZS2 A;  3QC9 A;  3EAB A;  2VQE T;  3RLF F;  3O4X E;  2D2S A;  4I0U A;  4UXN B;  4CN1 A;  5L2L A;  1QSD A;  3KV6 A;  2P9B A;  2RP4 A;  2RPA A;  1NEN A;  1G8X A;  4IE5 A;  3AAE B;  2XNT A;  5LBQ B;  3ZMV B;  4U3C A;  3V5U A;  2UUA T;  4JBW F;  4HTE A;  4B3T T;  3C50 A;  3RF1 A;  3PJA A;  3UUL A;  3ABV A;  4PFP A;  1HNZ T;  4FJO A;  5HXR A;  2VVS A;  4B3R T;  4X20 E;  3KVB A;  2XTL A;  3PDY A;  5ABG A;  4QH4 A;  2X9H A;  3UUX B;  5J1G A;  1N32 T;  5LHH B;  4DND A;  3JC6 D;  1WRD A;  2HH7 A;  2K3W A;  3UQ4 A;  3WTI A;  2VL0 A;  1ZEE A;  1OED B;  3PUZ F;  2XAH B;  5LJM A;  4XK9 A;  3RPU A;  3WTO A;  4GK0 E;  2AXD S;  3AAI A;  2XM1 A;  2G0U A;  4QH1 A;  3C4W A;  5L3E B;  2EHO A;  2YEV C;  4OFZ A;  1NAF A;  1UK5 A;  4UVA B;  2CLY C;  3UUN A;  2MBG A;  3HKE E;  1UX5 A;  3AVS A;  4HKA A;  4NUU A;  2I59 A;  3P8C D;  1T72 A;  4PW8 A;  3O9X A;  4TUY E;  2NTY A;  2WWU A;  1UX2 A;  5IWA T;  3DTO A;  4BJM A;  3NVO A;  5KZU A;  4XHE A;  3WTH A;  5AQN B;  3B57 A;  4UY2 A;  2YMD A;  1FMV A;  3OKQ A;  2UXN B;  3EVY A;  2WZY A;  3Q5W A;  2RA1 A;  2CPT A;  4AKI A;  4TWD A;  2VL8 A;  4HFB A;  4L5G A;  1FMW A;  1S94 A;  1YKH B;  3ZPO A;  2UXC T;  4IT4 A;  3ZCI A;  3LBX B;  2ACX A;  4U31 A;  3UUM A;  2BG9 C;  2VKJ A;  4IDN A;  4UV9 B;  3UU5 A;  2LKH A;  2YK0 A;  2BS2 A;  4YTN A;  3LSV A;  3N5L A;  5HXH A;  2XUE A;  1LRZ A;  3N2K E;  2CMR A;  2LEH A;  3AVR A;  5A1L A;  1GQE A;  2XQY A;  4GIW A;  3UFG A;  2MAW A;  2CXL A;  4F6R C;  5AQV B;  2E5L T;  2W00 A;  2EHO D;  2XQ4 A;  3TLU A;  2LM9 A;  4ZK4 A;  3RC8 A;  3VR8 A;  4NPP A;  5AFN A;  4LF5 T;  4DV7 T;  3AE6 A;  3H3M A;  1IJ5 A;  2JRK A;  2LOP A;  2KLQ A;  3AA6 B;  5JH7 E;  5JME A;  2ZM8 A;  4O2A E;  4CQI A;  4X64 T;  2DWK A;  1OED C;  5LG4 A;  2KND A;  4AKG A;  4X1K E;  3CKD A;  4ALX A;  1J5W A;  4AQY T;  4WYV A;  5FXW A;  4ASK A;  1HCI A;  4ZJS A;  1HG2 A;  4WV9 A;  4U2Y A;  1YXR A;  2YKS A;  1WCR A;  5FL0 A;  4UR9 A;  4DV1 T;  2VKH A;  2OLT A;  2VQF T;  3SS1 A;  3ONX A;  4QXH B;  3U78 A;  1G73 A;  2C5J A;  2V7L A;  1LVF A;  1X9B A;  4ILB A;  5H6R B;  1E7P A;  2WNC A;  3SWH A;  1UUR A;  5L3D B;  3LK2 B;  5C3J A;  4QKN A;  1HNX T;  1HF8 A;  1KK7 A;  1KFY A;  3I9Y A;  5HXC A;  4ERR A;  5FYM A;  3UU8 A;  4QXB B;  2YDR A;  4ZHQ E;  4B6X A;  3NRY A;  3RIF A;  5AQT B;  4U33 A;  2XSB A;  4QX8 B;  5AFM A;  2DCF A;  3CQC B;  2V26 A;  4ZEY A;  4YT0 A;  4X5T A;  3H3A A;  2LM2 A;  4NXN T;  4YLH A;  1MND A;  3KIN B;  4O2B E;  1XWM A;  5HAX A;  4AIU A;  3R6N A;  2FJD A;  2CM0 A;  1W0B A;  3F57 A;  2BVM A;  1HS7 A;  4HFD A;  3MJX A;  4ZR6 A;  3O1I A;  5FNV E;  4M1P A;  4QHO A;  3WI3 A;  2DNX A;  4LFA T;  4TZ4 C;  4HWI B;  3RYH E;  3CVR A;  2XQ3 A;  2YU2 A;  3J7Y q;  5LXT E;  4BFQ A;  4A5X A;  2E8I A;  4UEM A;  4DR2 T;  3L8R A;  3JAD A;  1VCT A;  2CCQ A;  1WLX A;  3CX8 B;  2EHO C;  5LGT B;  1QLB A;  4HE8 A;  1SHZ C;  1D1B A;  3ETU A;  4TN7 B;  1LVK A;  3GN5 B;  2N2N A;  2WZI A;  3VKH A;  3KV4 A;  1YW0 A;  4IDZ A;  2X00 D;  2XQ7 A;  4LF4 T;  1MIW A;  4PJJ A;  3ZEF B;  3B5M A;  3RQU A;  4ANJ A;  3LG7 A;  5LCY A;  5AQP B;  4DBR A;  4O4H E;  5FVL A;  2D0U A;  2Y56 A;  3T4M A;  3AAA B;  3FB2 A;  3RIU A;  3BQK A;  3JAE A;  3N9P A;  2PFV A;  3ZDH A;  1MMN A;  4KX6 A;  4UV8 B;  5HCM A;  4TWH A;  4YY3 T;  4A97 A;  4UF0 B;  3CML A;  3QB5 K;  1S35 A;  2Y57 A;  3N9L A;  4LF6 T;  4OYJ A;  1SE7 A;  5HEH A;  2BYP A;  2V7M A;  4GYR A;  2UUC T;  3NWI A;  4AIS A;  5CFB A;  4LF8 T;  2CEA A;  3VHL A;  2Y58 A;  3ANW B;  3HKC E;  4U2Z A;  4DR5 T;  3ZN1 B;  4MAL A;  2VKD A;  3Q9D A;  4JEH B;  2BS4 A;  3RX6 A;  1US7 B;  2WM9 A;  2BKN A;  3AEA A;  2KWI B;  4JI3 T;  5L47 A;  4WBO A;  2JJ9 A;  3UFE A;  3ZJ1 A;  3L09 A;  4OK0 A;  4JI5 T;  5JDN A;  4KMC A;  4Q25 A;  1UGO A;  2B1E A;  3ESL A;  1XNQ T;  2ZM2 A;  3RKG A;  2FJB A;  4PNI A;  4DID B;  2V7K A;  2KT9 A;  3TKL B;  4NUV A;  5CB4 E;  4HFE A;  4IGU A;  2J62 A;  1WYB A;  4EV6 A;  3OTO T;  2M6I A;  4B3S T;  1D1A A;  4AXP A;  3DP7 A;  4X66 T;  3A7M A;  3PUA A;  2W62 A;  3RYC E;  2DLR A;  4XBF B;  2IDO B;  2PH9 A;  1Z8U A;  5FY1 A;  2WB5 A;  4G63 A;  1OWA A;  3HL6 A;  3ZYK A;  5CJ5 A;  4B3M T;  1E2A A;  2X68 A;  3ZMS B;  1I94 T;  5CO5 A; 
#chains in the Genus database with same CATH homology
 3JAE A;  3RIA A;  3ZDH A;  4LMJ A;  5AFM A;  5AIN A;  2PGZ A;  5HCM A;  5AFK A;  2BJ0 A;  3WTL A;  4TWH A;  1OED E;  5HEG A;  2WNL A;  3U8J A;  4A97 A;  4HFC A;  4QAB A;  5AFH A;  5BRX A;  4ZK1 A;  3ZDG A;  4X5T A;  3WTM A;  5JME A;  2LM2 A;  4ZZC A;  5FJV A;  4QAC A;  2BG9 B;  3EAM A;  3RI5 A;  1UW6 A;  3SQ9 A;  3RQW A;  4UM3 A;  2C9T A;  2Y57 A;  1UX2 A;  2QC1 B;  2W8F A;  2Y54 A;  2XQ9 A;  4A98 A;  4Z90 A;  3SH1 A;  2X00 A;  3WIP A;  3C84 A;  5HEH A;  2BYP A;  5KZU A;  2M6B A;  2YN6 A;  3PMZ A;  4XHE A;  4HFD A;  3UU3 A;  3WTH A;  2UZ6 A;  5HEU A;  5CFB A;  4UY2 A;  2YMD A;  2Y58 A;  4ZR6 A;  4UXU A;  5KE4 A;  4NZB A;  1OED C;  2BYR A;  2XQ8 A;  2Y7Y A;  1OED A;  5L4H A;  3U8L A;  4ALX A;  2XQ3 A;  2WZY A;  3TLW A;  3P4W A;  3WTK A;  3C79 A;  2YOE A;  4DBM A;  4FRR A;  4BFQ A;  4TWD A;  4ZJS A;  2BG9 A;  3TLV A;  4F8H A;  4ZZB A;  4WV9 A;  4HFB A;  2XNT A;  2WNJ A;  5L47 A;  1UV6 A;  3JAD A;  2ZJU A;  5AFJ A;  4IL4 A;  2ZJV A;  4Z91 A;  3WTJ A;  4UM3 S;  5AFM B;  2YKS A;  3EI0 A;  3UUB A;  2BR8 A;  4TNV A;  4AFH A;  5J5G A;  3U8M A;  2BR7 A;  3TLT A;  4IL9 A;  2LLY A;  2YME A;  4ZRU A;  4HQP A;  4COF A;  2BYN A;  3EHZ A;  2BG9 C;  3UU4 A;  2WN9 A;  4B5D A;  3IGQ A;  4UM1 A;  3UU5 A;  2LKH A;  4HFE A;  3TLS A;  5J5F A;  4BQT A;  2XQ5 A;  3LSV A;  3U8K A;  4HFH A;  3UQ7 A;  4QH5 A;  4IRE A;  3ZKR A;  2XZ5 A;  2XQA A;  3P50 A;  4QH4 A;  4PIR A;  4TWF A;  3JAF A;  2X00 D;  2XYS A;  2M6I A;  3U8N A;  2XQ7 A;  2BYS A;  5J5I A;  4EZ1 A;  4ILB A;  5J5H A;  5HEJ A;  5LG3 A;  2WNC A;  4ILC A;  4HFI A;  2XNU A;  5SYO A;  2XZ6 A;  3GUA A;  3UQ4 A;  4ZJT A;  4AFG A;  3WTN A;  5LXB A;  3WTI A;  2VL0 A;  2MAW A;  3SQ6 A;  3PEO A;  5HCJ A;  2XYT A;  5TVC A;  2XNV A;  2PH9 A;  1OED B;  4TNW A;  5IUX A;  4QAA A;  5BW2 A;  2LKG A;  3RQU A;  4XK9 A;  4LML A;  2XQ4 A;  3TLU A;  5BP0 A;  3T4M A;  1I9B A;  4ZK4 A;  3WTO A;  2XQ6 A;  4D01 A;  3RHW A;  4AFT A;  5AFL A;  3SIO A;  5AFN A;  4NPP A;  2BYQ A;  2W8G A;  4QH1 A;  3UU8 A;  5HEO A;  2KSR A;  5L4E A;  4ILA A;  2BG9 E;  4LMK A;  2Y56 A;  4UM3 P;  3RIF A;  5J0Z A;  5CO5 A;  3UU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...