3WTLA

Crystal structure of lymnaea stagnalis acetylcholine binding protein complexed with nitromethylene analogue of imidacloprid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 52
structure length 208
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wtlA00
3JAEA 5HEOA 5IUXA 4UY2A 4AFHA 5L47A 3JADA 5HEUA 5AFLA 3WTIA 2BYPA 5TVCA 4HFIA 5JMEA 4QABA 3ZDHA 3RI5A 3ZKRA 3C79A 4IREA 3WTKA 4LMKA 3UU6A 2XQAA 3UU5A 4UM3A 2WZYA 4AFTA 2Y56A 4WV9A 3SH1A 4HQPA 4D01A 2BG9C 3EHZA 4UM3S 5HCJA 4F8HA 4ZZCA 3U8KA 2XQ6A 4ALXA 5KZUA 2XNVA 4Z90A 5HEGA 5KE4A 2WNCA 3WTMA 5BW2A 4AFGA 4A98A 3WTOA 3SQ9A 4UXUA 3UQ7A 2BR7A 4QH5A 5SYOA 4ILBA 4TWFA 5HCMA 2BG9B 2BYSA 2XYTA 2W8FA 3UU8A 2XQ5A 3TLSA 1UW6A 4ILCA 2C9TA 3RIFA 4HFDA 5J5FA 2QC1B 5LXBA 3WIPA 2BYRA 4Z91A 4TWDA 3WTJA 4BFQA 5J0ZA 1UX2A 4ZK1A 2XNTA 5AFJA 2WNJA 4PIRA 4ZRUA 2XZ5A 2XQ3A 4COFA 4ILAA 3T4MA 5BRXA 4HFHA 2Y7YA 4QH1A 5CFBA 2XQ9A 3RHWA 4NZBA 4QACA 5AFMA 1I9BA 3U8JA 5LG3A 5BP0A 4ZZBA 2Y54A 2YN6A 4XK9A 3RQWA 2ZJUA 2XNUA 4LMLA 2W8GA 2BYNA 3UU4A 2WNLA 3RQUA 2X00A 3EAMA 2XZ6A 2XQ8A 4A97A 4BQTA 3U8MA 2YMDA 3P4WA 2YOEA 4ZJSA 4HFBA 3GUAA 3WTHA 3TLTA 5AFHA 4HFEA 4LMJA 5J5IA 2VL0A 5AFKA 4ZJTA 4TWHA 2ZJVA 5HEJA 4UM1A 3EI0A 4QH4A 4ZK4A 3IGQA 2XQ7A 2Y57A 2BR8A 4HFCA 3ZDGA 4ZR6A 4DBMA 2YMEA 2X00D 3TLUA 4TNWA 3PEOA 3U8LA 3TLWA 4X5TA 5L4EA 4XHEA 2XQ4A 5L4HA 1UV6A 4TNVA 2BG9A 2YKSA 5J5GA 4FRRA 2PH9A 2BJ0A 3RIAA 2Y58A 5AFNA 5FJVA 2BYQA 4NPPA 5HEHA 3UUBA 2XYSA 3UU3A 4IL9A 3WTLA 3JAFA 5CO5A 4QAAA 3UQ4A 3U8NA 3LSVA 5AINA 2PGZA 2WN9A 2BG9E 3C84A 4UM3P 3P50A 3PMZA 4B5DA 2UZ6A 5AFMB 4EZ1A 3SIOA 3SQ6A 3TLVA 3WTNA 5J5HA 4IL4A
chains in the Genus database with same CATH superfamily
3JAEA 5HEOA 5IUXA 4UY2A 4AFHA 5L47A 3JADA 5HEUA 5AFLA 3WTIA 2BYPA 5TVCA 4HFIA 5JMEA 4QABA 3ZDHA 3RI5A 3ZKRA 3C79A 4IREA 3WTKA 4LMKA 3UU6A 2XQAA 3UU5A 4UM3A 2WZYA 4AFTA 2Y56A 4WV9A 3SH1A 4HQPA 4D01A 2BG9C 3EHZA 4UM3S 5HCJA 4F8HA 4ZZCA 3U8KA 2XQ6A 4ALXA 5KZUA 2XNVA 4Z90A 5HEGA 5KE4A 2WNCA 3WTMA 5BW2A 4AFGA 4A98A 3WTOA 3SQ9A 4UXUA 3UQ7A 2BR7A 4QH5A 5SYOA 4ILBA 4TWFA 5HCMA 2BG9B 2BYSA 2XYTA 2W8FA 3UU8A 2XQ5A 3TLSA 1UW6A 4ILCA 2C9TA 3RIFA 4HFDA 5J5FA 2QC1B 5LXBA 3WIPA 2BYRA 4Z91A 4TWDA 3WTJA 4BFQA 5J0ZA 1UX2A 4ZK1A 2XNTA 5AFJA 2WNJA 4PIRA 4ZRUA 2XZ5A 2XQ3A 4COFA 4ILAA 3T4MA 5BRXA 4HFHA 2Y7YA 4QH1A 5CFBA 2XQ9A 3RHWA 4NZBA 4QACA 5AFMA 1I9BA 3U8JA 5LG3A 5BP0A 4ZZBA 2Y54A 2YN6A 4XK9A 3RQWA 2ZJUA 2XNUA 4LMLA 2W8GA 2BYNA 3UU4A 2WNLA 3RQUA 2X00A 3EAMA 2XZ6A 2XQ8A 4A97A 4BQTA 3U8MA 2YMDA 3P4WA 2YOEA 4ZJSA 4HFBA 3GUAA 3WTHA 3TLTA 5AFHA 4HFEA 4LMJA 5J5IA 2VL0A 5AFKA 4ZJTA 4TWHA 2ZJVA 5HEJA 4UM1A 3EI0A 4QH4A 4ZK4A 3IGQA 2XQ7A 2Y57A 2BR8A 4HFCA 3ZDGA 4ZR6A 4DBMA 2YMEA 2X00D 3TLUA 4TNWA 3PEOA 3U8LA 3TLWA 4X5TA 5L4EA 4XHEA 2XQ4A 5L4HA 1UV6A 4TNVA 2BG9A 2YKSA 5J5GA 4FRRA 2PH9A 2BJ0A 3RIAA 2Y58A 5AFNA 5FJVA 2BYQA 4NPPA 5HEHA 3UUBA 2XYSA 3UU3A 4IL9A 3WTLA 3JAFA 5CO5A 4QAAA 3UQ4A 3U8NA 3LSVA 5AINA 2PGZA 2WN9A 2BG9E 3C84A 4UM3P 3P50A 3PMZA 4B5DA 2UZ6A 5AFMB 4EZ1A 3SIOA 3SQ6A 3TLVA 3WTNA 5J5HA 4IL4A
chains in the Genus database with same CATH topology
3JAEA 5HEOA 5IUXA 4UY2A 4AFHA 5L47A 3JADA 5HEUA 5AFLA 3WTIA 2BYPA 5TVCA 4HFIA 5JMEA 4QABA 3ZDHA 3RI5A 3ZKRA 3C79A 4IREA 3WTKA 4LMKA 3UU6A 2XQAA 3UU5A 4UM3A 2WZYA 4AFTA 2Y56A 4WV9A 3SH1A 4HQPA 4D01A 2BG9C 3EHZA 4UM3S 5HCJA 4F8HA 4ZZCA 3U8KA 2XQ6A 4ALXA 5KZUA 2XNVA 4Z90A 5HEGA 5KE4A 2WNCA 3WTMA 5BW2A 4AFGA 4A98A 3WTOA 3SQ9A 4UXUA 3UQ7A 2BR7A 4QH5A 5SYOA 4ILBA 4TWFA 5HCMA 2BG9B 2BYSA 2XYTA 2W8FA 3UU8A 2XQ5A 3TLSA 1UW6A 4ILCA 2C9TA 3RIFA 4HFDA 5J5FA 2QC1B 5LXBA 3WIPA 2BYRA 4Z91A 4TWDA 3WTJA 4BFQA 5J0ZA 1UX2A 4ZK1A 2XNTA 5AFJA 2WNJA 4PIRA 4ZRUA 2XZ5A 2XQ3A 4COFA 4ILAA 3T4MA 5BRXA 4HFHA 2Y7YA 4QH1A 5CFBA 2XQ9A 3RHWA 4NZBA 4QACA 5AFMA 1I9BA 3U8JA 5LG3A 5BP0A 4ZZBA 2Y54A 2YN6A 4XK9A 3RQWA 2ZJUA 2XNUA 4LMLA 2W8GA 2BYNA 3UU4A 2WNLA 3RQUA 2X00A 3EAMA 2XZ6A 2XQ8A 4A97A 4BQTA 3U8MA 2YMDA 3P4WA 2YOEA 4ZJSA 4HFBA 3GUAA 3WTHA 3TLTA 5AFHA 4HFEA 4LMJA 5J5IA 2VL0A 5AFKA 4ZJTA 4TWHA 2ZJVA 5HEJA 4UM1A 3EI0A 4QH4A 4ZK4A 3IGQA 2XQ7A 2Y57A 2BR8A 4HFCA 3ZDGA 4ZR6A 4DBMA 2YMEA 2X00D 3TLUA 4TNWA 3PEOA 3U8LA 3TLWA 4X5TA 5L4EA 4XHEA 2XQ4A 5L4HA 1UV6A 4TNVA 2BG9A 2YKSA 5J5GA 4FRRA 2PH9A 2BJ0A 3RIAA 2Y58A 5AFNA 5FJVA 2BYQA 4NPPA 5HEHA 3UUBA 2XYSA 3UU3A 4IL9A 3WTLA 3JAFA 5CO5A 4QAAA 3UQ4A 3U8NA 3LSVA 5AINA 2PGZA 2WN9A 2BG9E 3C84A 4UM3P 3P50A 3PMZA 4B5DA 2UZ6A 5AFMB 4EZ1A 3SIOA 3SQ6A 3TLVA 3WTNA 5J5HA 4IL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAE A;  5HEO A;  5IUX A;  4UY2 A;  4AFH A;  5L47 A;  3JAD A;  5HEU A;  5AFL A;  3WTI A;  2BYP A;  5TVC A;  4HFI A;  5JME A;  4QAB A;  3ZDH A;  3RI5 A;  3ZKR A;  3C79 A;  4IRE A;  3WTK A;  4LMK A;  3UU6 A;  2XQA A;  3UU5 A;  4UM3 A;  2WZY A;  4AFT A;  2Y56 A;  4WV9 A;  3SH1 A;  4HQP A;  4D01 A;  2BG9 C;  3EHZ A;  4UM3 S;  5HCJ A;  4F8H A;  4ZZC A;  3U8K A;  2XQ6 A;  4ALX A;  5KZU A;  2XNV A;  4Z90 A;  5HEG A;  5KE4 A;  2WNC A;  3WTM A;  5BW2 A;  4AFG A;  4A98 A;  3WTO A;  3SQ9 A;  4UXU A;  3UQ7 A;  2BR7 A;  4QH5 A;  5SYO A;  4ILB A;  4TWF A;  5HCM A;  2BG9 B;  2BYS A;  2XYT A;  2W8F A;  3UU8 A;  2XQ5 A;  3TLS A;  1UW6 A;  4ILC A;  2C9T A;  3RIF A;  4HFD A;  5J5F A;  2QC1 B;  5LXB A;  3WIP A;  2BYR A;  4Z91 A;  4TWD A;  3WTJ A;  4BFQ A;  5J0Z A;  1UX2 A;  4ZK1 A;  2XNT A;  5AFJ A;  2WNJ A;  4PIR A;  4ZRU A;  2XZ5 A;  2XQ3 A;  4COF A;  4ILA A;  3T4M A;  5BRX A;  4HFH A;  2Y7Y A;  4QH1 A;  5CFB A;  2XQ9 A;  3RHW A;  4NZB A;  4QAC A;  5AFM A;  1I9B A;  3U8J A;  5LG3 A;  5BP0 A;  4ZZB A;  2Y54 A;  2YN6 A;  4XK9 A;  3RQW A;  2ZJU A;  2XNU A;  4LML A;  2W8G A;  2BYN A;  3UU4 A;  2WNL A;  3RQU A;  2X00 A;  3EAM A;  2XZ6 A;  2XQ8 A;  4A97 A;  4BQT A;  3U8M A;  2YMD A;  3P4W A;  2YOE A;  4ZJS A;  4HFB A;  3GUA A;  3WTH A;  3TLT A;  5AFH A;  4HFE A;  4LMJ A;  5J5I A;  2VL0 A;  5AFK A;  4ZJT A;  4TWH A;  2ZJV A;  5HEJ A;  4UM1 A;  3EI0 A;  4QH4 A;  4ZK4 A;  3IGQ A;  2XQ7 A;  2Y57 A;  2BR8 A;  4HFC A;  3ZDG A;  4ZR6 A;  4DBM A;  2YME A;  2X00 D;  3TLU A;  4TNW A;  3PEO A;  3U8L A;  3TLW A;  4X5T A;  5L4E A;  4XHE A;  2XQ4 A;  5L4H A;  1UV6 A;  4TNV A;  2BG9 A;  2YKS A;  5J5G A;  4FRR A;  2PH9 A;  2BJ0 A;  3RIA A;  2Y58 A;  5AFN A;  5FJV A;  2BYQ A;  4NPP A;  5HEH A;  3UUB A;  2XYS A;  3UU3 A;  4IL9 A;  3WTL A;  3JAF A;  5CO5 A;  4QAA A;  3UQ4 A;  3U8N A;  3LSV A;  5AIN A;  2PGZ A;  2WN9 A;  2BG9 E;  3C84 A;  4UM3 P;  3P50 A;  3PMZ A;  4B5D A;  2UZ6 A;  5AFM B;  4EZ1 A;  3SIO A;  3SQ6 A;  3TLV A;  3WTN A;  5J5H A;  4IL4 A; 
#chains in the Genus database with same CATH topology
 3JAE A;  5HEO A;  5IUX A;  4UY2 A;  4AFH A;  5L47 A;  3JAD A;  5HEU A;  5AFL A;  3WTI A;  2BYP A;  5TVC A;  4HFI A;  5JME A;  4QAB A;  3ZDH A;  3RI5 A;  3ZKR A;  3C79 A;  4IRE A;  3WTK A;  4LMK A;  3UU6 A;  2XQA A;  3UU5 A;  4UM3 A;  2WZY A;  4AFT A;  2Y56 A;  4WV9 A;  3SH1 A;  4HQP A;  4D01 A;  2BG9 C;  3EHZ A;  4UM3 S;  5HCJ A;  4F8H A;  4ZZC A;  3U8K A;  2XQ6 A;  4ALX A;  5KZU A;  2XNV A;  4Z90 A;  5HEG A;  5KE4 A;  2WNC A;  3WTM A;  5BW2 A;  4AFG A;  4A98 A;  3WTO A;  3SQ9 A;  4UXU A;  3UQ7 A;  2BR7 A;  4QH5 A;  5SYO A;  4ILB A;  4TWF A;  5HCM A;  2BG9 B;  2BYS A;  2XYT A;  2W8F A;  3UU8 A;  2XQ5 A;  3TLS A;  1UW6 A;  4ILC A;  2C9T A;  3RIF A;  4HFD A;  5J5F A;  2QC1 B;  5LXB A;  3WIP A;  2BYR A;  4Z91 A;  4TWD A;  3WTJ A;  4BFQ A;  5J0Z A;  1UX2 A;  4ZK1 A;  2XNT A;  5AFJ A;  2WNJ A;  4PIR A;  4ZRU A;  2XZ5 A;  2XQ3 A;  4COF A;  4ILA A;  3T4M A;  5BRX A;  4HFH A;  2Y7Y A;  4QH1 A;  5CFB A;  2XQ9 A;  3RHW A;  4NZB A;  4QAC A;  5AFM A;  1I9B A;  3U8J A;  5LG3 A;  5BP0 A;  4ZZB A;  2Y54 A;  2YN6 A;  4XK9 A;  3RQW A;  2ZJU A;  2XNU A;  4LML A;  2W8G A;  2BYN A;  3UU4 A;  2WNL A;  3RQU A;  2X00 A;  3EAM A;  2XZ6 A;  2XQ8 A;  4A97 A;  4BQT A;  3U8M A;  2YMD A;  3P4W A;  2YOE A;  4ZJS A;  4HFB A;  3GUA A;  3WTH A;  3TLT A;  5AFH A;  4HFE A;  4LMJ A;  5J5I A;  2VL0 A;  5AFK A;  4ZJT A;  4TWH A;  2ZJV A;  5HEJ A;  4UM1 A;  3EI0 A;  4QH4 A;  4ZK4 A;  3IGQ A;  2XQ7 A;  2Y57 A;  2BR8 A;  4HFC A;  3ZDG A;  4ZR6 A;  4DBM A;  2YME A;  2X00 D;  3TLU A;  4TNW A;  3PEO A;  3U8L A;  3TLW A;  4X5T A;  5L4E A;  4XHE A;  2XQ4 A;  5L4H A;  1UV6 A;  4TNV A;  2BG9 A;  2YKS A;  5J5G A;  4FRR A;  2PH9 A;  2BJ0 A;  3RIA A;  2Y58 A;  5AFN A;  5FJV A;  2BYQ A;  4NPP A;  5HEH A;  3UUB A;  2XYS A;  3UU3 A;  4IL9 A;  3WTL A;  3JAF A;  5CO5 A;  4QAA A;  3UQ4 A;  3U8N A;  3LSV A;  5AIN A;  2PGZ A;  2WN9 A;  2BG9 E;  3C84 A;  4UM3 P;  3P50 A;  3PMZ A;  4B5D A;  2UZ6 A;  5AFM B;  4EZ1 A;  3SIO A;  3SQ6 A;  3TLV A;  3WTN A;  5J5H A;  4IL4 A; 
#chains in the Genus database with same CATH homology
 3JAE A;  5HEO A;  5IUX A;  4UY2 A;  4AFH A;  5L47 A;  3JAD A;  5HEU A;  5AFL A;  3WTI A;  2BYP A;  5TVC A;  4HFI A;  5JME A;  4QAB A;  3ZDH A;  3RI5 A;  3ZKR A;  3C79 A;  4IRE A;  3WTK A;  4LMK A;  3UU6 A;  2XQA A;  3UU5 A;  4UM3 A;  2WZY A;  4AFT A;  2Y56 A;  4WV9 A;  3SH1 A;  4HQP A;  4D01 A;  2BG9 C;  3EHZ A;  4UM3 S;  5HCJ A;  4F8H A;  4ZZC A;  3U8K A;  2XQ6 A;  4ALX A;  5KZU A;  2XNV A;  4Z90 A;  5HEG A;  5KE4 A;  2WNC A;  3WTM A;  5BW2 A;  4AFG A;  4A98 A;  3WTO A;  3SQ9 A;  4UXU A;  3UQ7 A;  2BR7 A;  4QH5 A;  5SYO A;  4ILB A;  4TWF A;  5HCM A;  2BG9 B;  2BYS A;  2XYT A;  2W8F A;  3UU8 A;  2XQ5 A;  3TLS A;  1UW6 A;  4ILC A;  2C9T A;  3RIF A;  4HFD A;  5J5F A;  2QC1 B;  5LXB A;  3WIP A;  2BYR A;  4Z91 A;  4TWD A;  3WTJ A;  4BFQ A;  5J0Z A;  1UX2 A;  4ZK1 A;  2XNT A;  5AFJ A;  2WNJ A;  4PIR A;  4ZRU A;  2XZ5 A;  2XQ3 A;  4COF A;  4ILA A;  3T4M A;  5BRX A;  4HFH A;  2Y7Y A;  4QH1 A;  5CFB A;  2XQ9 A;  3RHW A;  4NZB A;  4QAC A;  5AFM A;  1I9B A;  3U8J A;  5LG3 A;  5BP0 A;  4ZZB A;  2Y54 A;  2YN6 A;  4XK9 A;  3RQW A;  2ZJU A;  2XNU A;  4LML A;  2W8G A;  2BYN A;  3UU4 A;  2WNL A;  3RQU A;  2X00 A;  3EAM A;  2XZ6 A;  2XQ8 A;  4A97 A;  4BQT A;  3U8M A;  2YMD A;  3P4W A;  2YOE A;  4ZJS A;  4HFB A;  3GUA A;  3WTH A;  3TLT A;  5AFH A;  4HFE A;  4LMJ A;  5J5I A;  2VL0 A;  5AFK A;  4ZJT A;  4TWH A;  2ZJV A;  5HEJ A;  4UM1 A;  3EI0 A;  4QH4 A;  4ZK4 A;  3IGQ A;  2XQ7 A;  2Y57 A;  2BR8 A;  4HFC A;  3ZDG A;  4ZR6 A;  4DBM A;  2YME A;  2X00 D;  3TLU A;  4TNW A;  3PEO A;  3U8L A;  3TLW A;  4X5T A;  5L4E A;  4XHE A;  2XQ4 A;  5L4H A;  1UV6 A;  4TNV A;  2BG9 A;  2YKS A;  5J5G A;  4FRR A;  2PH9 A;  2BJ0 A;  3RIA A;  2Y58 A;  5AFN A;  5FJV A;  2BYQ A;  4NPP A;  5HEH A;  3UUB A;  2XYS A;  3UU3 A;  4IL9 A;  3WTL A;  3JAF A;  5CO5 A;  4QAA A;  3UQ4 A;  3U8N A;  3LSV A;  5AIN A;  2PGZ A;  2WN9 A;  2BG9 E;  3C84 A;  4UM3 P;  3P50 A;  3PMZ A;  4B5D A;  2UZ6 A;  5AFM B;  4EZ1 A;  3SIO A;  3SQ6 A;  3TLV A;  3WTN A;  5J5H A;  4IL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...