3WTLA

Crystal structure of lymnaea stagnalis acetylcholine binding protein complexed with nitromethylene analogue of imidacloprid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
b'AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 52
structure length 208
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wtlA00
2BYRA 3UU6A 5KE4A 5AFLA 5HEJA 4LMJA 2Y57A 4TWFA 4ZRUA 4HFEA 4QH1A 3ZKRA 2Y56A 2XQAA 2XNVA 5HEOA 3TLWA 3TLSA 4HFHA 2YMDA 3RIFA 3U8KA 5J0ZA 2XQ4A 3ZDHA 2YN6A 3EAMA 4EZ1A 3GUAA 2VL0A 2YMEA 4UM3P 4TWHA 5AFMA 4IREA 3IGQA 5J5GA 4QAAA 4HQPA 5KZUA 2BJ0A 4LMLA 3C84A 2BG9C 1UX2A 5HEUA 2WNJA 3UU5A 3WTKA 2W8GA 2XZ6A 3WTIA 5J5HA 2Y7YA 2XQ6A 3WTJA 5FJVA 3RHWA 2W8FA 3UU3A 5IUXA 3U8MA 3LSVA 2BYSA 4QH4A 1UW6A 3WTOA 2X00D 2BG9B 5L4HA 4QH5A 3WTHA 5JMEA 5AFNA 3UUBA 4AFGA 2Y58A 3PEOA 3RIAA 3WTLA 3TLTA 4AFHA 3P50A 4ZZCA 3U8JA 3UU8A 3TLUA 4X5TA 4HFDA 2XQ7A 3EHZA 2XYSA 4Z91A 2XNTA 4ILBA 4NPPA 4WV9A 4ALXA 5BP0A 2PGZA 4A97A 5LXBA 3EI0A 4HFBA 4ILCA 3PMZA 2YKSA 2XQ8A 4HFCA 2BG9A 2BYQA 3JAFA 5HEHA 5J5FA 2XZ5A 5HCJA 2C9TA 3P4WA 4F8HA 3WTNA 3JADA 4TNVA 2XYTA 3WIPA 4Z90A 5L47A 2ZJVA 4UXUA 4IL9A 3SQ6A 2BR7A 2XQ9A 2BG9E 4UY2A 5SYOA 4UM1A 4QACA 3SIOA 4HFIA 4FRRA 5HEGA 2BYNA 2XQ3A 2QC1B 4NZBA 3WTMA 4B5DA 4ZK1A 4XK9A 4ZJSA 3TLVA 5BRXA 5L4EA 3RQUA 3RQWA 4QABA 3JAEA 4ILAA 2ZJUA 4BQTA 2WZYA 5J5IA 4XHEA 4ZJTA 2Y54A 4UM3A 4ZR6A 2BR8A 3C79A 4COFA 4A98A 3SH1A 4DBMA 4UM3S 2WNCA 4AFTA 3U8LA 5AFKA 4D01A 4ZZBA 2X00A 1I9BA 4IL4A 3T4MA 5LG3A 4ZK4A 5AINA 4BFQA 2PH9A 4LMKA 2UZ6A 5CFBA 4TNWA 5BW2A 3ZDGA 4PIRA 3U8NA 1UV6A 3UQ4A 2WN9A 5HCMA 2XNUA 3RI5A 2XQ5A 3UU4A 5TVCA 5AFMB 2WNLA 4TWDA 5AFJA 3SQ9A 5CO5A 3UQ7A 2BYPA 5AFHA 2YOEA
chains in the Genus database with same CATH superfamily
2BYRA 3UU6A 5KE4A 5AFLA 5HEJA 4LMJA 2Y57A 4TWFA 4ZRUA 4HFEA 4QH1A 3ZKRA 2Y56A 2XQAA 2XNVA 5HEOA 3TLWA 3TLSA 4HFHA 2YMDA 3RIFA 3U8KA 5J0ZA 2XQ4A 3ZDHA 2YN6A 3EAMA 4EZ1A 3GUAA 2VL0A 2YMEA 4UM3P 4TWHA 5AFMA 4IREA 3IGQA 5J5GA 4QAAA 4HQPA 5KZUA 2BJ0A 4LMLA 3C84A 2BG9C 1UX2A 5HEUA 2WNJA 3UU5A 3WTKA 2W8GA 2XZ6A 3WTIA 5J5HA 2Y7YA 2XQ6A 3WTJA 5FJVA 3RHWA 2W8FA 3UU3A 5IUXA 3U8MA 3LSVA 2BYSA 4QH4A 1UW6A 3WTOA 2X00D 2BG9B 5L4HA 4QH5A 3WTHA 5JMEA 5AFNA 3UUBA 4AFGA 2Y58A 3PEOA 3RIAA 3WTLA 3TLTA 4AFHA 3P50A 4ZZCA 3U8JA 3UU8A 3TLUA 4X5TA 4HFDA 2XQ7A 3EHZA 2XYSA 4Z91A 2XNTA 4ILBA 4NPPA 4WV9A 4ALXA 5BP0A 2PGZA 4A97A 5LXBA 3EI0A 4HFBA 4ILCA 3PMZA 2YKSA 2XQ8A 4HFCA 2BG9A 2BYQA 3JAFA 5HEHA 5J5FA 2XZ5A 5HCJA 2C9TA 3P4WA 4F8HA 3WTNA 3JADA 4TNVA 2XYTA 3WIPA 4Z90A 5L47A 2ZJVA 4UXUA 4IL9A 3SQ6A 2BR7A 2XQ9A 2BG9E 4UY2A 5SYOA 4UM1A 4QACA 3SIOA 4HFIA 4FRRA 5HEGA 2BYNA 2XQ3A 2QC1B 4NZBA 3WTMA 4B5DA 4ZK1A 4XK9A 4ZJSA 3TLVA 5BRXA 5L4EA 3RQUA 3RQWA 4QABA 3JAEA 4ILAA 2ZJUA 4BQTA 2WZYA 5J5IA 4XHEA 4ZJTA 2Y54A 4UM3A 4ZR6A 2BR8A 3C79A 4COFA 4A98A 3SH1A 4DBMA 4UM3S 2WNCA 4AFTA 3U8LA 5AFKA 4D01A 4ZZBA 2X00A 1I9BA 4IL4A 3T4MA 5LG3A 4ZK4A 5AINA 4BFQA 2PH9A 4LMKA 2UZ6A 5CFBA 4TNWA 5BW2A 3ZDGA 4PIRA 3U8NA 1UV6A 3UQ4A 2WN9A 5HCMA 2XNUA 3RI5A 2XQ5A 3UU4A 5TVCA 5AFMB 2WNLA 4TWDA 5AFJA 3SQ9A 5CO5A 3UQ7A 2BYPA 5AFHA 2YOEA
chains in the Genus database with same CATH topology
2BYRA 3UU6A 5KE4A 5AFLA 5HEJA 4LMJA 2Y57A 4TWFA 4ZRUA 4HFEA 4QH1A 3ZKRA 2Y56A 2XQAA 2XNVA 5HEOA 3TLWA 3TLSA 4HFHA 2YMDA 3RIFA 3U8KA 5J0ZA 2XQ4A 3ZDHA 2YN6A 3EAMA 4EZ1A 3GUAA 2VL0A 2YMEA 4UM3P 4TWHA 5AFMA 4IREA 3IGQA 5J5GA 4QAAA 4HQPA 5KZUA 2BJ0A 4LMLA 3C84A 2BG9C 1UX2A 5HEUA 2WNJA 3UU5A 3WTKA 2W8GA 2XZ6A 3WTIA 5J5HA 2Y7YA 2XQ6A 3WTJA 5FJVA 3RHWA 2W8FA 3UU3A 5IUXA 3U8MA 3LSVA 2BYSA 4QH4A 1UW6A 3WTOA 2X00D 2BG9B 5L4HA 4QH5A 3WTHA 5JMEA 5AFNA 3UUBA 4AFGA 2Y58A 3PEOA 3RIAA 3WTLA 3TLTA 4AFHA 3P50A 4ZZCA 3U8JA 3UU8A 3TLUA 4X5TA 4HFDA 2XQ7A 3EHZA 2XYSA 4Z91A 2XNTA 4ILBA 4NPPA 4WV9A 4ALXA 5BP0A 2PGZA 4A97A 5LXBA 3EI0A 4HFBA 4ILCA 3PMZA 2YKSA 2XQ8A 4HFCA 2BG9A 2BYQA 3JAFA 5HEHA 5J5FA 2XZ5A 5HCJA 2C9TA 3P4WA 4F8HA 3WTNA 3JADA 4TNVA 2XYTA 3WIPA 4Z90A 5L47A 2ZJVA 4UXUA 4IL9A 3SQ6A 2BR7A 2XQ9A 2BG9E 4UY2A 5SYOA 4UM1A 4QACA 3SIOA 4HFIA 4FRRA 5HEGA 2BYNA 2XQ3A 2QC1B 4NZBA 3WTMA 4B5DA 4ZK1A 4XK9A 4ZJSA 3TLVA 5BRXA 5L4EA 3RQUA 3RQWA 4QABA 3JAEA 4ILAA 2ZJUA 4BQTA 2WZYA 5J5IA 4XHEA 4ZJTA 2Y54A 4UM3A 4ZR6A 2BR8A 3C79A 4COFA 4A98A 3SH1A 4DBMA 4UM3S 2WNCA 4AFTA 3U8LA 5AFKA 4D01A 4ZZBA 2X00A 1I9BA 4IL4A 3T4MA 5LG3A 4ZK4A 5AINA 4BFQA 2PH9A 4LMKA 2UZ6A 5CFBA 4TNWA 5BW2A 3ZDGA 4PIRA 3U8NA 1UV6A 3UQ4A 2WN9A 5HCMA 2XNUA 3RI5A 2XQ5A 3UU4A 5TVCA 5AFMB 2WNLA 4TWDA 5AFJA 3SQ9A 5CO5A 3UQ7A 2BYPA 5AFHA 2YOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYR A;  3UU6 A;  5KE4 A;  5AFL A;  5HEJ A;  4LMJ A;  2Y57 A;  4TWF A;  4ZRU A;  4HFE A;  4QH1 A;  3ZKR A;  2Y56 A;  2XQA A;  2XNV A;  5HEO A;  3TLW A;  3TLS A;  4HFH A;  2YMD A;  3RIF A;  3U8K A;  5J0Z A;  2XQ4 A;  3ZDH A;  2YN6 A;  3EAM A;  4EZ1 A;  3GUA A;  2VL0 A;  2YME A;  4UM3 P;  4TWH A;  5AFM A;  4IRE A;  3IGQ A;  5J5G A;  4QAA A;  4HQP A;  5KZU A;  2BJ0 A;  4LML A;  3C84 A;  2BG9 C;  1UX2 A;  5HEU A;  2WNJ A;  3UU5 A;  3WTK A;  2W8G A;  2XZ6 A;  3WTI A;  5J5H A;  2Y7Y A;  2XQ6 A;  3WTJ A;  5FJV A;  3RHW A;  2W8F A;  3UU3 A;  5IUX A;  3U8M A;  3LSV A;  2BYS A;  4QH4 A;  1UW6 A;  3WTO A;  2X00 D;  2BG9 B;  5L4H A;  4QH5 A;  3WTH A;  5JME A;  5AFN A;  3UUB A;  4AFG A;  2Y58 A;  3PEO A;  3RIA A;  3WTL A;  3TLT A;  4AFH A;  3P50 A;  4ZZC A;  3U8J A;  3UU8 A;  3TLU A;  4X5T A;  4HFD A;  2XQ7 A;  3EHZ A;  2XYS A;  4Z91 A;  2XNT A;  4ILB A;  4NPP A;  4WV9 A;  4ALX A;  5BP0 A;  2PGZ A;  4A97 A;  5LXB A;  3EI0 A;  4HFB A;  4ILC A;  3PMZ A;  2YKS A;  2XQ8 A;  4HFC A;  2BG9 A;  2BYQ A;  3JAF A;  5HEH A;  5J5F A;  2XZ5 A;  5HCJ A;  2C9T A;  3P4W A;  4F8H A;  3WTN A;  3JAD A;  4TNV A;  2XYT A;  3WIP A;  4Z90 A;  5L47 A;  2ZJV A;  4UXU A;  4IL9 A;  3SQ6 A;  2BR7 A;  2XQ9 A;  2BG9 E;  4UY2 A;  5SYO A;  4UM1 A;  4QAC A;  3SIO A;  4HFI A;  4FRR A;  5HEG A;  2BYN A;  2XQ3 A;  2QC1 B;  4NZB A;  3WTM A;  4B5D A;  4ZK1 A;  4XK9 A;  4ZJS A;  3TLV A;  5BRX A;  5L4E A;  3RQU A;  3RQW A;  4QAB A;  3JAE A;  4ILA A;  2ZJU A;  4BQT A;  2WZY A;  5J5I A;  4XHE A;  4ZJT A;  2Y54 A;  4UM3 A;  4ZR6 A;  2BR8 A;  3C79 A;  4COF A;  4A98 A;  3SH1 A;  4DBM A;  4UM3 S;  2WNC A;  4AFT A;  3U8L A;  5AFK A;  4D01 A;  4ZZB A;  2X00 A;  1I9B A;  4IL4 A;  3T4M A;  5LG3 A;  4ZK4 A;  5AIN A;  4BFQ A;  2PH9 A;  4LMK A;  2UZ6 A;  5CFB A;  4TNW A;  5BW2 A;  3ZDG A;  4PIR A;  3U8N A;  1UV6 A;  3UQ4 A;  2WN9 A;  5HCM A;  2XNU A;  3RI5 A;  2XQ5 A;  3UU4 A;  5TVC A;  5AFM B;  2WNL A;  4TWD A;  5AFJ A;  3SQ9 A;  5CO5 A;  3UQ7 A;  2BYP A;  5AFH A;  2YOE A; 
#chains in the Genus database with same CATH topology
 2BYR A;  3UU6 A;  5KE4 A;  5AFL A;  5HEJ A;  4LMJ A;  2Y57 A;  4TWF A;  4ZRU A;  4HFE A;  4QH1 A;  3ZKR A;  2Y56 A;  2XQA A;  2XNV A;  5HEO A;  3TLW A;  3TLS A;  4HFH A;  2YMD A;  3RIF A;  3U8K A;  5J0Z A;  2XQ4 A;  3ZDH A;  2YN6 A;  3EAM A;  4EZ1 A;  3GUA A;  2VL0 A;  2YME A;  4UM3 P;  4TWH A;  5AFM A;  4IRE A;  3IGQ A;  5J5G A;  4QAA A;  4HQP A;  5KZU A;  2BJ0 A;  4LML A;  3C84 A;  2BG9 C;  1UX2 A;  5HEU A;  2WNJ A;  3UU5 A;  3WTK A;  2W8G A;  2XZ6 A;  3WTI A;  5J5H A;  2Y7Y A;  2XQ6 A;  3WTJ A;  5FJV A;  3RHW A;  2W8F A;  3UU3 A;  5IUX A;  3U8M A;  3LSV A;  2BYS A;  4QH4 A;  1UW6 A;  3WTO A;  2X00 D;  2BG9 B;  5L4H A;  4QH5 A;  3WTH A;  5JME A;  5AFN A;  3UUB A;  4AFG A;  2Y58 A;  3PEO A;  3RIA A;  3WTL A;  3TLT A;  4AFH A;  3P50 A;  4ZZC A;  3U8J A;  3UU8 A;  3TLU A;  4X5T A;  4HFD A;  2XQ7 A;  3EHZ A;  2XYS A;  4Z91 A;  2XNT A;  4ILB A;  4NPP A;  4WV9 A;  4ALX A;  5BP0 A;  2PGZ A;  4A97 A;  5LXB A;  3EI0 A;  4HFB A;  4ILC A;  3PMZ A;  2YKS A;  2XQ8 A;  4HFC A;  2BG9 A;  2BYQ A;  3JAF A;  5HEH A;  5J5F A;  2XZ5 A;  5HCJ A;  2C9T A;  3P4W A;  4F8H A;  3WTN A;  3JAD A;  4TNV A;  2XYT A;  3WIP A;  4Z90 A;  5L47 A;  2ZJV A;  4UXU A;  4IL9 A;  3SQ6 A;  2BR7 A;  2XQ9 A;  2BG9 E;  4UY2 A;  5SYO A;  4UM1 A;  4QAC A;  3SIO A;  4HFI A;  4FRR A;  5HEG A;  2BYN A;  2XQ3 A;  2QC1 B;  4NZB A;  3WTM A;  4B5D A;  4ZK1 A;  4XK9 A;  4ZJS A;  3TLV A;  5BRX A;  5L4E A;  3RQU A;  3RQW A;  4QAB A;  3JAE A;  4ILA A;  2ZJU A;  4BQT A;  2WZY A;  5J5I A;  4XHE A;  4ZJT A;  2Y54 A;  4UM3 A;  4ZR6 A;  2BR8 A;  3C79 A;  4COF A;  4A98 A;  3SH1 A;  4DBM A;  4UM3 S;  2WNC A;  4AFT A;  3U8L A;  5AFK A;  4D01 A;  4ZZB A;  2X00 A;  1I9B A;  4IL4 A;  3T4M A;  5LG3 A;  4ZK4 A;  5AIN A;  4BFQ A;  2PH9 A;  4LMK A;  2UZ6 A;  5CFB A;  4TNW A;  5BW2 A;  3ZDG A;  4PIR A;  3U8N A;  1UV6 A;  3UQ4 A;  2WN9 A;  5HCM A;  2XNU A;  3RI5 A;  2XQ5 A;  3UU4 A;  5TVC A;  5AFM B;  2WNL A;  4TWD A;  5AFJ A;  3SQ9 A;  5CO5 A;  3UQ7 A;  2BYP A;  5AFH A;  2YOE A; 
#chains in the Genus database with same CATH homology
 2BYR A;  3UU6 A;  5KE4 A;  5AFL A;  5HEJ A;  4LMJ A;  2Y57 A;  4TWF A;  4ZRU A;  4HFE A;  4QH1 A;  3ZKR A;  2Y56 A;  2XQA A;  2XNV A;  5HEO A;  3TLW A;  3TLS A;  4HFH A;  2YMD A;  3RIF A;  3U8K A;  5J0Z A;  2XQ4 A;  3ZDH A;  2YN6 A;  3EAM A;  4EZ1 A;  3GUA A;  2VL0 A;  2YME A;  4UM3 P;  4TWH A;  5AFM A;  4IRE A;  3IGQ A;  5J5G A;  4QAA A;  4HQP A;  5KZU A;  2BJ0 A;  4LML A;  3C84 A;  2BG9 C;  1UX2 A;  5HEU A;  2WNJ A;  3UU5 A;  3WTK A;  2W8G A;  2XZ6 A;  3WTI A;  5J5H A;  2Y7Y A;  2XQ6 A;  3WTJ A;  5FJV A;  3RHW A;  2W8F A;  3UU3 A;  5IUX A;  3U8M A;  3LSV A;  2BYS A;  4QH4 A;  1UW6 A;  3WTO A;  2X00 D;  2BG9 B;  5L4H A;  4QH5 A;  3WTH A;  5JME A;  5AFN A;  3UUB A;  4AFG A;  2Y58 A;  3PEO A;  3RIA A;  3WTL A;  3TLT A;  4AFH A;  3P50 A;  4ZZC A;  3U8J A;  3UU8 A;  3TLU A;  4X5T A;  4HFD A;  2XQ7 A;  3EHZ A;  2XYS A;  4Z91 A;  2XNT A;  4ILB A;  4NPP A;  4WV9 A;  4ALX A;  5BP0 A;  2PGZ A;  4A97 A;  5LXB A;  3EI0 A;  4HFB A;  4ILC A;  3PMZ A;  2YKS A;  2XQ8 A;  4HFC A;  2BG9 A;  2BYQ A;  3JAF A;  5HEH A;  5J5F A;  2XZ5 A;  5HCJ A;  2C9T A;  3P4W A;  4F8H A;  3WTN A;  3JAD A;  4TNV A;  2XYT A;  3WIP A;  4Z90 A;  5L47 A;  2ZJV A;  4UXU A;  4IL9 A;  3SQ6 A;  2BR7 A;  2XQ9 A;  2BG9 E;  4UY2 A;  5SYO A;  4UM1 A;  4QAC A;  3SIO A;  4HFI A;  4FRR A;  5HEG A;  2BYN A;  2XQ3 A;  2QC1 B;  4NZB A;  3WTM A;  4B5D A;  4ZK1 A;  4XK9 A;  4ZJS A;  3TLV A;  5BRX A;  5L4E A;  3RQU A;  3RQW A;  4QAB A;  3JAE A;  4ILA A;  2ZJU A;  4BQT A;  2WZY A;  5J5I A;  4XHE A;  4ZJT A;  2Y54 A;  4UM3 A;  4ZR6 A;  2BR8 A;  3C79 A;  4COF A;  4A98 A;  3SH1 A;  4DBM A;  4UM3 S;  2WNC A;  4AFT A;  3U8L A;  5AFK A;  4D01 A;  4ZZB A;  2X00 A;  1I9B A;  4IL4 A;  3T4M A;  5LG3 A;  4ZK4 A;  5AIN A;  4BFQ A;  2PH9 A;  4LMK A;  2UZ6 A;  5CFB A;  4TNW A;  5BW2 A;  3ZDG A;  4PIR A;  3U8N A;  1UV6 A;  3UQ4 A;  2WN9 A;  5HCM A;  2XNU A;  3RI5 A;  2XQ5 A;  3UU4 A;  5TVC A;  5AFM B;  2WNL A;  4TWD A;  5AFJ A;  3SQ9 A;  5CO5 A;  3UQ7 A;  2BYP A;  5AFH A;  2YOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...