3WTLA

Crystal structure of lymnaea stagnalis acetylcholine binding protein complexed with nitromethylene analogue of imidacloprid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
208
structure length
208
Chain Sequence
AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 52
structure length 208
sequence length 208
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wtlA00
2XNTA 2BG9C 2XQ7A 5HEGA 4ILBA 4TWHA 3WTKA 5IUXA 2BR7A 4UXUA 1UW6A 2YMEA 3TLWA 4COFA 4UM3A 5HEHA 3U8JA 2XNUA 2YN6A 4FRRA 3TLSA 3SH1A 4HQPA 2QC1B 4PIRA 3SQ6A 3JADA 3EAMA 2ZJVA 4LMLA 4BFQA 2PGZA 3ZKRA 4QACA 5BRXA 4HFBA 4ILCA 5AFMB 3ZDGA 4UM3P 3RHWA 2Y54A 4WV9A 3C84A 2BYQA 3WTLA 5AFMA 3UU8A 3PEOA 3UU6A 5BW2A 5AFJA 2X00A 3IGQA 2WNCA 2XQ4A 4BQTA 4XK9A 4QABA 5L4EA 3UUBA 4QH4A 4ZR6A 4UM1A 2YOEA 5J5HA 3RIFA 1UV6A 2W8FA 4IREA 3U8NA 2YKSA 4HFCA 4HFHA 5L4HA 3WIPA 5L47A 2BG9B 2C9TA 2Y7YA 3JAEA 3TLTA 4ZK1A 5HEUA 4X5TA 2XQ9A 3WTJA 2XNVA 2BG9E 3RIAA 2BJ0A 2BG9A 3WTNA 3U8LA 5AFHA 2Y57A 2YMDA 4ZJTA 2WNLA 5J0ZA 4A98A 4NZBA 2XZ6A 4ZZBA 3UU3A 4AFHA 4ZK4A 2VL0A 3P4WA 5J5GA 2WZYA 2BR8A 2WN9A 3C79A 4ZJSA 3RQUA 1UX2A 3UQ4A 2X00D 2XQ5A 1I9BA 2Y58A 5FJVA 5BP0A 2UZ6A 4QH1A 3RQWA 3TLVA 3U8MA 2BYNA 2XQ3A 4QH5A 4NPPA 2XYTA 3RI5A 3WTHA 4DBMA 5HEOA 4A97A 2BYPA 3EHZA 4IL4A 4F8HA 5CO5A 5AFNA 5J5FA 5TVCA 3TLUA 4ZRUA 5SYOA 4AFTA 4ALXA 5AINA 4XHEA 3UU4A 3WTOA 5LG3A 4EZ1A 5AFLA 2WNJA 3GUAA 5HCMA 4HFIA 4AFGA 3T4MA 2Y56A 2BYRA 4LMJA 3LSVA 3EI0A 5AFKA 4HFDA 3UQ7A 5HEJA 3UU5A 3SQ9A 5HCJA 5KZUA 3SIOA 3JAFA 3P50A 3PMZA 3WTIA 4LMKA 2BYSA 2XQAA 4TWDA 5LXBA 4UY2A 2W8GA 2PH9A 2XQ6A 5KE4A 4UM3S 4Z91A 4ZZCA 4ILAA 4TWFA 4TNWA 5J5IA 4HFEA 5CFBA 4Z90A 2ZJUA 3WTMA 4IL9A 4D01A 2XZ5A 4B5DA 3U8KA 5JMEA 2XYSA 2XQ8A 4TNVA 3ZDHA 4QAAA
chains in the Genus database with same CATH superfamily
2XNTA 2BG9C 2XQ7A 5HEGA 4ILBA 4TWHA 3WTKA 5IUXA 2BR7A 4UXUA 1UW6A 2YMEA 3TLWA 4COFA 4UM3A 5HEHA 3U8JA 2XNUA 2YN6A 4FRRA 3TLSA 3SH1A 4HQPA 2QC1B 4PIRA 3SQ6A 3JADA 3EAMA 2ZJVA 4LMLA 4BFQA 2PGZA 3ZKRA 4QACA 5BRXA 4HFBA 4ILCA 5AFMB 3ZDGA 4UM3P 3RHWA 2Y54A 4WV9A 3C84A 2BYQA 3WTLA 5AFMA 3UU8A 3PEOA 3UU6A 5BW2A 5AFJA 2X00A 3IGQA 2WNCA 2XQ4A 4BQTA 4XK9A 4QABA 5L4EA 3UUBA 4QH4A 4ZR6A 4UM1A 2YOEA 5J5HA 3RIFA 1UV6A 2W8FA 4IREA 3U8NA 2YKSA 4HFCA 4HFHA 5L4HA 3WIPA 5L47A 2BG9B 2C9TA 2Y7YA 3JAEA 3TLTA 4ZK1A 5HEUA 4X5TA 2XQ9A 3WTJA 2XNVA 2BG9E 3RIAA 2BJ0A 2BG9A 3WTNA 3U8LA 5AFHA 2Y57A 2YMDA 4ZJTA 2WNLA 5J0ZA 4A98A 4NZBA 2XZ6A 4ZZBA 3UU3A 4AFHA 4ZK4A 2VL0A 3P4WA 5J5GA 2WZYA 2BR8A 2WN9A 3C79A 4ZJSA 3RQUA 1UX2A 3UQ4A 2X00D 2XQ5A 1I9BA 2Y58A 5FJVA 5BP0A 2UZ6A 4QH1A 3RQWA 3TLVA 3U8MA 2BYNA 2XQ3A 4QH5A 4NPPA 2XYTA 3RI5A 3WTHA 4DBMA 5HEOA 4A97A 2BYPA 3EHZA 4IL4A 4F8HA 5CO5A 5AFNA 5J5FA 5TVCA 3TLUA 4ZRUA 5SYOA 4AFTA 4ALXA 5AINA 4XHEA 3UU4A 3WTOA 5LG3A 4EZ1A 5AFLA 2WNJA 3GUAA 5HCMA 4HFIA 4AFGA 3T4MA 2Y56A 2BYRA 4LMJA 3LSVA 3EI0A 5AFKA 4HFDA 3UQ7A 5HEJA 3UU5A 3SQ9A 5HCJA 5KZUA 3SIOA 3JAFA 3P50A 3PMZA 3WTIA 4LMKA 2BYSA 2XQAA 4TWDA 5LXBA 4UY2A 2W8GA 2PH9A 2XQ6A 5KE4A 4UM3S 4Z91A 4ZZCA 4ILAA 4TWFA 4TNWA 5J5IA 4HFEA 5CFBA 4Z90A 2ZJUA 3WTMA 4IL9A 4D01A 2XZ5A 4B5DA 3U8KA 5JMEA 2XYSA 2XQ8A 4TNVA 3ZDHA 4QAAA
chains in the Genus database with same CATH topology
2XNTA 2BG9C 2XQ7A 5HEGA 4ILBA 4TWHA 3WTKA 5IUXA 2BR7A 4UXUA 1UW6A 2YMEA 3TLWA 4COFA 4UM3A 5HEHA 3U8JA 2XNUA 2YN6A 4FRRA 3TLSA 3SH1A 4HQPA 2QC1B 4PIRA 3SQ6A 3JADA 3EAMA 2ZJVA 4LMLA 4BFQA 2PGZA 3ZKRA 4QACA 5BRXA 4HFBA 4ILCA 5AFMB 3ZDGA 4UM3P 3RHWA 2Y54A 4WV9A 3C84A 2BYQA 3WTLA 5AFMA 3UU8A 3PEOA 3UU6A 5BW2A 5AFJA 2X00A 3IGQA 2WNCA 2XQ4A 4BQTA 4XK9A 4QABA 5L4EA 3UUBA 4QH4A 4ZR6A 4UM1A 2YOEA 5J5HA 3RIFA 1UV6A 2W8FA 4IREA 3U8NA 2YKSA 4HFCA 4HFHA 5L4HA 3WIPA 5L47A 2BG9B 2C9TA 2Y7YA 3JAEA 3TLTA 4ZK1A 5HEUA 4X5TA 2XQ9A 3WTJA 2XNVA 2BG9E 3RIAA 2BJ0A 2BG9A 3WTNA 3U8LA 5AFHA 2Y57A 2YMDA 4ZJTA 2WNLA 5J0ZA 4A98A 4NZBA 2XZ6A 4ZZBA 3UU3A 4AFHA 4ZK4A 2VL0A 3P4WA 5J5GA 2WZYA 2BR8A 2WN9A 3C79A 4ZJSA 3RQUA 1UX2A 3UQ4A 2X00D 2XQ5A 1I9BA 2Y58A 5FJVA 5BP0A 2UZ6A 4QH1A 3RQWA 3TLVA 3U8MA 2BYNA 2XQ3A 4QH5A 4NPPA 2XYTA 3RI5A 3WTHA 4DBMA 5HEOA 4A97A 2BYPA 3EHZA 4IL4A 4F8HA 5CO5A 5AFNA 5J5FA 5TVCA 3TLUA 4ZRUA 5SYOA 4AFTA 4ALXA 5AINA 4XHEA 3UU4A 3WTOA 5LG3A 4EZ1A 5AFLA 2WNJA 3GUAA 5HCMA 4HFIA 4AFGA 3T4MA 2Y56A 2BYRA 4LMJA 3LSVA 3EI0A 5AFKA 4HFDA 3UQ7A 5HEJA 3UU5A 3SQ9A 5HCJA 5KZUA 3SIOA 3JAFA 3P50A 3PMZA 3WTIA 4LMKA 2BYSA 2XQAA 4TWDA 5LXBA 4UY2A 2W8GA 2PH9A 2XQ6A 5KE4A 4UM3S 4Z91A 4ZZCA 4ILAA 4TWFA 4TNWA 5J5IA 4HFEA 5CFBA 4Z90A 2ZJUA 3WTMA 4IL9A 4D01A 2XZ5A 4B5DA 3U8KA 5JMEA 2XYSA 2XQ8A 4TNVA 3ZDHA 4QAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNT A;  2BG9 C;  2XQ7 A;  5HEG A;  4ILB A;  4TWH A;  3WTK A;  5IUX A;  2BR7 A;  4UXU A;  1UW6 A;  2YME A;  3TLW A;  4COF A;  4UM3 A;  5HEH A;  3U8J A;  2XNU A;  2YN6 A;  4FRR A;  3TLS A;  3SH1 A;  4HQP A;  2QC1 B;  4PIR A;  3SQ6 A;  3JAD A;  3EAM A;  2ZJV A;  4LML A;  4BFQ A;  2PGZ A;  3ZKR A;  4QAC A;  5BRX A;  4HFB A;  4ILC A;  5AFM B;  3ZDG A;  4UM3 P;  3RHW A;  2Y54 A;  4WV9 A;  3C84 A;  2BYQ A;  3WTL A;  5AFM A;  3UU8 A;  3PEO A;  3UU6 A;  5BW2 A;  5AFJ A;  2X00 A;  3IGQ A;  2WNC A;  2XQ4 A;  4BQT A;  4XK9 A;  4QAB A;  5L4E A;  3UUB A;  4QH4 A;  4ZR6 A;  4UM1 A;  2YOE A;  5J5H A;  3RIF A;  1UV6 A;  2W8F A;  4IRE A;  3U8N A;  2YKS A;  4HFC A;  4HFH A;  5L4H A;  3WIP A;  5L47 A;  2BG9 B;  2C9T A;  2Y7Y A;  3JAE A;  3TLT A;  4ZK1 A;  5HEU A;  4X5T A;  2XQ9 A;  3WTJ A;  2XNV A;  2BG9 E;  3RIA A;  2BJ0 A;  2BG9 A;  3WTN A;  3U8L A;  5AFH A;  2Y57 A;  2YMD A;  4ZJT A;  2WNL A;  5J0Z A;  4A98 A;  4NZB A;  2XZ6 A;  4ZZB A;  3UU3 A;  4AFH A;  4ZK4 A;  2VL0 A;  3P4W A;  5J5G A;  2WZY A;  2BR8 A;  2WN9 A;  3C79 A;  4ZJS A;  3RQU A;  1UX2 A;  3UQ4 A;  2X00 D;  2XQ5 A;  1I9B A;  2Y58 A;  5FJV A;  5BP0 A;  2UZ6 A;  4QH1 A;  3RQW A;  3TLV A;  3U8M A;  2BYN A;  2XQ3 A;  4QH5 A;  4NPP A;  2XYT A;  3RI5 A;  3WTH A;  4DBM A;  5HEO A;  4A97 A;  2BYP A;  3EHZ A;  4IL4 A;  4F8H A;  5CO5 A;  5AFN A;  5J5F A;  5TVC A;  3TLU A;  4ZRU A;  5SYO A;  4AFT A;  4ALX A;  5AIN A;  4XHE A;  3UU4 A;  3WTO A;  5LG3 A;  4EZ1 A;  5AFL A;  2WNJ A;  3GUA A;  5HCM A;  4HFI A;  4AFG A;  3T4M A;  2Y56 A;  2BYR A;  4LMJ A;  3LSV A;  3EI0 A;  5AFK A;  4HFD A;  3UQ7 A;  5HEJ A;  3UU5 A;  3SQ9 A;  5HCJ A;  5KZU A;  3SIO A;  3JAF A;  3P50 A;  3PMZ A;  3WTI A;  4LMK A;  2BYS A;  2XQA A;  4TWD A;  5LXB A;  4UY2 A;  2W8G A;  2PH9 A;  2XQ6 A;  5KE4 A;  4UM3 S;  4Z91 A;  4ZZC A;  4ILA A;  4TWF A;  4TNW A;  5J5I A;  4HFE A;  5CFB A;  4Z90 A;  2ZJU A;  3WTM A;  4IL9 A;  4D01 A;  2XZ5 A;  4B5D A;  3U8K A;  5JME A;  2XYS A;  2XQ8 A;  4TNV A;  3ZDH A;  4QAA A; 
#chains in the Genus database with same CATH topology
 2XNT A;  2BG9 C;  2XQ7 A;  5HEG A;  4ILB A;  4TWH A;  3WTK A;  5IUX A;  2BR7 A;  4UXU A;  1UW6 A;  2YME A;  3TLW A;  4COF A;  4UM3 A;  5HEH A;  3U8J A;  2XNU A;  2YN6 A;  4FRR A;  3TLS A;  3SH1 A;  4HQP A;  2QC1 B;  4PIR A;  3SQ6 A;  3JAD A;  3EAM A;  2ZJV A;  4LML A;  4BFQ A;  2PGZ A;  3ZKR A;  4QAC A;  5BRX A;  4HFB A;  4ILC A;  5AFM B;  3ZDG A;  4UM3 P;  3RHW A;  2Y54 A;  4WV9 A;  3C84 A;  2BYQ A;  3WTL A;  5AFM A;  3UU8 A;  3PEO A;  3UU6 A;  5BW2 A;  5AFJ A;  2X00 A;  3IGQ A;  2WNC A;  2XQ4 A;  4BQT A;  4XK9 A;  4QAB A;  5L4E A;  3UUB A;  4QH4 A;  4ZR6 A;  4UM1 A;  2YOE A;  5J5H A;  3RIF A;  1UV6 A;  2W8F A;  4IRE A;  3U8N A;  2YKS A;  4HFC A;  4HFH A;  5L4H A;  3WIP A;  5L47 A;  2BG9 B;  2C9T A;  2Y7Y A;  3JAE A;  3TLT A;  4ZK1 A;  5HEU A;  4X5T A;  2XQ9 A;  3WTJ A;  2XNV A;  2BG9 E;  3RIA A;  2BJ0 A;  2BG9 A;  3WTN A;  3U8L A;  5AFH A;  2Y57 A;  2YMD A;  4ZJT A;  2WNL A;  5J0Z A;  4A98 A;  4NZB A;  2XZ6 A;  4ZZB A;  3UU3 A;  4AFH A;  4ZK4 A;  2VL0 A;  3P4W A;  5J5G A;  2WZY A;  2BR8 A;  2WN9 A;  3C79 A;  4ZJS A;  3RQU A;  1UX2 A;  3UQ4 A;  2X00 D;  2XQ5 A;  1I9B A;  2Y58 A;  5FJV A;  5BP0 A;  2UZ6 A;  4QH1 A;  3RQW A;  3TLV A;  3U8M A;  2BYN A;  2XQ3 A;  4QH5 A;  4NPP A;  2XYT A;  3RI5 A;  3WTH A;  4DBM A;  5HEO A;  4A97 A;  2BYP A;  3EHZ A;  4IL4 A;  4F8H A;  5CO5 A;  5AFN A;  5J5F A;  5TVC A;  3TLU A;  4ZRU A;  5SYO A;  4AFT A;  4ALX A;  5AIN A;  4XHE A;  3UU4 A;  3WTO A;  5LG3 A;  4EZ1 A;  5AFL A;  2WNJ A;  3GUA A;  5HCM A;  4HFI A;  4AFG A;  3T4M A;  2Y56 A;  2BYR A;  4LMJ A;  3LSV A;  3EI0 A;  5AFK A;  4HFD A;  3UQ7 A;  5HEJ A;  3UU5 A;  3SQ9 A;  5HCJ A;  5KZU A;  3SIO A;  3JAF A;  3P50 A;  3PMZ A;  3WTI A;  4LMK A;  2BYS A;  2XQA A;  4TWD A;  5LXB A;  4UY2 A;  2W8G A;  2PH9 A;  2XQ6 A;  5KE4 A;  4UM3 S;  4Z91 A;  4ZZC A;  4ILA A;  4TWF A;  4TNW A;  5J5I A;  4HFE A;  5CFB A;  4Z90 A;  2ZJU A;  3WTM A;  4IL9 A;  4D01 A;  2XZ5 A;  4B5D A;  3U8K A;  5JME A;  2XYS A;  2XQ8 A;  4TNV A;  3ZDH A;  4QAA A; 
#chains in the Genus database with same CATH homology
 2XNT A;  2BG9 C;  2XQ7 A;  5HEG A;  4ILB A;  4TWH A;  3WTK A;  5IUX A;  2BR7 A;  4UXU A;  1UW6 A;  2YME A;  3TLW A;  4COF A;  4UM3 A;  5HEH A;  3U8J A;  2XNU A;  2YN6 A;  4FRR A;  3TLS A;  3SH1 A;  4HQP A;  2QC1 B;  4PIR A;  3SQ6 A;  3JAD A;  3EAM A;  2ZJV A;  4LML A;  4BFQ A;  2PGZ A;  3ZKR A;  4QAC A;  5BRX A;  4HFB A;  4ILC A;  5AFM B;  3ZDG A;  4UM3 P;  3RHW A;  2Y54 A;  4WV9 A;  3C84 A;  2BYQ A;  3WTL A;  5AFM A;  3UU8 A;  3PEO A;  3UU6 A;  5BW2 A;  5AFJ A;  2X00 A;  3IGQ A;  2WNC A;  2XQ4 A;  4BQT A;  4XK9 A;  4QAB A;  5L4E A;  3UUB A;  4QH4 A;  4ZR6 A;  4UM1 A;  2YOE A;  5J5H A;  3RIF A;  1UV6 A;  2W8F A;  4IRE A;  3U8N A;  2YKS A;  4HFC A;  4HFH A;  5L4H A;  3WIP A;  5L47 A;  2BG9 B;  2C9T A;  2Y7Y A;  3JAE A;  3TLT A;  4ZK1 A;  5HEU A;  4X5T A;  2XQ9 A;  3WTJ A;  2XNV A;  2BG9 E;  3RIA A;  2BJ0 A;  2BG9 A;  3WTN A;  3U8L A;  5AFH A;  2Y57 A;  2YMD A;  4ZJT A;  2WNL A;  5J0Z A;  4A98 A;  4NZB A;  2XZ6 A;  4ZZB A;  3UU3 A;  4AFH A;  4ZK4 A;  2VL0 A;  3P4W A;  5J5G A;  2WZY A;  2BR8 A;  2WN9 A;  3C79 A;  4ZJS A;  3RQU A;  1UX2 A;  3UQ4 A;  2X00 D;  2XQ5 A;  1I9B A;  2Y58 A;  5FJV A;  5BP0 A;  2UZ6 A;  4QH1 A;  3RQW A;  3TLV A;  3U8M A;  2BYN A;  2XQ3 A;  4QH5 A;  4NPP A;  2XYT A;  3RI5 A;  3WTH A;  4DBM A;  5HEO A;  4A97 A;  2BYP A;  3EHZ A;  4IL4 A;  4F8H A;  5CO5 A;  5AFN A;  5J5F A;  5TVC A;  3TLU A;  4ZRU A;  5SYO A;  4AFT A;  4ALX A;  5AIN A;  4XHE A;  3UU4 A;  3WTO A;  5LG3 A;  4EZ1 A;  5AFL A;  2WNJ A;  3GUA A;  5HCM A;  4HFI A;  4AFG A;  3T4M A;  2Y56 A;  2BYR A;  4LMJ A;  3LSV A;  3EI0 A;  5AFK A;  4HFD A;  3UQ7 A;  5HEJ A;  3UU5 A;  3SQ9 A;  5HCJ A;  5KZU A;  3SIO A;  3JAF A;  3P50 A;  3PMZ A;  3WTI A;  4LMK A;  2BYS A;  2XQA A;  4TWD A;  5LXB A;  4UY2 A;  2W8G A;  2PH9 A;  2XQ6 A;  5KE4 A;  4UM3 S;  4Z91 A;  4ZZC A;  4ILA A;  4TWF A;  4TNW A;  5J5I A;  4HFE A;  5CFB A;  4Z90 A;  2ZJU A;  3WTM A;  4IL9 A;  4D01 A;  2XZ5 A;  4B5D A;  3U8K A;  5JME A;  2XYS A;  2XQ8 A;  4TNV A;  3ZDH A;  4QAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...