2WNLA

Crystal structure of aplysia achbp in complex with anabaseine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
213
Chain Sequence
DDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural determinants for interaction of partial agonists with acetylcholine binding protein and neuronal alpha7 nicotinic acetylcholine receptor.
pubmed doi rcsb
source organism Aplysia californica
total genus 50
structure length 213
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2wnlA00
3RIAA 4DBMA 5AFHA 3U8KA 4X5TA 2Y7YA 4LMLA 5AFNA 3UQ7A 3WTOA 2X00A 3PMZA 4FRRA 4IL9A 4Z90A 3JAFA 4TNVA 4A97A 4ZR6A 4HFBA 3U8LA 4QACA 2BR8A 4ZK4A 3RQWA 3P50A 4TNWA 3WTHA 3ZKRA 3TLSA 3UQ4A 4TWFA 4HFEA 5HCJA 4QH1A 4ZJSA 3TLVA 3WTKA 2YMEA 3PEOA 2WNLA 4UM1A 3RHWA 4LMJA 2XQ7A 2XZ5A 2BYNA 4ZZCA 3RI5A 4B5DA 5SYOA 4UY2A 2XYSA 2Y54A 3UUBA 5HCMA 5HEHA 2XNUA 2XZ6A 5HEGA 2X00D 4QH4A 4QH5A 3U8NA 4HFHA 3IGQA 2WZYA 2XNTA 2W8GA 2WNJA 3EI0A 5KZUA 3SH1A 4Z91A 4ZK1A 5HEOA 2BR7A 4IL4A 1I9BA 3SQ6A 5BW2A 2VL0A 2Y56A 4WV9A 4UM3P 3WTMA 3TLUA 3GUAA 3LSVA 5FJVA 3U8JA 2BG9C 5J5GA 4ILBA 5L47A 2BJ0A 3ZDGA 2XQ9A 4UM3A 5J0ZA 4HFDA 3ZDHA 2WNCA 5HEUA 4NPPA 3JAEA 2PH9A 3WTIA 4EZ1A 3JADA 5CFBA 1UV6A 4NZBA 4F8HA 5HEJA 2YMDA 4UM3S 3U8MA 3UU6A 5J5HA 4UXUA 2BYSA 2QC1B 4BFQA 2YOEA 2C9TA 3UU5A 3P4WA 2XQ4A 5LG3A 2BYPA 2PGZA 3UU4A 3WTLA 5JMEA 5CO5A 3EHZA 4PIRA 2BYRA 4HFIA 3T4MA 4ALXA 4ZRUA 5BP0A 5KE4A 3SIOA 4A98A 2BYQA 2UZ6A 2BG9A 4QABA 5AFMA 4LMKA 2XQ6A 4HQPA 4HFCA 3C84A 2Y58A 5AFLA 3UU3A 5LXBA 4IREA 4AFHA 5AINA 4TWHA 4XHEA 4ZJTA 2ZJUA 2XQ3A 2XQ5A 2XYTA 2W8FA 5J5FA 3SQ9A 3WTNA 2XNVA 3RIFA 4BQTA 3UU8A 4AFTA 5AFKA 2BG9E 2BG9B 4ILAA 5AFMB 2YKSA 5J5IA 1UX2A 3C79A 4QAAA 2ZJVA 3WIPA 4ZZBA 5BRXA 4XK9A 3WTJA 2Y57A 4AFGA 4D01A 5L4HA 5AFJA 3TLTA 4TWDA 1UW6A 3RQUA 5L4EA 2XQAA 4COFA 2YN6A 4ILCA 5IUXA 5TVCA 3TLWA 2XQ8A 2WN9A 3EAMA
chains in the Genus database with same CATH superfamily
3RIAA 4DBMA 5AFHA 3U8KA 4X5TA 2Y7YA 4LMLA 5AFNA 3UQ7A 3WTOA 2X00A 3PMZA 4FRRA 4IL9A 4Z90A 3JAFA 4TNVA 4A97A 4ZR6A 4HFBA 3U8LA 4QACA 2BR8A 4ZK4A 3RQWA 3P50A 4TNWA 3WTHA 3ZKRA 3TLSA 3UQ4A 4TWFA 4HFEA 5HCJA 4QH1A 4ZJSA 3TLVA 3WTKA 2YMEA 3PEOA 2WNLA 4UM1A 3RHWA 4LMJA 2XQ7A 2XZ5A 2BYNA 4ZZCA 3RI5A 4B5DA 5SYOA 4UY2A 2XYSA 2Y54A 3UUBA 5HCMA 5HEHA 2XNUA 2XZ6A 5HEGA 2X00D 4QH4A 4QH5A 3U8NA 4HFHA 3IGQA 2WZYA 2XNTA 2W8GA 2WNJA 3EI0A 5KZUA 3SH1A 4Z91A 4ZK1A 5HEOA 2BR7A 4IL4A 1I9BA 3SQ6A 5BW2A 2VL0A 2Y56A 4WV9A 4UM3P 3WTMA 3TLUA 3GUAA 3LSVA 5FJVA 3U8JA 2BG9C 5J5GA 4ILBA 5L47A 2BJ0A 3ZDGA 2XQ9A 4UM3A 5J0ZA 4HFDA 3ZDHA 2WNCA 5HEUA 4NPPA 3JAEA 2PH9A 3WTIA 4EZ1A 3JADA 5CFBA 1UV6A 4NZBA 4F8HA 5HEJA 2YMDA 4UM3S 3U8MA 3UU6A 5J5HA 4UXUA 2BYSA 2QC1B 4BFQA 2YOEA 2C9TA 3UU5A 3P4WA 2XQ4A 5LG3A 2BYPA 2PGZA 3UU4A 3WTLA 5JMEA 5CO5A 3EHZA 4PIRA 2BYRA 4HFIA 3T4MA 4ALXA 4ZRUA 5BP0A 5KE4A 3SIOA 4A98A 2BYQA 2UZ6A 2BG9A 4QABA 5AFMA 4LMKA 2XQ6A 4HQPA 4HFCA 3C84A 2Y58A 5AFLA 3UU3A 5LXBA 4IREA 4AFHA 5AINA 4TWHA 4XHEA 4ZJTA 2ZJUA 2XQ3A 2XQ5A 2XYTA 2W8FA 5J5FA 3SQ9A 3WTNA 2XNVA 3RIFA 4BQTA 3UU8A 4AFTA 5AFKA 2BG9E 2BG9B 4ILAA 5AFMB 2YKSA 5J5IA 1UX2A 3C79A 4QAAA 2ZJVA 3WIPA 4ZZBA 5BRXA 4XK9A 3WTJA 2Y57A 4AFGA 4D01A 5L4HA 5AFJA 3TLTA 4TWDA 1UW6A 3RQUA 5L4EA 2XQAA 4COFA 2YN6A 4ILCA 5IUXA 5TVCA 3TLWA 2XQ8A 2WN9A 3EAMA
chains in the Genus database with same CATH topology
3RIAA 4DBMA 5AFHA 3U8KA 4X5TA 2Y7YA 4LMLA 5AFNA 3UQ7A 3WTOA 2X00A 3PMZA 4FRRA 4IL9A 4Z90A 3JAFA 4TNVA 4A97A 4ZR6A 4HFBA 3U8LA 4QACA 2BR8A 4ZK4A 3RQWA 3P50A 4TNWA 3WTHA 3ZKRA 3TLSA 3UQ4A 4TWFA 4HFEA 5HCJA 4QH1A 4ZJSA 3TLVA 3WTKA 2YMEA 3PEOA 2WNLA 4UM1A 3RHWA 4LMJA 2XQ7A 2XZ5A 2BYNA 4ZZCA 3RI5A 4B5DA 5SYOA 4UY2A 2XYSA 2Y54A 3UUBA 5HCMA 5HEHA 2XNUA 2XZ6A 5HEGA 2X00D 4QH4A 4QH5A 3U8NA 4HFHA 3IGQA 2WZYA 2XNTA 2W8GA 2WNJA 3EI0A 5KZUA 3SH1A 4Z91A 4ZK1A 5HEOA 2BR7A 4IL4A 1I9BA 3SQ6A 5BW2A 2VL0A 2Y56A 4WV9A 4UM3P 3WTMA 3TLUA 3GUAA 3LSVA 5FJVA 3U8JA 2BG9C 5J5GA 4ILBA 5L47A 2BJ0A 3ZDGA 2XQ9A 4UM3A 5J0ZA 4HFDA 3ZDHA 2WNCA 5HEUA 4NPPA 3JAEA 2PH9A 3WTIA 4EZ1A 3JADA 5CFBA 1UV6A 4NZBA 4F8HA 5HEJA 2YMDA 4UM3S 3U8MA 3UU6A 5J5HA 4UXUA 2BYSA 2QC1B 4BFQA 2YOEA 2C9TA 3UU5A 3P4WA 2XQ4A 5LG3A 2BYPA 2PGZA 3UU4A 3WTLA 5JMEA 5CO5A 3EHZA 4PIRA 2BYRA 4HFIA 3T4MA 4ALXA 4ZRUA 5BP0A 5KE4A 3SIOA 4A98A 2BYQA 2UZ6A 2BG9A 4QABA 5AFMA 4LMKA 2XQ6A 4HQPA 4HFCA 3C84A 2Y58A 5AFLA 3UU3A 5LXBA 4IREA 4AFHA 5AINA 4TWHA 4XHEA 4ZJTA 2ZJUA 2XQ3A 2XQ5A 2XYTA 2W8FA 5J5FA 3SQ9A 3WTNA 2XNVA 3RIFA 4BQTA 3UU8A 4AFTA 5AFKA 2BG9E 2BG9B 4ILAA 5AFMB 2YKSA 5J5IA 1UX2A 3C79A 4QAAA 2ZJVA 3WIPA 4ZZBA 5BRXA 4XK9A 3WTJA 2Y57A 4AFGA 4D01A 5L4HA 5AFJA 3TLTA 4TWDA 1UW6A 3RQUA 5L4EA 2XQAA 4COFA 2YN6A 4ILCA 5IUXA 5TVCA 3TLWA 2XQ8A 2WN9A 3EAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIA A;  4DBM A;  5AFH A;  3U8K A;  4X5T A;  2Y7Y A;  4LML A;  5AFN A;  3UQ7 A;  3WTO A;  2X00 A;  3PMZ A;  4FRR A;  4IL9 A;  4Z90 A;  3JAF A;  4TNV A;  4A97 A;  4ZR6 A;  4HFB A;  3U8L A;  4QAC A;  2BR8 A;  4ZK4 A;  3RQW A;  3P50 A;  4TNW A;  3WTH A;  3ZKR A;  3TLS A;  3UQ4 A;  4TWF A;  4HFE A;  5HCJ A;  4QH1 A;  4ZJS A;  3TLV A;  3WTK A;  2YME A;  3PEO A;  2WNL A;  4UM1 A;  3RHW A;  4LMJ A;  2XQ7 A;  2XZ5 A;  2BYN A;  4ZZC A;  3RI5 A;  4B5D A;  5SYO A;  4UY2 A;  2XYS A;  2Y54 A;  3UUB A;  5HCM A;  5HEH A;  2XNU A;  2XZ6 A;  5HEG A;  2X00 D;  4QH4 A;  4QH5 A;  3U8N A;  4HFH A;  3IGQ A;  2WZY A;  2XNT A;  2W8G A;  2WNJ A;  3EI0 A;  5KZU A;  3SH1 A;  4Z91 A;  4ZK1 A;  5HEO A;  2BR7 A;  4IL4 A;  1I9B A;  3SQ6 A;  5BW2 A;  2VL0 A;  2Y56 A;  4WV9 A;  4UM3 P;  3WTM A;  3TLU A;  3GUA A;  3LSV A;  5FJV A;  3U8J A;  2BG9 C;  5J5G A;  4ILB A;  5L47 A;  2BJ0 A;  3ZDG A;  2XQ9 A;  4UM3 A;  5J0Z A;  4HFD A;  3ZDH A;  2WNC A;  5HEU A;  4NPP A;  3JAE A;  2PH9 A;  3WTI A;  4EZ1 A;  3JAD A;  5CFB A;  1UV6 A;  4NZB A;  4F8H A;  5HEJ A;  2YMD A;  4UM3 S;  3U8M A;  3UU6 A;  5J5H A;  4UXU A;  2BYS A;  2QC1 B;  4BFQ A;  2YOE A;  2C9T A;  3UU5 A;  3P4W A;  2XQ4 A;  5LG3 A;  2BYP A;  2PGZ A;  3UU4 A;  3WTL A;  5JME A;  5CO5 A;  3EHZ A;  4PIR A;  2BYR A;  4HFI A;  3T4M A;  4ALX A;  4ZRU A;  5BP0 A;  5KE4 A;  3SIO A;  4A98 A;  2BYQ A;  2UZ6 A;  2BG9 A;  4QAB A;  5AFM A;  4LMK A;  2XQ6 A;  4HQP A;  4HFC A;  3C84 A;  2Y58 A;  5AFL A;  3UU3 A;  5LXB A;  4IRE A;  4AFH A;  5AIN A;  4TWH A;  4XHE A;  4ZJT A;  2ZJU A;  2XQ3 A;  2XQ5 A;  2XYT A;  2W8F A;  5J5F A;  3SQ9 A;  3WTN A;  2XNV A;  3RIF A;  4BQT A;  3UU8 A;  4AFT A;  5AFK A;  2BG9 E;  2BG9 B;  4ILA A;  5AFM B;  2YKS A;  5J5I A;  1UX2 A;  3C79 A;  4QAA A;  2ZJV A;  3WIP A;  4ZZB A;  5BRX A;  4XK9 A;  3WTJ A;  2Y57 A;  4AFG A;  4D01 A;  5L4H A;  5AFJ A;  3TLT A;  4TWD A;  1UW6 A;  3RQU A;  5L4E A;  2XQA A;  4COF A;  2YN6 A;  4ILC A;  5IUX A;  5TVC A;  3TLW A;  2XQ8 A;  2WN9 A;  3EAM A; 
#chains in the Genus database with same CATH topology
 3RIA A;  4DBM A;  5AFH A;  3U8K A;  4X5T A;  2Y7Y A;  4LML A;  5AFN A;  3UQ7 A;  3WTO A;  2X00 A;  3PMZ A;  4FRR A;  4IL9 A;  4Z90 A;  3JAF A;  4TNV A;  4A97 A;  4ZR6 A;  4HFB A;  3U8L A;  4QAC A;  2BR8 A;  4ZK4 A;  3RQW A;  3P50 A;  4TNW A;  3WTH A;  3ZKR A;  3TLS A;  3UQ4 A;  4TWF A;  4HFE A;  5HCJ A;  4QH1 A;  4ZJS A;  3TLV A;  3WTK A;  2YME A;  3PEO A;  2WNL A;  4UM1 A;  3RHW A;  4LMJ A;  2XQ7 A;  2XZ5 A;  2BYN A;  4ZZC A;  3RI5 A;  4B5D A;  5SYO A;  4UY2 A;  2XYS A;  2Y54 A;  3UUB A;  5HCM A;  5HEH A;  2XNU A;  2XZ6 A;  5HEG A;  2X00 D;  4QH4 A;  4QH5 A;  3U8N A;  4HFH A;  3IGQ A;  2WZY A;  2XNT A;  2W8G A;  2WNJ A;  3EI0 A;  5KZU A;  3SH1 A;  4Z91 A;  4ZK1 A;  5HEO A;  2BR7 A;  4IL4 A;  1I9B A;  3SQ6 A;  5BW2 A;  2VL0 A;  2Y56 A;  4WV9 A;  4UM3 P;  3WTM A;  3TLU A;  3GUA A;  3LSV A;  5FJV A;  3U8J A;  2BG9 C;  5J5G A;  4ILB A;  5L47 A;  2BJ0 A;  3ZDG A;  2XQ9 A;  4UM3 A;  5J0Z A;  4HFD A;  3ZDH A;  2WNC A;  5HEU A;  4NPP A;  3JAE A;  2PH9 A;  3WTI A;  4EZ1 A;  3JAD A;  5CFB A;  1UV6 A;  4NZB A;  4F8H A;  5HEJ A;  2YMD A;  4UM3 S;  3U8M A;  3UU6 A;  5J5H A;  4UXU A;  2BYS A;  2QC1 B;  4BFQ A;  2YOE A;  2C9T A;  3UU5 A;  3P4W A;  2XQ4 A;  5LG3 A;  2BYP A;  2PGZ A;  3UU4 A;  3WTL A;  5JME A;  5CO5 A;  3EHZ A;  4PIR A;  2BYR A;  4HFI A;  3T4M A;  4ALX A;  4ZRU A;  5BP0 A;  5KE4 A;  3SIO A;  4A98 A;  2BYQ A;  2UZ6 A;  2BG9 A;  4QAB A;  5AFM A;  4LMK A;  2XQ6 A;  4HQP A;  4HFC A;  3C84 A;  2Y58 A;  5AFL A;  3UU3 A;  5LXB A;  4IRE A;  4AFH A;  5AIN A;  4TWH A;  4XHE A;  4ZJT A;  2ZJU A;  2XQ3 A;  2XQ5 A;  2XYT A;  2W8F A;  5J5F A;  3SQ9 A;  3WTN A;  2XNV A;  3RIF A;  4BQT A;  3UU8 A;  4AFT A;  5AFK A;  2BG9 E;  2BG9 B;  4ILA A;  5AFM B;  2YKS A;  5J5I A;  1UX2 A;  3C79 A;  4QAA A;  2ZJV A;  3WIP A;  4ZZB A;  5BRX A;  4XK9 A;  3WTJ A;  2Y57 A;  4AFG A;  4D01 A;  5L4H A;  5AFJ A;  3TLT A;  4TWD A;  1UW6 A;  3RQU A;  5L4E A;  2XQA A;  4COF A;  2YN6 A;  4ILC A;  5IUX A;  5TVC A;  3TLW A;  2XQ8 A;  2WN9 A;  3EAM A; 
#chains in the Genus database with same CATH homology
 3RIA A;  4DBM A;  5AFH A;  3U8K A;  4X5T A;  2Y7Y A;  4LML A;  5AFN A;  3UQ7 A;  3WTO A;  2X00 A;  3PMZ A;  4FRR A;  4IL9 A;  4Z90 A;  3JAF A;  4TNV A;  4A97 A;  4ZR6 A;  4HFB A;  3U8L A;  4QAC A;  2BR8 A;  4ZK4 A;  3RQW A;  3P50 A;  4TNW A;  3WTH A;  3ZKR A;  3TLS A;  3UQ4 A;  4TWF A;  4HFE A;  5HCJ A;  4QH1 A;  4ZJS A;  3TLV A;  3WTK A;  2YME A;  3PEO A;  2WNL A;  4UM1 A;  3RHW A;  4LMJ A;  2XQ7 A;  2XZ5 A;  2BYN A;  4ZZC A;  3RI5 A;  4B5D A;  5SYO A;  4UY2 A;  2XYS A;  2Y54 A;  3UUB A;  5HCM A;  5HEH A;  2XNU A;  2XZ6 A;  5HEG A;  2X00 D;  4QH4 A;  4QH5 A;  3U8N A;  4HFH A;  3IGQ A;  2WZY A;  2XNT A;  2W8G A;  2WNJ A;  3EI0 A;  5KZU A;  3SH1 A;  4Z91 A;  4ZK1 A;  5HEO A;  2BR7 A;  4IL4 A;  1I9B A;  3SQ6 A;  5BW2 A;  2VL0 A;  2Y56 A;  4WV9 A;  4UM3 P;  3WTM A;  3TLU A;  3GUA A;  3LSV A;  5FJV A;  3U8J A;  2BG9 C;  5J5G A;  4ILB A;  5L47 A;  2BJ0 A;  3ZDG A;  2XQ9 A;  4UM3 A;  5J0Z A;  4HFD A;  3ZDH A;  2WNC A;  5HEU A;  4NPP A;  3JAE A;  2PH9 A;  3WTI A;  4EZ1 A;  3JAD A;  5CFB A;  1UV6 A;  4NZB A;  4F8H A;  5HEJ A;  2YMD A;  4UM3 S;  3U8M A;  3UU6 A;  5J5H A;  4UXU A;  2BYS A;  2QC1 B;  4BFQ A;  2YOE A;  2C9T A;  3UU5 A;  3P4W A;  2XQ4 A;  5LG3 A;  2BYP A;  2PGZ A;  3UU4 A;  3WTL A;  5JME A;  5CO5 A;  3EHZ A;  4PIR A;  2BYR A;  4HFI A;  3T4M A;  4ALX A;  4ZRU A;  5BP0 A;  5KE4 A;  3SIO A;  4A98 A;  2BYQ A;  2UZ6 A;  2BG9 A;  4QAB A;  5AFM A;  4LMK A;  2XQ6 A;  4HQP A;  4HFC A;  3C84 A;  2Y58 A;  5AFL A;  3UU3 A;  5LXB A;  4IRE A;  4AFH A;  5AIN A;  4TWH A;  4XHE A;  4ZJT A;  2ZJU A;  2XQ3 A;  2XQ5 A;  2XYT A;  2W8F A;  5J5F A;  3SQ9 A;  3WTN A;  2XNV A;  3RIF A;  4BQT A;  3UU8 A;  4AFT A;  5AFK A;  2BG9 E;  2BG9 B;  4ILA A;  5AFM B;  2YKS A;  5J5I A;  1UX2 A;  3C79 A;  4QAA A;  2ZJV A;  3WIP A;  4ZZB A;  5BRX A;  4XK9 A;  3WTJ A;  2Y57 A;  4AFG A;  4D01 A;  5L4H A;  5AFJ A;  3TLT A;  4TWD A;  1UW6 A;  3RQU A;  5L4E A;  2XQA A;  4COF A;  2YN6 A;  4ILC A;  5IUX A;  5TVC A;  3TLW A;  2XQ8 A;  2WN9 A;  3EAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...