2WNLA

Crystal structure of aplysia achbp in complex with anabaseine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
213
Chain Sequence
DDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural determinants for interaction of partial agonists with acetylcholine binding protein and neuronal alpha7 nicotinic acetylcholine receptor.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 50
structure length 213
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2wnlA00
2XQ6A 2BG9A 2XYTA 2X00D 4ILBA 4TWFA 4IREA 3UU5A 4D01A 5BP0A 2WZYA 2XQ8A 2WN9A 5CO5A 1I9BA 4QAAA 5HEHA 2YMEA 4QACA 3WTNA 2BYRA 3UU6A 4BFQA 4IL9A 4AFGA 5KE4A 3SQ6A 3SH1A 4ZJTA 3WTLA 5SYOA 2BG9E 5AFMA 4IL4A 2BG9B 3C84A 2XQ3A 3RHWA 4HFHA 2C9TA 4HFBA 3RQWA 5L47A 3JADA 2YN6A 4TNVA 4QABA 3UQ4A 2XNVA 3EI0A 4XHEA 4X5TA 2Y56A 3TLTA 2W8FA 4UY2A 4B5DA 1UW6A 5HEGA 2XQ5A 3U8NA 2XNUA 4HQPA 4TWHA 5KZUA 3UQ7A 1UV6A 5AFMB 4NZBA 2X00A 3U8MA 5J5IA 5J5GA 3TLUA 3PMZA 5HEOA 4AFHA 3WTIA 2WNCA 4UM3P 4QH4A 4TWDA 2XQ9A 4ZRUA 5CFBA 3EHZA 4ZZCA 3C79A 5AFNA 3TLSA 3U8KA 5J5HA 4HFDA 3WTOA 2QC1B 4F8HA 2WNJA 5AINA 5L4HA 5AFKA 2UZ6A 4ZK1A 2ZJVA 2PH9A 5BRXA 3ZDHA 2BYPA 5J0ZA 3ZKRA 4Z91A 4BQTA 2XZ5A 3PEOA 2W8GA 4ILAA 3RQUA 4ZJSA 3UU8A 5HEUA 5AFLA 2BYNA 5TVCA 3WTHA 2BR8A 3UUBA 2XNTA 5BW2A 3WTKA 3WIPA 3JAEA 2BYSA 1UX2A 2YKSA 4UXUA 2Y7YA 4UM3S 5LG3A 4A97A 5JMEA 3JAFA 3WTJA 3TLVA 2BYQA 2YMDA 4ZK4A 4QH1A 4ZR6A 5J5FA 2ZJUA 5FJVA 3UU4A 4HFIA 3P4WA 4HFEA 4TNWA 2XQAA 5L4EA 3SQ9A 3IGQA 4COFA 2VL0A 4QH5A 3WTMA 4FRRA 3GUAA 3U8LA 2Y57A 3UU3A 3LSVA 5HCJA 5HCMA 2XQ7A 3ZDGA 4ZZBA 5AFHA 2BJ0A 4EZ1A 5IUXA 2BG9C 3TLWA 2XQ4A 2YOEA 4ILCA 2Y58A 5HEJA 4UM1A 3P50A 2XZ6A 4ALXA 3EAMA 3RIAA 3SIOA 4AFTA 3RIFA 4LMLA 3T4MA 2WNLA 4XK9A 2PGZA 3RI5A 3U8JA 2BR7A 2XYSA 4NPPA 4PIRA 5AFJA 5LXBA 4LMKA 4UM3A 4LMJA 4HFCA 4Z90A 4A98A 4WV9A 4DBMA 2Y54A
chains in the Genus database with same CATH superfamily
2XQ6A 2BG9A 2XYTA 2X00D 4ILBA 4TWFA 4IREA 3UU5A 4D01A 5BP0A 2WZYA 2XQ8A 2WN9A 5CO5A 1I9BA 4QAAA 5HEHA 2YMEA 4QACA 3WTNA 2BYRA 3UU6A 4BFQA 4IL9A 4AFGA 5KE4A 3SQ6A 3SH1A 4ZJTA 3WTLA 5SYOA 2BG9E 5AFMA 4IL4A 2BG9B 3C84A 2XQ3A 3RHWA 4HFHA 2C9TA 4HFBA 3RQWA 5L47A 3JADA 2YN6A 4TNVA 4QABA 3UQ4A 2XNVA 3EI0A 4XHEA 4X5TA 2Y56A 3TLTA 2W8FA 4UY2A 4B5DA 1UW6A 5HEGA 2XQ5A 3U8NA 2XNUA 4HQPA 4TWHA 5KZUA 3UQ7A 1UV6A 5AFMB 4NZBA 2X00A 3U8MA 5J5IA 5J5GA 3TLUA 3PMZA 5HEOA 4AFHA 3WTIA 2WNCA 4UM3P 4QH4A 4TWDA 2XQ9A 4ZRUA 5CFBA 3EHZA 4ZZCA 3C79A 5AFNA 3TLSA 3U8KA 5J5HA 4HFDA 3WTOA 2QC1B 4F8HA 2WNJA 5AINA 5L4HA 5AFKA 2UZ6A 4ZK1A 2ZJVA 2PH9A 5BRXA 3ZDHA 2BYPA 5J0ZA 3ZKRA 4Z91A 4BQTA 2XZ5A 3PEOA 2W8GA 4ILAA 3RQUA 4ZJSA 3UU8A 5HEUA 5AFLA 2BYNA 5TVCA 3WTHA 2BR8A 3UUBA 2XNTA 5BW2A 3WTKA 3WIPA 3JAEA 2BYSA 1UX2A 2YKSA 4UXUA 2Y7YA 4UM3S 5LG3A 4A97A 5JMEA 3JAFA 3WTJA 3TLVA 2BYQA 2YMDA 4ZK4A 4QH1A 4ZR6A 5J5FA 2ZJUA 5FJVA 3UU4A 4HFIA 3P4WA 4HFEA 4TNWA 2XQAA 5L4EA 3SQ9A 3IGQA 4COFA 2VL0A 4QH5A 3WTMA 4FRRA 3GUAA 3U8LA 2Y57A 3UU3A 3LSVA 5HCJA 5HCMA 2XQ7A 3ZDGA 4ZZBA 5AFHA 2BJ0A 4EZ1A 5IUXA 2BG9C 3TLWA 2XQ4A 2YOEA 4ILCA 2Y58A 5HEJA 4UM1A 3P50A 2XZ6A 4ALXA 3EAMA 3RIAA 3SIOA 4AFTA 3RIFA 4LMLA 3T4MA 2WNLA 4XK9A 2PGZA 3RI5A 3U8JA 2BR7A 2XYSA 4NPPA 4PIRA 5AFJA 5LXBA 4LMKA 4UM3A 4LMJA 4HFCA 4Z90A 4A98A 4WV9A 4DBMA 2Y54A
chains in the Genus database with same CATH topology
2XQ6A 2BG9A 2XYTA 2X00D 4ILBA 4TWFA 4IREA 3UU5A 4D01A 5BP0A 2WZYA 2XQ8A 2WN9A 5CO5A 1I9BA 4QAAA 5HEHA 2YMEA 4QACA 3WTNA 2BYRA 3UU6A 4BFQA 4IL9A 4AFGA 5KE4A 3SQ6A 3SH1A 4ZJTA 3WTLA 5SYOA 2BG9E 5AFMA 4IL4A 2BG9B 3C84A 2XQ3A 3RHWA 4HFHA 2C9TA 4HFBA 3RQWA 5L47A 3JADA 2YN6A 4TNVA 4QABA 3UQ4A 2XNVA 3EI0A 4XHEA 4X5TA 2Y56A 3TLTA 2W8FA 4UY2A 4B5DA 1UW6A 5HEGA 2XQ5A 3U8NA 2XNUA 4HQPA 4TWHA 5KZUA 3UQ7A 1UV6A 5AFMB 4NZBA 2X00A 3U8MA 5J5IA 5J5GA 3TLUA 3PMZA 5HEOA 4AFHA 3WTIA 2WNCA 4UM3P 4QH4A 4TWDA 2XQ9A 4ZRUA 5CFBA 3EHZA 4ZZCA 3C79A 5AFNA 3TLSA 3U8KA 5J5HA 4HFDA 3WTOA 2QC1B 4F8HA 2WNJA 5AINA 5L4HA 5AFKA 2UZ6A 4ZK1A 2ZJVA 2PH9A 5BRXA 3ZDHA 2BYPA 5J0ZA 3ZKRA 4Z91A 4BQTA 2XZ5A 3PEOA 2W8GA 4ILAA 3RQUA 4ZJSA 3UU8A 5HEUA 5AFLA 2BYNA 5TVCA 3WTHA 2BR8A 3UUBA 2XNTA 5BW2A 3WTKA 3WIPA 3JAEA 2BYSA 1UX2A 2YKSA 4UXUA 2Y7YA 4UM3S 5LG3A 4A97A 5JMEA 3JAFA 3WTJA 3TLVA 2BYQA 2YMDA 4ZK4A 4QH1A 4ZR6A 5J5FA 2ZJUA 5FJVA 3UU4A 4HFIA 3P4WA 4HFEA 4TNWA 2XQAA 5L4EA 3SQ9A 3IGQA 4COFA 2VL0A 4QH5A 3WTMA 4FRRA 3GUAA 3U8LA 2Y57A 3UU3A 3LSVA 5HCJA 5HCMA 2XQ7A 3ZDGA 4ZZBA 5AFHA 2BJ0A 4EZ1A 5IUXA 2BG9C 3TLWA 2XQ4A 2YOEA 4ILCA 2Y58A 5HEJA 4UM1A 3P50A 2XZ6A 4ALXA 3EAMA 3RIAA 3SIOA 4AFTA 3RIFA 4LMLA 3T4MA 2WNLA 4XK9A 2PGZA 3RI5A 3U8JA 2BR7A 2XYSA 4NPPA 4PIRA 5AFJA 5LXBA 4LMKA 4UM3A 4LMJA 4HFCA 4Z90A 4A98A 4WV9A 4DBMA 2Y54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ6 A;  2BG9 A;  2XYT A;  2X00 D;  4ILB A;  4TWF A;  4IRE A;  3UU5 A;  4D01 A;  5BP0 A;  2WZY A;  2XQ8 A;  2WN9 A;  5CO5 A;  1I9B A;  4QAA A;  5HEH A;  2YME A;  4QAC A;  3WTN A;  2BYR A;  3UU6 A;  4BFQ A;  4IL9 A;  4AFG A;  5KE4 A;  3SQ6 A;  3SH1 A;  4ZJT A;  3WTL A;  5SYO A;  2BG9 E;  5AFM A;  4IL4 A;  2BG9 B;  3C84 A;  2XQ3 A;  3RHW A;  4HFH A;  2C9T A;  4HFB A;  3RQW A;  5L47 A;  3JAD A;  2YN6 A;  4TNV A;  4QAB A;  3UQ4 A;  2XNV A;  3EI0 A;  4XHE A;  4X5T A;  2Y56 A;  3TLT A;  2W8F A;  4UY2 A;  4B5D A;  1UW6 A;  5HEG A;  2XQ5 A;  3U8N A;  2XNU A;  4HQP A;  4TWH A;  5KZU A;  3UQ7 A;  1UV6 A;  5AFM B;  4NZB A;  2X00 A;  3U8M A;  5J5I A;  5J5G A;  3TLU A;  3PMZ A;  5HEO A;  4AFH A;  3WTI A;  2WNC A;  4UM3 P;  4QH4 A;  4TWD A;  2XQ9 A;  4ZRU A;  5CFB A;  3EHZ A;  4ZZC A;  3C79 A;  5AFN A;  3TLS A;  3U8K A;  5J5H A;  4HFD A;  3WTO A;  2QC1 B;  4F8H A;  2WNJ A;  5AIN A;  5L4H A;  5AFK A;  2UZ6 A;  4ZK1 A;  2ZJV A;  2PH9 A;  5BRX A;  3ZDH A;  2BYP A;  5J0Z A;  3ZKR A;  4Z91 A;  4BQT A;  2XZ5 A;  3PEO A;  2W8G A;  4ILA A;  3RQU A;  4ZJS A;  3UU8 A;  5HEU A;  5AFL A;  2BYN A;  5TVC A;  3WTH A;  2BR8 A;  3UUB A;  2XNT A;  5BW2 A;  3WTK A;  3WIP A;  3JAE A;  2BYS A;  1UX2 A;  2YKS A;  4UXU A;  2Y7Y A;  4UM3 S;  5LG3 A;  4A97 A;  5JME A;  3JAF A;  3WTJ A;  3TLV A;  2BYQ A;  2YMD A;  4ZK4 A;  4QH1 A;  4ZR6 A;  5J5F A;  2ZJU A;  5FJV A;  3UU4 A;  4HFI A;  3P4W A;  4HFE A;  4TNW A;  2XQA A;  5L4E A;  3SQ9 A;  3IGQ A;  4COF A;  2VL0 A;  4QH5 A;  3WTM A;  4FRR A;  3GUA A;  3U8L A;  2Y57 A;  3UU3 A;  3LSV A;  5HCJ A;  5HCM A;  2XQ7 A;  3ZDG A;  4ZZB A;  5AFH A;  2BJ0 A;  4EZ1 A;  5IUX A;  2BG9 C;  3TLW A;  2XQ4 A;  2YOE A;  4ILC A;  2Y58 A;  5HEJ A;  4UM1 A;  3P50 A;  2XZ6 A;  4ALX A;  3EAM A;  3RIA A;  3SIO A;  4AFT A;  3RIF A;  4LML A;  3T4M A;  2WNL A;  4XK9 A;  2PGZ A;  3RI5 A;  3U8J A;  2BR7 A;  2XYS A;  4NPP A;  4PIR A;  5AFJ A;  5LXB A;  4LMK A;  4UM3 A;  4LMJ A;  4HFC A;  4Z90 A;  4A98 A;  4WV9 A;  4DBM A;  2Y54 A; 
#chains in the Genus database with same CATH topology
 2XQ6 A;  2BG9 A;  2XYT A;  2X00 D;  4ILB A;  4TWF A;  4IRE A;  3UU5 A;  4D01 A;  5BP0 A;  2WZY A;  2XQ8 A;  2WN9 A;  5CO5 A;  1I9B A;  4QAA A;  5HEH A;  2YME A;  4QAC A;  3WTN A;  2BYR A;  3UU6 A;  4BFQ A;  4IL9 A;  4AFG A;  5KE4 A;  3SQ6 A;  3SH1 A;  4ZJT A;  3WTL A;  5SYO A;  2BG9 E;  5AFM A;  4IL4 A;  2BG9 B;  3C84 A;  2XQ3 A;  3RHW A;  4HFH A;  2C9T A;  4HFB A;  3RQW A;  5L47 A;  3JAD A;  2YN6 A;  4TNV A;  4QAB A;  3UQ4 A;  2XNV A;  3EI0 A;  4XHE A;  4X5T A;  2Y56 A;  3TLT A;  2W8F A;  4UY2 A;  4B5D A;  1UW6 A;  5HEG A;  2XQ5 A;  3U8N A;  2XNU A;  4HQP A;  4TWH A;  5KZU A;  3UQ7 A;  1UV6 A;  5AFM B;  4NZB A;  2X00 A;  3U8M A;  5J5I A;  5J5G A;  3TLU A;  3PMZ A;  5HEO A;  4AFH A;  3WTI A;  2WNC A;  4UM3 P;  4QH4 A;  4TWD A;  2XQ9 A;  4ZRU A;  5CFB A;  3EHZ A;  4ZZC A;  3C79 A;  5AFN A;  3TLS A;  3U8K A;  5J5H A;  4HFD A;  3WTO A;  2QC1 B;  4F8H A;  2WNJ A;  5AIN A;  5L4H A;  5AFK A;  2UZ6 A;  4ZK1 A;  2ZJV A;  2PH9 A;  5BRX A;  3ZDH A;  2BYP A;  5J0Z A;  3ZKR A;  4Z91 A;  4BQT A;  2XZ5 A;  3PEO A;  2W8G A;  4ILA A;  3RQU A;  4ZJS A;  3UU8 A;  5HEU A;  5AFL A;  2BYN A;  5TVC A;  3WTH A;  2BR8 A;  3UUB A;  2XNT A;  5BW2 A;  3WTK A;  3WIP A;  3JAE A;  2BYS A;  1UX2 A;  2YKS A;  4UXU A;  2Y7Y A;  4UM3 S;  5LG3 A;  4A97 A;  5JME A;  3JAF A;  3WTJ A;  3TLV A;  2BYQ A;  2YMD A;  4ZK4 A;  4QH1 A;  4ZR6 A;  5J5F A;  2ZJU A;  5FJV A;  3UU4 A;  4HFI A;  3P4W A;  4HFE A;  4TNW A;  2XQA A;  5L4E A;  3SQ9 A;  3IGQ A;  4COF A;  2VL0 A;  4QH5 A;  3WTM A;  4FRR A;  3GUA A;  3U8L A;  2Y57 A;  3UU3 A;  3LSV A;  5HCJ A;  5HCM A;  2XQ7 A;  3ZDG A;  4ZZB A;  5AFH A;  2BJ0 A;  4EZ1 A;  5IUX A;  2BG9 C;  3TLW A;  2XQ4 A;  2YOE A;  4ILC A;  2Y58 A;  5HEJ A;  4UM1 A;  3P50 A;  2XZ6 A;  4ALX A;  3EAM A;  3RIA A;  3SIO A;  4AFT A;  3RIF A;  4LML A;  3T4M A;  2WNL A;  4XK9 A;  2PGZ A;  3RI5 A;  3U8J A;  2BR7 A;  2XYS A;  4NPP A;  4PIR A;  5AFJ A;  5LXB A;  4LMK A;  4UM3 A;  4LMJ A;  4HFC A;  4Z90 A;  4A98 A;  4WV9 A;  4DBM A;  2Y54 A; 
#chains in the Genus database with same CATH homology
 2XQ6 A;  2BG9 A;  2XYT A;  2X00 D;  4ILB A;  4TWF A;  4IRE A;  3UU5 A;  4D01 A;  5BP0 A;  2WZY A;  2XQ8 A;  2WN9 A;  5CO5 A;  1I9B A;  4QAA A;  5HEH A;  2YME A;  4QAC A;  3WTN A;  2BYR A;  3UU6 A;  4BFQ A;  4IL9 A;  4AFG A;  5KE4 A;  3SQ6 A;  3SH1 A;  4ZJT A;  3WTL A;  5SYO A;  2BG9 E;  5AFM A;  4IL4 A;  2BG9 B;  3C84 A;  2XQ3 A;  3RHW A;  4HFH A;  2C9T A;  4HFB A;  3RQW A;  5L47 A;  3JAD A;  2YN6 A;  4TNV A;  4QAB A;  3UQ4 A;  2XNV A;  3EI0 A;  4XHE A;  4X5T A;  2Y56 A;  3TLT A;  2W8F A;  4UY2 A;  4B5D A;  1UW6 A;  5HEG A;  2XQ5 A;  3U8N A;  2XNU A;  4HQP A;  4TWH A;  5KZU A;  3UQ7 A;  1UV6 A;  5AFM B;  4NZB A;  2X00 A;  3U8M A;  5J5I A;  5J5G A;  3TLU A;  3PMZ A;  5HEO A;  4AFH A;  3WTI A;  2WNC A;  4UM3 P;  4QH4 A;  4TWD A;  2XQ9 A;  4ZRU A;  5CFB A;  3EHZ A;  4ZZC A;  3C79 A;  5AFN A;  3TLS A;  3U8K A;  5J5H A;  4HFD A;  3WTO A;  2QC1 B;  4F8H A;  2WNJ A;  5AIN A;  5L4H A;  5AFK A;  2UZ6 A;  4ZK1 A;  2ZJV A;  2PH9 A;  5BRX A;  3ZDH A;  2BYP A;  5J0Z A;  3ZKR A;  4Z91 A;  4BQT A;  2XZ5 A;  3PEO A;  2W8G A;  4ILA A;  3RQU A;  4ZJS A;  3UU8 A;  5HEU A;  5AFL A;  2BYN A;  5TVC A;  3WTH A;  2BR8 A;  3UUB A;  2XNT A;  5BW2 A;  3WTK A;  3WIP A;  3JAE A;  2BYS A;  1UX2 A;  2YKS A;  4UXU A;  2Y7Y A;  4UM3 S;  5LG3 A;  4A97 A;  5JME A;  3JAF A;  3WTJ A;  3TLV A;  2BYQ A;  2YMD A;  4ZK4 A;  4QH1 A;  4ZR6 A;  5J5F A;  2ZJU A;  5FJV A;  3UU4 A;  4HFI A;  3P4W A;  4HFE A;  4TNW A;  2XQA A;  5L4E A;  3SQ9 A;  3IGQ A;  4COF A;  2VL0 A;  4QH5 A;  3WTM A;  4FRR A;  3GUA A;  3U8L A;  2Y57 A;  3UU3 A;  3LSV A;  5HCJ A;  5HCM A;  2XQ7 A;  3ZDG A;  4ZZB A;  5AFH A;  2BJ0 A;  4EZ1 A;  5IUX A;  2BG9 C;  3TLW A;  2XQ4 A;  2YOE A;  4ILC A;  2Y58 A;  5HEJ A;  4UM1 A;  3P50 A;  2XZ6 A;  4ALX A;  3EAM A;  3RIA A;  3SIO A;  4AFT A;  3RIF A;  4LML A;  3T4M A;  2WNL A;  4XK9 A;  2PGZ A;  3RI5 A;  3U8J A;  2BR7 A;  2XYS A;  4NPP A;  4PIR A;  5AFJ A;  5LXB A;  4LMK A;  4UM3 A;  4LMJ A;  4HFC A;  4Z90 A;  4A98 A;  4WV9 A;  4DBM A;  2Y54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...