4UY2A

Crystal structure of the complex of the extracellular domain of human alpha9 nachr with alpha-bungarotoxin.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
203
Chain Sequence
YAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin-binding protein/toxin
molecule keywords NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-9
publication title Crystal Structures of Free and Antagonist-Bound States of Human Alpha9 Nicotinic Receptor Extracellular Domain
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 203
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4uy2A00
2UZ6A 2XQ7A 5CO5A 3RHWA 2YMEA 1I9BA 3P50A 4TWFA 4QH1A 5LG3A 3UU6A 5J5GA 4EZ1A 4X5TA 2BYRA 4UM3P 3UUBA 5KZUA 2BG9E 4ILBA 4UM1A 4FRRA 4ZRUA 3ZDHA 2YMDA 5HEGA 5JMEA 2XQ3A 3C79A 4IL9A 4IL4A 5L47A 5LXBA 2YKSA 1UW6A 3PMZA 5TVCA 3ZDGA 4TWHA 2XYSA 5HCMA 4ZJSA 5HEJA 5J5HA 4QABA 5BRXA 5KE4A 3EHZA 4WV9A 4HFBA 4QH4A 4ZZCA 3SIOA 3IGQA 3RQWA 4DBMA 2BYQA 4HFIA 2YN6A 2XQ8A 3LSVA 5AFNA 4A97A 3EI0A 2QC1B 4ZK1A 5J5IA 4TWDA 3WTNA 2YOEA 3WTJA 2BJ0A 4Z90A 4UY2A 3WTMA 2ZJUA 4TNWA 4XHEA 3TLVA 2BG9A 4LMJA 4UM3A 2XZ6A 5AFJA 3JADA 3ZKRA 4NZBA 4ZZBA 2WNCA 5AFHA 3TLUA 3UU4A 4HFDA 3TLTA 4NPPA 4XK9A 2XQ9A 4AFTA 2W8FA 4F8HA 4COFA 5L4EA 4D01A 4AFHA 4LMKA 2BG9B 3SQ9A 4UM3S 4BFQA 2PH9A 1UV6A 3WTIA 3SH1A 5IUXA 4HFEA 2X00D 2WNLA 3U8LA 2XYTA 5AINA 3RIFA 4BQTA 4ILCA 5HEHA 3U8NA 3UQ4A 2WZYA 4UXUA 4IREA 3RQUA 3GUAA 5HEUA 3U8JA 3RIAA 4B5DA 3U8MA 4HFCA 2ZJVA 3EAMA 2WN9A 5SYOA 2XNVA 3C84A 3TLSA 3UU5A 3WIPA 2BYNA 2WNJA 4LMLA 4ALXA 2C9TA 2Y58A 3JAEA 4QACA 2XQ5A 5J0ZA 3UU8A 2XNTA 4ZJTA 2PGZA 3WTKA 2XZ5A 2Y56A 2XQ6A 3WTOA 4QAAA 5FJVA 5HEOA 3P4WA 3WTLA 4HFHA 3RI5A 3JAFA 2VL0A 3T4MA 2Y7YA 5AFMB 2Y54A 4Z91A 4ZK4A 3TLWA 2BYSA 2BG9C 3UQ7A 3SQ6A 3UU3A 5CFBA 2XNUA 1UX2A 2W8GA 4QH5A 2XQ4A 2BR7A 5J5FA 5AFKA 4AFGA 4ILAA 4PIRA 2XQAA 4ZR6A 5BP0A 4HQPA 3PEOA 3WTHA 2X00A 4TNVA 2BYPA 5AFMA 5BW2A 5HCJA 5L4HA 2Y57A 4A98A 3U8KA 2BR8A 5AFLA
chains in the Genus database with same CATH superfamily
2UZ6A 2XQ7A 5CO5A 3RHWA 2YMEA 1I9BA 3P50A 4TWFA 4QH1A 5LG3A 3UU6A 5J5GA 4EZ1A 4X5TA 2BYRA 4UM3P 3UUBA 5KZUA 2BG9E 4ILBA 4UM1A 4FRRA 4ZRUA 3ZDHA 2YMDA 5HEGA 5JMEA 2XQ3A 3C79A 4IL9A 4IL4A 5L47A 5LXBA 2YKSA 1UW6A 3PMZA 5TVCA 3ZDGA 4TWHA 2XYSA 5HCMA 4ZJSA 5HEJA 5J5HA 4QABA 5BRXA 5KE4A 3EHZA 4WV9A 4HFBA 4QH4A 4ZZCA 3SIOA 3IGQA 3RQWA 4DBMA 2BYQA 4HFIA 2YN6A 2XQ8A 3LSVA 5AFNA 4A97A 3EI0A 2QC1B 4ZK1A 5J5IA 4TWDA 3WTNA 2YOEA 3WTJA 2BJ0A 4Z90A 4UY2A 3WTMA 2ZJUA 4TNWA 4XHEA 3TLVA 2BG9A 4LMJA 4UM3A 2XZ6A 5AFJA 3JADA 3ZKRA 4NZBA 4ZZBA 2WNCA 5AFHA 3TLUA 3UU4A 4HFDA 3TLTA 4NPPA 4XK9A 2XQ9A 4AFTA 2W8FA 4F8HA 4COFA 5L4EA 4D01A 4AFHA 4LMKA 2BG9B 3SQ9A 4UM3S 4BFQA 2PH9A 1UV6A 3WTIA 3SH1A 5IUXA 4HFEA 2X00D 2WNLA 3U8LA 2XYTA 5AINA 3RIFA 4BQTA 4ILCA 5HEHA 3U8NA 3UQ4A 2WZYA 4UXUA 4IREA 3RQUA 3GUAA 5HEUA 3U8JA 3RIAA 4B5DA 3U8MA 4HFCA 2ZJVA 3EAMA 2WN9A 5SYOA 2XNVA 3C84A 3TLSA 3UU5A 3WIPA 2BYNA 2WNJA 4LMLA 4ALXA 2C9TA 2Y58A 3JAEA 4QACA 2XQ5A 5J0ZA 3UU8A 2XNTA 4ZJTA 2PGZA 3WTKA 2XZ5A 2Y56A 2XQ6A 3WTOA 4QAAA 5FJVA 5HEOA 3P4WA 3WTLA 4HFHA 3RI5A 3JAFA 2VL0A 3T4MA 2Y7YA 5AFMB 2Y54A 4Z91A 4ZK4A 3TLWA 2BYSA 2BG9C 3UQ7A 3SQ6A 3UU3A 5CFBA 2XNUA 1UX2A 2W8GA 4QH5A 2XQ4A 2BR7A 5J5FA 5AFKA 4AFGA 4ILAA 4PIRA 2XQAA 4ZR6A 5BP0A 4HQPA 3PEOA 3WTHA 2X00A 4TNVA 2BYPA 5AFMA 5BW2A 5HCJA 5L4HA 2Y57A 4A98A 3U8KA 2BR8A 5AFLA
chains in the Genus database with same CATH topology
2UZ6A 2XQ7A 5CO5A 3RHWA 2YMEA 1I9BA 3P50A 4TWFA 4QH1A 5LG3A 3UU6A 5J5GA 4EZ1A 4X5TA 2BYRA 4UM3P 3UUBA 5KZUA 2BG9E 4ILBA 4UM1A 4FRRA 4ZRUA 3ZDHA 2YMDA 5HEGA 5JMEA 2XQ3A 3C79A 4IL9A 4IL4A 5L47A 5LXBA 2YKSA 1UW6A 3PMZA 5TVCA 3ZDGA 4TWHA 2XYSA 5HCMA 4ZJSA 5HEJA 5J5HA 4QABA 5BRXA 5KE4A 3EHZA 4WV9A 4HFBA 4QH4A 4ZZCA 3SIOA 3IGQA 3RQWA 4DBMA 2BYQA 4HFIA 2YN6A 2XQ8A 3LSVA 5AFNA 4A97A 3EI0A 2QC1B 4ZK1A 5J5IA 4TWDA 3WTNA 2YOEA 3WTJA 2BJ0A 4Z90A 4UY2A 3WTMA 2ZJUA 4TNWA 4XHEA 3TLVA 2BG9A 4LMJA 4UM3A 2XZ6A 5AFJA 3JADA 3ZKRA 4NZBA 4ZZBA 2WNCA 5AFHA 3TLUA 3UU4A 4HFDA 3TLTA 4NPPA 4XK9A 2XQ9A 4AFTA 2W8FA 4F8HA 4COFA 5L4EA 4D01A 4AFHA 4LMKA 2BG9B 3SQ9A 4UM3S 4BFQA 2PH9A 1UV6A 3WTIA 3SH1A 5IUXA 4HFEA 2X00D 2WNLA 3U8LA 2XYTA 5AINA 3RIFA 4BQTA 4ILCA 5HEHA 3U8NA 3UQ4A 2WZYA 4UXUA 4IREA 3RQUA 3GUAA 5HEUA 3U8JA 3RIAA 4B5DA 3U8MA 4HFCA 2ZJVA 3EAMA 2WN9A 5SYOA 2XNVA 3C84A 3TLSA 3UU5A 3WIPA 2BYNA 2WNJA 4LMLA 4ALXA 2C9TA 2Y58A 3JAEA 4QACA 2XQ5A 5J0ZA 3UU8A 2XNTA 4ZJTA 2PGZA 3WTKA 2XZ5A 2Y56A 2XQ6A 3WTOA 4QAAA 5FJVA 5HEOA 3P4WA 3WTLA 4HFHA 3RI5A 3JAFA 2VL0A 3T4MA 2Y7YA 5AFMB 2Y54A 4Z91A 4ZK4A 3TLWA 2BYSA 2BG9C 3UQ7A 3SQ6A 3UU3A 5CFBA 2XNUA 1UX2A 2W8GA 4QH5A 2XQ4A 2BR7A 5J5FA 5AFKA 4AFGA 4ILAA 4PIRA 2XQAA 4ZR6A 5BP0A 4HQPA 3PEOA 3WTHA 2X00A 4TNVA 2BYPA 5AFMA 5BW2A 5HCJA 5L4HA 2Y57A 4A98A 3U8KA 2BR8A 5AFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ6 A;  2XQ7 A;  5CO5 A;  3RHW A;  2YME A;  1I9B A;  3P50 A;  4TWF A;  4QH1 A;  5LG3 A;  3UU6 A;  5J5G A;  4EZ1 A;  4X5T A;  2BYR A;  4UM3 P;  3UUB A;  5KZU A;  2BG9 E;  4ILB A;  4UM1 A;  4FRR A;  4ZRU A;  3ZDH A;  2YMD A;  5HEG A;  5JME A;  2XQ3 A;  3C79 A;  4IL9 A;  4IL4 A;  5L47 A;  5LXB A;  2YKS A;  1UW6 A;  3PMZ A;  5TVC A;  3ZDG A;  4TWH A;  2XYS A;  5HCM A;  4ZJS A;  5HEJ A;  5J5H A;  4QAB A;  5BRX A;  5KE4 A;  3EHZ A;  4WV9 A;  4HFB A;  4QH4 A;  4ZZC A;  3SIO A;  3IGQ A;  3RQW A;  4DBM A;  2BYQ A;  4HFI A;  2YN6 A;  2XQ8 A;  3LSV A;  5AFN A;  4A97 A;  3EI0 A;  2QC1 B;  4ZK1 A;  5J5I A;  4TWD A;  3WTN A;  2YOE A;  3WTJ A;  2BJ0 A;  4Z90 A;  4UY2 A;  3WTM A;  2ZJU A;  4TNW A;  4XHE A;  3TLV A;  2BG9 A;  4LMJ A;  4UM3 A;  2XZ6 A;  5AFJ A;  3JAD A;  3ZKR A;  4NZB A;  4ZZB A;  2WNC A;  5AFH A;  3TLU A;  3UU4 A;  4HFD A;  3TLT A;  4NPP A;  4XK9 A;  2XQ9 A;  4AFT A;  2W8F A;  4F8H A;  4COF A;  5L4E A;  4D01 A;  4AFH A;  4LMK A;  2BG9 B;  3SQ9 A;  4UM3 S;  4BFQ A;  2PH9 A;  1UV6 A;  3WTI A;  3SH1 A;  5IUX A;  4HFE A;  2X00 D;  2WNL A;  3U8L A;  2XYT A;  5AIN A;  3RIF A;  4BQT A;  4ILC A;  5HEH A;  3U8N A;  3UQ4 A;  2WZY A;  4UXU A;  4IRE A;  3RQU A;  3GUA A;  5HEU A;  3U8J A;  3RIA A;  4B5D A;  3U8M A;  4HFC A;  2ZJV A;  3EAM A;  2WN9 A;  5SYO A;  2XNV A;  3C84 A;  3TLS A;  3UU5 A;  3WIP A;  2BYN A;  2WNJ A;  4LML A;  4ALX A;  2C9T A;  2Y58 A;  3JAE A;  4QAC A;  2XQ5 A;  5J0Z A;  3UU8 A;  2XNT A;  4ZJT A;  2PGZ A;  3WTK A;  2XZ5 A;  2Y56 A;  2XQ6 A;  3WTO A;  4QAA A;  5FJV A;  5HEO A;  3P4W A;  3WTL A;  4HFH A;  3RI5 A;  3JAF A;  2VL0 A;  3T4M A;  2Y7Y A;  5AFM B;  2Y54 A;  4Z91 A;  4ZK4 A;  3TLW A;  2BYS A;  2BG9 C;  3UQ7 A;  3SQ6 A;  3UU3 A;  5CFB A;  2XNU A;  1UX2 A;  2W8G A;  4QH5 A;  2XQ4 A;  2BR7 A;  5J5F A;  5AFK A;  4AFG A;  4ILA A;  4PIR A;  2XQA A;  4ZR6 A;  5BP0 A;  4HQP A;  3PEO A;  3WTH A;  2X00 A;  4TNV A;  2BYP A;  5AFM A;  5BW2 A;  5HCJ A;  5L4H A;  2Y57 A;  4A98 A;  3U8K A;  2BR8 A;  5AFL A; 
#chains in the Genus database with same CATH topology
 2UZ6 A;  2XQ7 A;  5CO5 A;  3RHW A;  2YME A;  1I9B A;  3P50 A;  4TWF A;  4QH1 A;  5LG3 A;  3UU6 A;  5J5G A;  4EZ1 A;  4X5T A;  2BYR A;  4UM3 P;  3UUB A;  5KZU A;  2BG9 E;  4ILB A;  4UM1 A;  4FRR A;  4ZRU A;  3ZDH A;  2YMD A;  5HEG A;  5JME A;  2XQ3 A;  3C79 A;  4IL9 A;  4IL4 A;  5L47 A;  5LXB A;  2YKS A;  1UW6 A;  3PMZ A;  5TVC A;  3ZDG A;  4TWH A;  2XYS A;  5HCM A;  4ZJS A;  5HEJ A;  5J5H A;  4QAB A;  5BRX A;  5KE4 A;  3EHZ A;  4WV9 A;  4HFB A;  4QH4 A;  4ZZC A;  3SIO A;  3IGQ A;  3RQW A;  4DBM A;  2BYQ A;  4HFI A;  2YN6 A;  2XQ8 A;  3LSV A;  5AFN A;  4A97 A;  3EI0 A;  2QC1 B;  4ZK1 A;  5J5I A;  4TWD A;  3WTN A;  2YOE A;  3WTJ A;  2BJ0 A;  4Z90 A;  4UY2 A;  3WTM A;  2ZJU A;  4TNW A;  4XHE A;  3TLV A;  2BG9 A;  4LMJ A;  4UM3 A;  2XZ6 A;  5AFJ A;  3JAD A;  3ZKR A;  4NZB A;  4ZZB A;  2WNC A;  5AFH A;  3TLU A;  3UU4 A;  4HFD A;  3TLT A;  4NPP A;  4XK9 A;  2XQ9 A;  4AFT A;  2W8F A;  4F8H A;  4COF A;  5L4E A;  4D01 A;  4AFH A;  4LMK A;  2BG9 B;  3SQ9 A;  4UM3 S;  4BFQ A;  2PH9 A;  1UV6 A;  3WTI A;  3SH1 A;  5IUX A;  4HFE A;  2X00 D;  2WNL A;  3U8L A;  2XYT A;  5AIN A;  3RIF A;  4BQT A;  4ILC A;  5HEH A;  3U8N A;  3UQ4 A;  2WZY A;  4UXU A;  4IRE A;  3RQU A;  3GUA A;  5HEU A;  3U8J A;  3RIA A;  4B5D A;  3U8M A;  4HFC A;  2ZJV A;  3EAM A;  2WN9 A;  5SYO A;  2XNV A;  3C84 A;  3TLS A;  3UU5 A;  3WIP A;  2BYN A;  2WNJ A;  4LML A;  4ALX A;  2C9T A;  2Y58 A;  3JAE A;  4QAC A;  2XQ5 A;  5J0Z A;  3UU8 A;  2XNT A;  4ZJT A;  2PGZ A;  3WTK A;  2XZ5 A;  2Y56 A;  2XQ6 A;  3WTO A;  4QAA A;  5FJV A;  5HEO A;  3P4W A;  3WTL A;  4HFH A;  3RI5 A;  3JAF A;  2VL0 A;  3T4M A;  2Y7Y A;  5AFM B;  2Y54 A;  4Z91 A;  4ZK4 A;  3TLW A;  2BYS A;  2BG9 C;  3UQ7 A;  3SQ6 A;  3UU3 A;  5CFB A;  2XNU A;  1UX2 A;  2W8G A;  4QH5 A;  2XQ4 A;  2BR7 A;  5J5F A;  5AFK A;  4AFG A;  4ILA A;  4PIR A;  2XQA A;  4ZR6 A;  5BP0 A;  4HQP A;  3PEO A;  3WTH A;  2X00 A;  4TNV A;  2BYP A;  5AFM A;  5BW2 A;  5HCJ A;  5L4H A;  2Y57 A;  4A98 A;  3U8K A;  2BR8 A;  5AFL A; 
#chains in the Genus database with same CATH homology
 2UZ6 A;  2XQ7 A;  5CO5 A;  3RHW A;  2YME A;  1I9B A;  3P50 A;  4TWF A;  4QH1 A;  5LG3 A;  3UU6 A;  5J5G A;  4EZ1 A;  4X5T A;  2BYR A;  4UM3 P;  3UUB A;  5KZU A;  2BG9 E;  4ILB A;  4UM1 A;  4FRR A;  4ZRU A;  3ZDH A;  2YMD A;  5HEG A;  5JME A;  2XQ3 A;  3C79 A;  4IL9 A;  4IL4 A;  5L47 A;  5LXB A;  2YKS A;  1UW6 A;  3PMZ A;  5TVC A;  3ZDG A;  4TWH A;  2XYS A;  5HCM A;  4ZJS A;  5HEJ A;  5J5H A;  4QAB A;  5BRX A;  5KE4 A;  3EHZ A;  4WV9 A;  4HFB A;  4QH4 A;  4ZZC A;  3SIO A;  3IGQ A;  3RQW A;  4DBM A;  2BYQ A;  4HFI A;  2YN6 A;  2XQ8 A;  3LSV A;  5AFN A;  4A97 A;  3EI0 A;  2QC1 B;  4ZK1 A;  5J5I A;  4TWD A;  3WTN A;  2YOE A;  3WTJ A;  2BJ0 A;  4Z90 A;  4UY2 A;  3WTM A;  2ZJU A;  4TNW A;  4XHE A;  3TLV A;  2BG9 A;  4LMJ A;  4UM3 A;  2XZ6 A;  5AFJ A;  3JAD A;  3ZKR A;  4NZB A;  4ZZB A;  2WNC A;  5AFH A;  3TLU A;  3UU4 A;  4HFD A;  3TLT A;  4NPP A;  4XK9 A;  2XQ9 A;  4AFT A;  2W8F A;  4F8H A;  4COF A;  5L4E A;  4D01 A;  4AFH A;  4LMK A;  2BG9 B;  3SQ9 A;  4UM3 S;  4BFQ A;  2PH9 A;  1UV6 A;  3WTI A;  3SH1 A;  5IUX A;  4HFE A;  2X00 D;  2WNL A;  3U8L A;  2XYT A;  5AIN A;  3RIF A;  4BQT A;  4ILC A;  5HEH A;  3U8N A;  3UQ4 A;  2WZY A;  4UXU A;  4IRE A;  3RQU A;  3GUA A;  5HEU A;  3U8J A;  3RIA A;  4B5D A;  3U8M A;  4HFC A;  2ZJV A;  3EAM A;  2WN9 A;  5SYO A;  2XNV A;  3C84 A;  3TLS A;  3UU5 A;  3WIP A;  2BYN A;  2WNJ A;  4LML A;  4ALX A;  2C9T A;  2Y58 A;  3JAE A;  4QAC A;  2XQ5 A;  5J0Z A;  3UU8 A;  2XNT A;  4ZJT A;  2PGZ A;  3WTK A;  2XZ5 A;  2Y56 A;  2XQ6 A;  3WTO A;  4QAA A;  5FJV A;  5HEO A;  3P4W A;  3WTL A;  4HFH A;  3RI5 A;  3JAF A;  2VL0 A;  3T4M A;  2Y7Y A;  5AFM B;  2Y54 A;  4Z91 A;  4ZK4 A;  3TLW A;  2BYS A;  2BG9 C;  3UQ7 A;  3SQ6 A;  3UU3 A;  5CFB A;  2XNU A;  1UX2 A;  2W8G A;  4QH5 A;  2XQ4 A;  2BR7 A;  5J5F A;  5AFK A;  4AFG A;  4ILA A;  4PIR A;  2XQA A;  4ZR6 A;  5BP0 A;  4HQP A;  3PEO A;  3WTH A;  2X00 A;  4TNV A;  2BYP A;  5AFM A;  5BW2 A;  5HCJ A;  5L4H A;  2Y57 A;  4A98 A;  3U8K A;  2BR8 A;  5AFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...