4ZK4A

Crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with 7-(5-isopropoxy-pyridin-3-yl)-1-methyl-1,7-diaza-spiro[4.4]nonane
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
215
structure length
211
Chain Sequence
DDDKLHSQANLMRLKSDLFNYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQYKHDIKYNCCEEIYPDVVLVVKFRERRAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine binding protein
molecule keywords soluble acetylcholine receptor, neuronal acetylcholine recep
publication title Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 3 nicotinic acetylcholine receptor in complex with 7-(5-isopropoxy-pyridin-3-yl)-1-methyl-1,7-diaza-spiro[4.4]nonane.
rcsb
source organism Aplysia californica
total genus 48
structure length 211
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4zk4A00
3RQUA 3UQ4A 5L4EA 2YKSA 4HFDA 4HFEA 4ILCA 2Y58A 2BYRA 5KE4A 1I9BA 4HFBA 2UZ6A 3U8MA 5JMEA 4IL4A 4QABA 3WTJA 4ILAA 3TLTA 4B5DA 5HEJA 2XQ6A 4NZBA 4X5TA 4PIRA 3PMZA 3WTOA 3UUBA 4HFCA 2WNJA 4TNVA 4TWHA 2BJ0A 3WTHA 2XNUA 3IGQA 3U8LA 4ALXA 2XZ5A 2Y7YA 2BR8A 4QAAA 3UQ7A 3RI5A 5HEHA 2Y57A 3U8NA 5J5HA 3SH1A 3ZKRA 2X00A 5SYOA 5HEUA 4ZJSA 2ZJUA 4ZZBA 3WIPA 3C79A 4UM3P 4UY2A 2XQ8A 2BG9A 2WZYA 2WN9A 4EZ1A 1UV6A 4TNWA 5J5GA 4WV9A 4A97A 5HCJA 2BYNA 3EI0A 5AFJA 5AINA 2XYSA 3RIAA 4ZR6A 2BYPA 4XK9A 4QH1A 5AFHA 4FRRA 4Z91A 5FJVA 3TLVA 5L47A 5HCMA 2YMEA 2YN6A 3EAMA 3UU3A 3ZDGA 4ZJTA 5J5IA 4HQPA 3WTKA 3JAEA 4UM3A 4F8HA 2Y56A 4BQTA 4DBMA 2XQ3A 3JAFA 4ILBA 5TVCA 5L4HA 2XNVA 4ZK4A 4QACA 3P50A 2ZJVA 2XQ5A 3SQ9A 5LG3A 3RIFA 3TLWA 4UM3S 2WNCA 2XYTA 2Y54A 5AFMB 5AFNA 2XZ6A 4ZRUA 1UX2A 2W8FA 3P4WA 5HEGA 3T4MA 4AFHA 3EHZA 5AFLA 2VL0A 4TWFA 3WTMA 4ZZCA 2XQ9A 5BP0A 4LMKA 3TLSA 4NPPA 2C9TA 3SIOA 4A98A 2PGZA 4D01A 3LSVA 5AFMA 1UW6A 4LMLA 2X00D 2XNTA 2PH9A 4QH5A 3ZDHA 3U8KA 4UM1A 4TWDA 3WTLA 3SQ6A 3C84A 2BG9E 4COFA 2XQ4A 4IREA 4AFGA 3WTNA 4IL9A 3RQWA 5J0ZA 5BW2A 3GUAA 5LXBA 4XHEA 2QC1B 5J5FA 5AFKA 2YMDA 3UU4A 2YOEA 3JADA 2WNLA 2BYQA 3U8JA 2W8GA 4HFHA 5CO5A 3WTIA 3TLUA 3PEOA 4LMJA 2BG9C 4BFQA 4ZK1A 5BRXA 5CFBA 2XQAA 3RHWA 2BG9B 4UXUA 2BR7A 5HEOA 5IUXA 3UU8A 4AFTA 4QH4A 3UU5A 4Z90A 4HFIA 2BYSA 5KZUA 3UU6A 2XQ7A
chains in the Genus database with same CATH superfamily
3RQUA 3UQ4A 5L4EA 2YKSA 4HFDA 4HFEA 4ILCA 2Y58A 2BYRA 5KE4A 1I9BA 4HFBA 2UZ6A 3U8MA 5JMEA 4IL4A 4QABA 3WTJA 4ILAA 3TLTA 4B5DA 5HEJA 2XQ6A 4NZBA 4X5TA 4PIRA 3PMZA 3WTOA 3UUBA 4HFCA 2WNJA 4TNVA 4TWHA 2BJ0A 3WTHA 2XNUA 3IGQA 3U8LA 4ALXA 2XZ5A 2Y7YA 2BR8A 4QAAA 3UQ7A 3RI5A 5HEHA 2Y57A 3U8NA 5J5HA 3SH1A 3ZKRA 2X00A 5SYOA 5HEUA 4ZJSA 2ZJUA 4ZZBA 3WIPA 3C79A 4UM3P 4UY2A 2XQ8A 2BG9A 2WZYA 2WN9A 4EZ1A 1UV6A 4TNWA 5J5GA 4WV9A 4A97A 5HCJA 2BYNA 3EI0A 5AFJA 5AINA 2XYSA 3RIAA 4ZR6A 2BYPA 4XK9A 4QH1A 5AFHA 4FRRA 4Z91A 5FJVA 3TLVA 5L47A 5HCMA 2YMEA 2YN6A 3EAMA 3UU3A 3ZDGA 4ZJTA 5J5IA 4HQPA 3WTKA 3JAEA 4UM3A 4F8HA 2Y56A 4BQTA 4DBMA 2XQ3A 3JAFA 4ILBA 5TVCA 5L4HA 2XNVA 4ZK4A 4QACA 3P50A 2ZJVA 2XQ5A 3SQ9A 5LG3A 3RIFA 3TLWA 4UM3S 2WNCA 2XYTA 2Y54A 5AFMB 5AFNA 2XZ6A 4ZRUA 1UX2A 2W8FA 3P4WA 5HEGA 3T4MA 4AFHA 3EHZA 5AFLA 2VL0A 4TWFA 3WTMA 4ZZCA 2XQ9A 5BP0A 4LMKA 3TLSA 4NPPA 2C9TA 3SIOA 4A98A 2PGZA 4D01A 3LSVA 5AFMA 1UW6A 4LMLA 2X00D 2XNTA 2PH9A 4QH5A 3ZDHA 3U8KA 4UM1A 4TWDA 3WTLA 3SQ6A 3C84A 2BG9E 4COFA 2XQ4A 4IREA 4AFGA 3WTNA 4IL9A 3RQWA 5J0ZA 5BW2A 3GUAA 5LXBA 4XHEA 2QC1B 5J5FA 5AFKA 2YMDA 3UU4A 2YOEA 3JADA 2WNLA 2BYQA 3U8JA 2W8GA 4HFHA 5CO5A 3WTIA 3TLUA 3PEOA 4LMJA 2BG9C 4BFQA 4ZK1A 5BRXA 5CFBA 2XQAA 3RHWA 2BG9B 4UXUA 2BR7A 5HEOA 5IUXA 3UU8A 4AFTA 4QH4A 3UU5A 4Z90A 4HFIA 2BYSA 5KZUA 3UU6A 2XQ7A
chains in the Genus database with same CATH topology
3RQUA 3UQ4A 5L4EA 2YKSA 4HFDA 4HFEA 4ILCA 2Y58A 2BYRA 5KE4A 1I9BA 4HFBA 2UZ6A 3U8MA 5JMEA 4IL4A 4QABA 3WTJA 4ILAA 3TLTA 4B5DA 5HEJA 2XQ6A 4NZBA 4X5TA 4PIRA 3PMZA 3WTOA 3UUBA 4HFCA 2WNJA 4TNVA 4TWHA 2BJ0A 3WTHA 2XNUA 3IGQA 3U8LA 4ALXA 2XZ5A 2Y7YA 2BR8A 4QAAA 3UQ7A 3RI5A 5HEHA 2Y57A 3U8NA 5J5HA 3SH1A 3ZKRA 2X00A 5SYOA 5HEUA 4ZJSA 2ZJUA 4ZZBA 3WIPA 3C79A 4UM3P 4UY2A 2XQ8A 2BG9A 2WZYA 2WN9A 4EZ1A 1UV6A 4TNWA 5J5GA 4WV9A 4A97A 5HCJA 2BYNA 3EI0A 5AFJA 5AINA 2XYSA 3RIAA 4ZR6A 2BYPA 4XK9A 4QH1A 5AFHA 4FRRA 4Z91A 5FJVA 3TLVA 5L47A 5HCMA 2YMEA 2YN6A 3EAMA 3UU3A 3ZDGA 4ZJTA 5J5IA 4HQPA 3WTKA 3JAEA 4UM3A 4F8HA 2Y56A 4BQTA 4DBMA 2XQ3A 3JAFA 4ILBA 5TVCA 5L4HA 2XNVA 4ZK4A 4QACA 3P50A 2ZJVA 2XQ5A 3SQ9A 5LG3A 3RIFA 3TLWA 4UM3S 2WNCA 2XYTA 2Y54A 5AFMB 5AFNA 2XZ6A 4ZRUA 1UX2A 2W8FA 3P4WA 5HEGA 3T4MA 4AFHA 3EHZA 5AFLA 2VL0A 4TWFA 3WTMA 4ZZCA 2XQ9A 5BP0A 4LMKA 3TLSA 4NPPA 2C9TA 3SIOA 4A98A 2PGZA 4D01A 3LSVA 5AFMA 1UW6A 4LMLA 2X00D 2XNTA 2PH9A 4QH5A 3ZDHA 3U8KA 4UM1A 4TWDA 3WTLA 3SQ6A 3C84A 2BG9E 4COFA 2XQ4A 4IREA 4AFGA 3WTNA 4IL9A 3RQWA 5J0ZA 5BW2A 3GUAA 5LXBA 4XHEA 2QC1B 5J5FA 5AFKA 2YMDA 3UU4A 2YOEA 3JADA 2WNLA 2BYQA 3U8JA 2W8GA 4HFHA 5CO5A 3WTIA 3TLUA 3PEOA 4LMJA 2BG9C 4BFQA 4ZK1A 5BRXA 5CFBA 2XQAA 3RHWA 2BG9B 4UXUA 2BR7A 5HEOA 5IUXA 3UU8A 4AFTA 4QH4A 3UU5A 4Z90A 4HFIA 2BYSA 5KZUA 3UU6A 2XQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQU A;  3UQ4 A;  5L4E A;  2YKS A;  4HFD A;  4HFE A;  4ILC A;  2Y58 A;  2BYR A;  5KE4 A;  1I9B A;  4HFB A;  2UZ6 A;  3U8M A;  5JME A;  4IL4 A;  4QAB A;  3WTJ A;  4ILA A;  3TLT A;  4B5D A;  5HEJ A;  2XQ6 A;  4NZB A;  4X5T A;  4PIR A;  3PMZ A;  3WTO A;  3UUB A;  4HFC A;  2WNJ A;  4TNV A;  4TWH A;  2BJ0 A;  3WTH A;  2XNU A;  3IGQ A;  3U8L A;  4ALX A;  2XZ5 A;  2Y7Y A;  2BR8 A;  4QAA A;  3UQ7 A;  3RI5 A;  5HEH A;  2Y57 A;  3U8N A;  5J5H A;  3SH1 A;  3ZKR A;  2X00 A;  5SYO A;  5HEU A;  4ZJS A;  2ZJU A;  4ZZB A;  3WIP A;  3C79 A;  4UM3 P;  4UY2 A;  2XQ8 A;  2BG9 A;  2WZY A;  2WN9 A;  4EZ1 A;  1UV6 A;  4TNW A;  5J5G A;  4WV9 A;  4A97 A;  5HCJ A;  2BYN A;  3EI0 A;  5AFJ A;  5AIN A;  2XYS A;  3RIA A;  4ZR6 A;  2BYP A;  4XK9 A;  4QH1 A;  5AFH A;  4FRR A;  4Z91 A;  5FJV A;  3TLV A;  5L47 A;  5HCM A;  2YME A;  2YN6 A;  3EAM A;  3UU3 A;  3ZDG A;  4ZJT A;  5J5I A;  4HQP A;  3WTK A;  3JAE A;  4UM3 A;  4F8H A;  2Y56 A;  4BQT A;  4DBM A;  2XQ3 A;  3JAF A;  4ILB A;  5TVC A;  5L4H A;  2XNV A;  4ZK4 A;  4QAC A;  3P50 A;  2ZJV A;  2XQ5 A;  3SQ9 A;  5LG3 A;  3RIF A;  3TLW A;  4UM3 S;  2WNC A;  2XYT A;  2Y54 A;  5AFM B;  5AFN A;  2XZ6 A;  4ZRU A;  1UX2 A;  2W8F A;  3P4W A;  5HEG A;  3T4M A;  4AFH A;  3EHZ A;  5AFL A;  2VL0 A;  4TWF A;  3WTM A;  4ZZC A;  2XQ9 A;  5BP0 A;  4LMK A;  3TLS A;  4NPP A;  2C9T A;  3SIO A;  4A98 A;  2PGZ A;  4D01 A;  3LSV A;  5AFM A;  1UW6 A;  4LML A;  2X00 D;  2XNT A;  2PH9 A;  4QH5 A;  3ZDH A;  3U8K A;  4UM1 A;  4TWD A;  3WTL A;  3SQ6 A;  3C84 A;  2BG9 E;  4COF A;  2XQ4 A;  4IRE A;  4AFG A;  3WTN A;  4IL9 A;  3RQW A;  5J0Z A;  5BW2 A;  3GUA A;  5LXB A;  4XHE A;  2QC1 B;  5J5F A;  5AFK A;  2YMD A;  3UU4 A;  2YOE A;  3JAD A;  2WNL A;  2BYQ A;  3U8J A;  2W8G A;  4HFH A;  5CO5 A;  3WTI A;  3TLU A;  3PEO A;  4LMJ A;  2BG9 C;  4BFQ A;  4ZK1 A;  5BRX A;  5CFB A;  2XQA A;  3RHW A;  2BG9 B;  4UXU A;  2BR7 A;  5HEO A;  5IUX A;  3UU8 A;  4AFT A;  4QH4 A;  3UU5 A;  4Z90 A;  4HFI A;  2BYS A;  5KZU A;  3UU6 A;  2XQ7 A; 
#chains in the Genus database with same CATH topology
 3RQU A;  3UQ4 A;  5L4E A;  2YKS A;  4HFD A;  4HFE A;  4ILC A;  2Y58 A;  2BYR A;  5KE4 A;  1I9B A;  4HFB A;  2UZ6 A;  3U8M A;  5JME A;  4IL4 A;  4QAB A;  3WTJ A;  4ILA A;  3TLT A;  4B5D A;  5HEJ A;  2XQ6 A;  4NZB A;  4X5T A;  4PIR A;  3PMZ A;  3WTO A;  3UUB A;  4HFC A;  2WNJ A;  4TNV A;  4TWH A;  2BJ0 A;  3WTH A;  2XNU A;  3IGQ A;  3U8L A;  4ALX A;  2XZ5 A;  2Y7Y A;  2BR8 A;  4QAA A;  3UQ7 A;  3RI5 A;  5HEH A;  2Y57 A;  3U8N A;  5J5H A;  3SH1 A;  3ZKR A;  2X00 A;  5SYO A;  5HEU A;  4ZJS A;  2ZJU A;  4ZZB A;  3WIP A;  3C79 A;  4UM3 P;  4UY2 A;  2XQ8 A;  2BG9 A;  2WZY A;  2WN9 A;  4EZ1 A;  1UV6 A;  4TNW A;  5J5G A;  4WV9 A;  4A97 A;  5HCJ A;  2BYN A;  3EI0 A;  5AFJ A;  5AIN A;  2XYS A;  3RIA A;  4ZR6 A;  2BYP A;  4XK9 A;  4QH1 A;  5AFH A;  4FRR A;  4Z91 A;  5FJV A;  3TLV A;  5L47 A;  5HCM A;  2YME A;  2YN6 A;  3EAM A;  3UU3 A;  3ZDG A;  4ZJT A;  5J5I A;  4HQP A;  3WTK A;  3JAE A;  4UM3 A;  4F8H A;  2Y56 A;  4BQT A;  4DBM A;  2XQ3 A;  3JAF A;  4ILB A;  5TVC A;  5L4H A;  2XNV A;  4ZK4 A;  4QAC A;  3P50 A;  2ZJV A;  2XQ5 A;  3SQ9 A;  5LG3 A;  3RIF A;  3TLW A;  4UM3 S;  2WNC A;  2XYT A;  2Y54 A;  5AFM B;  5AFN A;  2XZ6 A;  4ZRU A;  1UX2 A;  2W8F A;  3P4W A;  5HEG A;  3T4M A;  4AFH A;  3EHZ A;  5AFL A;  2VL0 A;  4TWF A;  3WTM A;  4ZZC A;  2XQ9 A;  5BP0 A;  4LMK A;  3TLS A;  4NPP A;  2C9T A;  3SIO A;  4A98 A;  2PGZ A;  4D01 A;  3LSV A;  5AFM A;  1UW6 A;  4LML A;  2X00 D;  2XNT A;  2PH9 A;  4QH5 A;  3ZDH A;  3U8K A;  4UM1 A;  4TWD A;  3WTL A;  3SQ6 A;  3C84 A;  2BG9 E;  4COF A;  2XQ4 A;  4IRE A;  4AFG A;  3WTN A;  4IL9 A;  3RQW A;  5J0Z A;  5BW2 A;  3GUA A;  5LXB A;  4XHE A;  2QC1 B;  5J5F A;  5AFK A;  2YMD A;  3UU4 A;  2YOE A;  3JAD A;  2WNL A;  2BYQ A;  3U8J A;  2W8G A;  4HFH A;  5CO5 A;  3WTI A;  3TLU A;  3PEO A;  4LMJ A;  2BG9 C;  4BFQ A;  4ZK1 A;  5BRX A;  5CFB A;  2XQA A;  3RHW A;  2BG9 B;  4UXU A;  2BR7 A;  5HEO A;  5IUX A;  3UU8 A;  4AFT A;  4QH4 A;  3UU5 A;  4Z90 A;  4HFI A;  2BYS A;  5KZU A;  3UU6 A;  2XQ7 A; 
#chains in the Genus database with same CATH homology
 3RQU A;  3UQ4 A;  5L4E A;  2YKS A;  4HFD A;  4HFE A;  4ILC A;  2Y58 A;  2BYR A;  5KE4 A;  1I9B A;  4HFB A;  2UZ6 A;  3U8M A;  5JME A;  4IL4 A;  4QAB A;  3WTJ A;  4ILA A;  3TLT A;  4B5D A;  5HEJ A;  2XQ6 A;  4NZB A;  4X5T A;  4PIR A;  3PMZ A;  3WTO A;  3UUB A;  4HFC A;  2WNJ A;  4TNV A;  4TWH A;  2BJ0 A;  3WTH A;  2XNU A;  3IGQ A;  3U8L A;  4ALX A;  2XZ5 A;  2Y7Y A;  2BR8 A;  4QAA A;  3UQ7 A;  3RI5 A;  5HEH A;  2Y57 A;  3U8N A;  5J5H A;  3SH1 A;  3ZKR A;  2X00 A;  5SYO A;  5HEU A;  4ZJS A;  2ZJU A;  4ZZB A;  3WIP A;  3C79 A;  4UM3 P;  4UY2 A;  2XQ8 A;  2BG9 A;  2WZY A;  2WN9 A;  4EZ1 A;  1UV6 A;  4TNW A;  5J5G A;  4WV9 A;  4A97 A;  5HCJ A;  2BYN A;  3EI0 A;  5AFJ A;  5AIN A;  2XYS A;  3RIA A;  4ZR6 A;  2BYP A;  4XK9 A;  4QH1 A;  5AFH A;  4FRR A;  4Z91 A;  5FJV A;  3TLV A;  5L47 A;  5HCM A;  2YME A;  2YN6 A;  3EAM A;  3UU3 A;  3ZDG A;  4ZJT A;  5J5I A;  4HQP A;  3WTK A;  3JAE A;  4UM3 A;  4F8H A;  2Y56 A;  4BQT A;  4DBM A;  2XQ3 A;  3JAF A;  4ILB A;  5TVC A;  5L4H A;  2XNV A;  4ZK4 A;  4QAC A;  3P50 A;  2ZJV A;  2XQ5 A;  3SQ9 A;  5LG3 A;  3RIF A;  3TLW A;  4UM3 S;  2WNC A;  2XYT A;  2Y54 A;  5AFM B;  5AFN A;  2XZ6 A;  4ZRU A;  1UX2 A;  2W8F A;  3P4W A;  5HEG A;  3T4M A;  4AFH A;  3EHZ A;  5AFL A;  2VL0 A;  4TWF A;  3WTM A;  4ZZC A;  2XQ9 A;  5BP0 A;  4LMK A;  3TLS A;  4NPP A;  2C9T A;  3SIO A;  4A98 A;  2PGZ A;  4D01 A;  3LSV A;  5AFM A;  1UW6 A;  4LML A;  2X00 D;  2XNT A;  2PH9 A;  4QH5 A;  3ZDH A;  3U8K A;  4UM1 A;  4TWD A;  3WTL A;  3SQ6 A;  3C84 A;  2BG9 E;  4COF A;  2XQ4 A;  4IRE A;  4AFG A;  3WTN A;  4IL9 A;  3RQW A;  5J0Z A;  5BW2 A;  3GUA A;  5LXB A;  4XHE A;  2QC1 B;  5J5F A;  5AFK A;  2YMD A;  3UU4 A;  2YOE A;  3JAD A;  2WNL A;  2BYQ A;  3U8J A;  2W8G A;  4HFH A;  5CO5 A;  3WTI A;  3TLU A;  3PEO A;  4LMJ A;  2BG9 C;  4BFQ A;  4ZK1 A;  5BRX A;  5CFB A;  2XQA A;  3RHW A;  2BG9 B;  4UXU A;  2BR7 A;  5HEO A;  5IUX A;  3UU8 A;  4AFT A;  4QH4 A;  3UU5 A;  4Z90 A;  4HFI A;  2BYS A;  5KZU A;  3UU6 A;  2XQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...