4ZK4A

Crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with 7-(5-isopropoxy-pyridin-3-yl)-1-methyl-1,7-diaza-spiro[4.4]nonane
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
215
structure length
211
Chain Sequence
DDDKLHSQANLMRLKSDLFNYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQYKHDIKYNCCEEIYPDVVLVVKFRERRAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords soluble acetylcholine receptor, neuronal acetylcholine recep
publication title Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 3 nicotinic acetylcholine receptor in complex with 7-(5-isopropoxy-pyridin-3-yl)-1-methyl-1,7-diaza-spiro[4.4]nonane.
rcsb
source organism Aplysia californica
molecule tags Acetylcholine binding protein
total genus 48
structure length 211
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4zk4A00
2WNJA 1UX2A 4LMLA 3PEOA 3WTLA 4AFGA 3SQ6A 5AINA 5HEUA 2BG9A 2Y58A 5AFKA 3P4WA 3RHWA 4TWHA 4UM3A 3T4MA 5L4EA 5HCJA 4ALXA 4BQTA 3PMZA 4ZZBA 3JAEA 2ZJUA 4BFQA 2BG9B 4Z91A 5HEHA 3EAMA 4ZK4A 2WNLA 4COFA 5AFMA 4WV9A 4DBMA 4QH4A 4TWDA 3C84A 2XZ6A 5IUXA 2XZ5A 4IL9A 5J0ZA 3SH1A 2XNTA 2BYSA 5AFMB 4ILAA 3GUAA 4FRRA 3ZDGA 2BYPA 4ZJSA 1UV6A 2Y56A 3P50A 2XNUA 4TWFA 4ZK1A 5KZUA 4B5DA 4ZJTA 2BYNA 5CO5A 3U8NA 5J5FA 2BR7A 2XQ9A 2C9TA 3IGQA 4IL4A 4TNVA 4ZRUA 3WTIA 2XQ3A 4QH5A 3U8KA 5J5IA 5JMEA 3WTHA 2Y57A 3C79A 2XYTA 4LMKA 3JADA 5LG3A 3UU4A 4ILCA 4D01A 3EI0A 2VL0A 4PIRA 3UU3A 4EZ1A 3JAFA 2Y54A 4ZZCA 5AFNA 4XHEA 5AFHA 4QH1A 4A97A 3ZDHA 2YMEA 3SQ9A 3TLUA 1I9BA 2YOEA 3LSVA 3WTMA 5HEGA 3RQWA 2XYSA 2X00A 4ZR6A 3TLWA 2XQAA 5J5HA 4NPPA 4UM3P 4UXUA 1UW6A 2XQ8A 5J5GA 3EHZA 4HFIA 5SYOA 3RQUA 5KE4A 2WNCA 2WN9A 4LMJA 2QC1B 4IREA 3RI5A 3RIAA 5BW2A 2ZJVA 3TLTA 4HFBA 2XQ5A 4QACA 2YKSA 4A98A 3UQ7A 3SIOA 4XK9A 5TVCA 2UZ6A 2XNVA 3RIFA 2W8GA 4AFHA 3UUBA 3U8LA 2BYQA 3TLSA 2PGZA 4X5TA 3ZKRA 2BYRA 2XQ7A 4ILBA 4HFDA 4TNWA 3UU6A 3UU8A 4QAAA 4F8HA 3U8JA 5HCMA 5LXBA 3UQ4A 3WTJA 5AFJA 2YN6A 4UM3S 3WTNA 5AFLA 2BG9E 5HEOA 3WTOA 5HEJA 3WTKA 2BR8A 5L4HA 5L47A 4HFCA 2PH9A 3U8MA 3WIPA 2YMDA 5BP0A 4UM1A 5FJVA 2Y7YA 3UU5A 4HFEA 3TLVA 2WZYA 4UY2A 2BJ0A 2BG9C 4Z90A 4QABA 2W8FA 4NZBA 2XQ6A 5BRXA 2XQ4A 5CFBA 4HQPA 2X00D 4AFTA 4HFHA
chains in the Genus database with same CATH superfamily
2WNJA 1UX2A 4LMLA 3PEOA 3WTLA 4AFGA 3SQ6A 5AINA 5HEUA 2BG9A 2Y58A 5AFKA 3P4WA 3RHWA 4TWHA 4UM3A 3T4MA 5L4EA 5HCJA 4ALXA 4BQTA 3PMZA 4ZZBA 3JAEA 2ZJUA 4BFQA 2BG9B 4Z91A 5HEHA 3EAMA 4ZK4A 2WNLA 4COFA 5AFMA 4WV9A 4DBMA 4QH4A 4TWDA 3C84A 2XZ6A 5IUXA 2XZ5A 4IL9A 5J0ZA 3SH1A 2XNTA 2BYSA 5AFMB 4ILAA 3GUAA 4FRRA 3ZDGA 2BYPA 4ZJSA 1UV6A 2Y56A 3P50A 2XNUA 4TWFA 4ZK1A 5KZUA 4B5DA 4ZJTA 2BYNA 5CO5A 3U8NA 5J5FA 2BR7A 2XQ9A 2C9TA 3IGQA 4IL4A 4TNVA 4ZRUA 3WTIA 2XQ3A 4QH5A 3U8KA 5J5IA 5JMEA 3WTHA 2Y57A 3C79A 2XYTA 4LMKA 3JADA 5LG3A 3UU4A 4ILCA 4D01A 3EI0A 2VL0A 4PIRA 3UU3A 4EZ1A 3JAFA 2Y54A 4ZZCA 5AFNA 4XHEA 5AFHA 4QH1A 4A97A 3ZDHA 2YMEA 3SQ9A 3TLUA 1I9BA 2YOEA 3LSVA 3WTMA 5HEGA 3RQWA 2XYSA 2X00A 4ZR6A 3TLWA 2XQAA 5J5HA 4NPPA 4UM3P 4UXUA 1UW6A 2XQ8A 5J5GA 3EHZA 4HFIA 5SYOA 3RQUA 5KE4A 2WNCA 2WN9A 4LMJA 2QC1B 4IREA 3RI5A 3RIAA 5BW2A 2ZJVA 3TLTA 4HFBA 2XQ5A 4QACA 2YKSA 4A98A 3UQ7A 3SIOA 4XK9A 5TVCA 2UZ6A 2XNVA 3RIFA 2W8GA 4AFHA 3UUBA 3U8LA 2BYQA 3TLSA 2PGZA 4X5TA 3ZKRA 2BYRA 2XQ7A 4ILBA 4HFDA 4TNWA 3UU6A 3UU8A 4QAAA 4F8HA 3U8JA 5HCMA 5LXBA 3UQ4A 3WTJA 5AFJA 2YN6A 4UM3S 3WTNA 5AFLA 2BG9E 5HEOA 3WTOA 5HEJA 3WTKA 2BR8A 5L4HA 5L47A 4HFCA 2PH9A 3U8MA 3WIPA 2YMDA 5BP0A 4UM1A 5FJVA 2Y7YA 3UU5A 4HFEA 3TLVA 2WZYA 4UY2A 2BJ0A 2BG9C 4Z90A 4QABA 2W8FA 4NZBA 2XQ6A 5BRXA 2XQ4A 5CFBA 4HQPA 2X00D 4AFTA 4HFHA
chains in the Genus database with same CATH topology
2WNJA 1UX2A 4LMLA 3PEOA 3WTLA 4AFGA 3SQ6A 5AINA 5HEUA 2BG9A 2Y58A 5AFKA 3P4WA 3RHWA 4TWHA 4UM3A 3T4MA 5L4EA 5HCJA 4ALXA 4BQTA 3PMZA 4ZZBA 3JAEA 2ZJUA 4BFQA 2BG9B 4Z91A 5HEHA 3EAMA 4ZK4A 2WNLA 4COFA 5AFMA 4WV9A 4DBMA 4QH4A 4TWDA 3C84A 2XZ6A 5IUXA 2XZ5A 4IL9A 5J0ZA 3SH1A 2XNTA 2BYSA 5AFMB 4ILAA 3GUAA 4FRRA 3ZDGA 2BYPA 4ZJSA 1UV6A 2Y56A 3P50A 2XNUA 4TWFA 4ZK1A 5KZUA 4B5DA 4ZJTA 2BYNA 5CO5A 3U8NA 5J5FA 2BR7A 2XQ9A 2C9TA 3IGQA 4IL4A 4TNVA 4ZRUA 3WTIA 2XQ3A 4QH5A 3U8KA 5J5IA 5JMEA 3WTHA 2Y57A 3C79A 2XYTA 4LMKA 3JADA 5LG3A 3UU4A 4ILCA 4D01A 3EI0A 2VL0A 4PIRA 3UU3A 4EZ1A 3JAFA 2Y54A 4ZZCA 5AFNA 4XHEA 5AFHA 4QH1A 4A97A 3ZDHA 2YMEA 3SQ9A 3TLUA 1I9BA 2YOEA 3LSVA 3WTMA 5HEGA 3RQWA 2XYSA 2X00A 4ZR6A 3TLWA 2XQAA 5J5HA 4NPPA 4UM3P 4UXUA 1UW6A 2XQ8A 5J5GA 3EHZA 4HFIA 5SYOA 3RQUA 5KE4A 2WNCA 2WN9A 4LMJA 2QC1B 4IREA 3RI5A 3RIAA 5BW2A 2ZJVA 3TLTA 4HFBA 2XQ5A 4QACA 2YKSA 4A98A 3UQ7A 3SIOA 4XK9A 5TVCA 2UZ6A 2XNVA 3RIFA 2W8GA 4AFHA 3UUBA 3U8LA 2BYQA 3TLSA 2PGZA 4X5TA 3ZKRA 2BYRA 2XQ7A 4ILBA 4HFDA 4TNWA 3UU6A 3UU8A 4QAAA 4F8HA 3U8JA 5HCMA 5LXBA 3UQ4A 3WTJA 5AFJA 2YN6A 4UM3S 3WTNA 5AFLA 2BG9E 5HEOA 3WTOA 5HEJA 3WTKA 2BR8A 5L4HA 5L47A 4HFCA 2PH9A 3U8MA 3WIPA 2YMDA 5BP0A 4UM1A 5FJVA 2Y7YA 3UU5A 4HFEA 3TLVA 2WZYA 4UY2A 2BJ0A 2BG9C 4Z90A 4QABA 2W8FA 4NZBA 2XQ6A 5BRXA 2XQ4A 5CFBA 4HQPA 2X00D 4AFTA 4HFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNJ A;  1UX2 A;  4LML A;  3PEO A;  3WTL A;  4AFG A;  3SQ6 A;  5AIN A;  5HEU A;  2BG9 A;  2Y58 A;  5AFK A;  3P4W A;  3RHW A;  4TWH A;  4UM3 A;  3T4M A;  5L4E A;  5HCJ A;  4ALX A;  4BQT A;  3PMZ A;  4ZZB A;  3JAE A;  2ZJU A;  4BFQ A;  2BG9 B;  4Z91 A;  5HEH A;  3EAM A;  4ZK4 A;  2WNL A;  4COF A;  5AFM A;  4WV9 A;  4DBM A;  4QH4 A;  4TWD A;  3C84 A;  2XZ6 A;  5IUX A;  2XZ5 A;  4IL9 A;  5J0Z A;  3SH1 A;  2XNT A;  2BYS A;  5AFM B;  4ILA A;  3GUA A;  4FRR A;  3ZDG A;  2BYP A;  4ZJS A;  1UV6 A;  2Y56 A;  3P50 A;  2XNU A;  4TWF A;  4ZK1 A;  5KZU A;  4B5D A;  4ZJT A;  2BYN A;  5CO5 A;  3U8N A;  5J5F A;  2BR7 A;  2XQ9 A;  2C9T A;  3IGQ A;  4IL4 A;  4TNV A;  4ZRU A;  3WTI A;  2XQ3 A;  4QH5 A;  3U8K A;  5J5I A;  5JME A;  3WTH A;  2Y57 A;  3C79 A;  2XYT A;  4LMK A;  3JAD A;  5LG3 A;  3UU4 A;  4ILC A;  4D01 A;  3EI0 A;  2VL0 A;  4PIR A;  3UU3 A;  4EZ1 A;  3JAF A;  2Y54 A;  4ZZC A;  5AFN A;  4XHE A;  5AFH A;  4QH1 A;  4A97 A;  3ZDH A;  2YME A;  3SQ9 A;  3TLU A;  1I9B A;  2YOE A;  3LSV A;  3WTM A;  5HEG A;  3RQW A;  2XYS A;  2X00 A;  4ZR6 A;  3TLW A;  2XQA A;  5J5H A;  4NPP A;  4UM3 P;  4UXU A;  1UW6 A;  2XQ8 A;  5J5G A;  3EHZ A;  4HFI A;  5SYO A;  3RQU A;  5KE4 A;  2WNC A;  2WN9 A;  4LMJ A;  2QC1 B;  4IRE A;  3RI5 A;  3RIA A;  5BW2 A;  2ZJV A;  3TLT A;  4HFB A;  2XQ5 A;  4QAC A;  2YKS A;  4A98 A;  3UQ7 A;  3SIO A;  4XK9 A;  5TVC A;  2UZ6 A;  2XNV A;  3RIF A;  2W8G A;  4AFH A;  3UUB A;  3U8L A;  2BYQ A;  3TLS A;  2PGZ A;  4X5T A;  3ZKR A;  2BYR A;  2XQ7 A;  4ILB A;  4HFD A;  4TNW A;  3UU6 A;  3UU8 A;  4QAA A;  4F8H A;  3U8J A;  5HCM A;  5LXB A;  3UQ4 A;  3WTJ A;  5AFJ A;  2YN6 A;  4UM3 S;  3WTN A;  5AFL A;  2BG9 E;  5HEO A;  3WTO A;  5HEJ A;  3WTK A;  2BR8 A;  5L4H A;  5L47 A;  4HFC A;  2PH9 A;  3U8M A;  3WIP A;  2YMD A;  5BP0 A;  4UM1 A;  5FJV A;  2Y7Y A;  3UU5 A;  4HFE A;  3TLV A;  2WZY A;  4UY2 A;  2BJ0 A;  2BG9 C;  4Z90 A;  4QAB A;  2W8F A;  4NZB A;  2XQ6 A;  5BRX A;  2XQ4 A;  5CFB A;  4HQP A;  2X00 D;  4AFT A;  4HFH A; 
#chains in the Genus database with same CATH topology
 2WNJ A;  1UX2 A;  4LML A;  3PEO A;  3WTL A;  4AFG A;  3SQ6 A;  5AIN A;  5HEU A;  2BG9 A;  2Y58 A;  5AFK A;  3P4W A;  3RHW A;  4TWH A;  4UM3 A;  3T4M A;  5L4E A;  5HCJ A;  4ALX A;  4BQT A;  3PMZ A;  4ZZB A;  3JAE A;  2ZJU A;  4BFQ A;  2BG9 B;  4Z91 A;  5HEH A;  3EAM A;  4ZK4 A;  2WNL A;  4COF A;  5AFM A;  4WV9 A;  4DBM A;  4QH4 A;  4TWD A;  3C84 A;  2XZ6 A;  5IUX A;  2XZ5 A;  4IL9 A;  5J0Z A;  3SH1 A;  2XNT A;  2BYS A;  5AFM B;  4ILA A;  3GUA A;  4FRR A;  3ZDG A;  2BYP A;  4ZJS A;  1UV6 A;  2Y56 A;  3P50 A;  2XNU A;  4TWF A;  4ZK1 A;  5KZU A;  4B5D A;  4ZJT A;  2BYN A;  5CO5 A;  3U8N A;  5J5F A;  2BR7 A;  2XQ9 A;  2C9T A;  3IGQ A;  4IL4 A;  4TNV A;  4ZRU A;  3WTI A;  2XQ3 A;  4QH5 A;  3U8K A;  5J5I A;  5JME A;  3WTH A;  2Y57 A;  3C79 A;  2XYT A;  4LMK A;  3JAD A;  5LG3 A;  3UU4 A;  4ILC A;  4D01 A;  3EI0 A;  2VL0 A;  4PIR A;  3UU3 A;  4EZ1 A;  3JAF A;  2Y54 A;  4ZZC A;  5AFN A;  4XHE A;  5AFH A;  4QH1 A;  4A97 A;  3ZDH A;  2YME A;  3SQ9 A;  3TLU A;  1I9B A;  2YOE A;  3LSV A;  3WTM A;  5HEG A;  3RQW A;  2XYS A;  2X00 A;  4ZR6 A;  3TLW A;  2XQA A;  5J5H A;  4NPP A;  4UM3 P;  4UXU A;  1UW6 A;  2XQ8 A;  5J5G A;  3EHZ A;  4HFI A;  5SYO A;  3RQU A;  5KE4 A;  2WNC A;  2WN9 A;  4LMJ A;  2QC1 B;  4IRE A;  3RI5 A;  3RIA A;  5BW2 A;  2ZJV A;  3TLT A;  4HFB A;  2XQ5 A;  4QAC A;  2YKS A;  4A98 A;  3UQ7 A;  3SIO A;  4XK9 A;  5TVC A;  2UZ6 A;  2XNV A;  3RIF A;  2W8G A;  4AFH A;  3UUB A;  3U8L A;  2BYQ A;  3TLS A;  2PGZ A;  4X5T A;  3ZKR A;  2BYR A;  2XQ7 A;  4ILB A;  4HFD A;  4TNW A;  3UU6 A;  3UU8 A;  4QAA A;  4F8H A;  3U8J A;  5HCM A;  5LXB A;  3UQ4 A;  3WTJ A;  5AFJ A;  2YN6 A;  4UM3 S;  3WTN A;  5AFL A;  2BG9 E;  5HEO A;  3WTO A;  5HEJ A;  3WTK A;  2BR8 A;  5L4H A;  5L47 A;  4HFC A;  2PH9 A;  3U8M A;  3WIP A;  2YMD A;  5BP0 A;  4UM1 A;  5FJV A;  2Y7Y A;  3UU5 A;  4HFE A;  3TLV A;  2WZY A;  4UY2 A;  2BJ0 A;  2BG9 C;  4Z90 A;  4QAB A;  2W8F A;  4NZB A;  2XQ6 A;  5BRX A;  2XQ4 A;  5CFB A;  4HQP A;  2X00 D;  4AFT A;  4HFH A; 
#chains in the Genus database with same CATH homology
 2WNJ A;  1UX2 A;  4LML A;  3PEO A;  3WTL A;  4AFG A;  3SQ6 A;  5AIN A;  5HEU A;  2BG9 A;  2Y58 A;  5AFK A;  3P4W A;  3RHW A;  4TWH A;  4UM3 A;  3T4M A;  5L4E A;  5HCJ A;  4ALX A;  4BQT A;  3PMZ A;  4ZZB A;  3JAE A;  2ZJU A;  4BFQ A;  2BG9 B;  4Z91 A;  5HEH A;  3EAM A;  4ZK4 A;  2WNL A;  4COF A;  5AFM A;  4WV9 A;  4DBM A;  4QH4 A;  4TWD A;  3C84 A;  2XZ6 A;  5IUX A;  2XZ5 A;  4IL9 A;  5J0Z A;  3SH1 A;  2XNT A;  2BYS A;  5AFM B;  4ILA A;  3GUA A;  4FRR A;  3ZDG A;  2BYP A;  4ZJS A;  1UV6 A;  2Y56 A;  3P50 A;  2XNU A;  4TWF A;  4ZK1 A;  5KZU A;  4B5D A;  4ZJT A;  2BYN A;  5CO5 A;  3U8N A;  5J5F A;  2BR7 A;  2XQ9 A;  2C9T A;  3IGQ A;  4IL4 A;  4TNV A;  4ZRU A;  3WTI A;  2XQ3 A;  4QH5 A;  3U8K A;  5J5I A;  5JME A;  3WTH A;  2Y57 A;  3C79 A;  2XYT A;  4LMK A;  3JAD A;  5LG3 A;  3UU4 A;  4ILC A;  4D01 A;  3EI0 A;  2VL0 A;  4PIR A;  3UU3 A;  4EZ1 A;  3JAF A;  2Y54 A;  4ZZC A;  5AFN A;  4XHE A;  5AFH A;  4QH1 A;  4A97 A;  3ZDH A;  2YME A;  3SQ9 A;  3TLU A;  1I9B A;  2YOE A;  3LSV A;  3WTM A;  5HEG A;  3RQW A;  2XYS A;  2X00 A;  4ZR6 A;  3TLW A;  2XQA A;  5J5H A;  4NPP A;  4UM3 P;  4UXU A;  1UW6 A;  2XQ8 A;  5J5G A;  3EHZ A;  4HFI A;  5SYO A;  3RQU A;  5KE4 A;  2WNC A;  2WN9 A;  4LMJ A;  2QC1 B;  4IRE A;  3RI5 A;  3RIA A;  5BW2 A;  2ZJV A;  3TLT A;  4HFB A;  2XQ5 A;  4QAC A;  2YKS A;  4A98 A;  3UQ7 A;  3SIO A;  4XK9 A;  5TVC A;  2UZ6 A;  2XNV A;  3RIF A;  2W8G A;  4AFH A;  3UUB A;  3U8L A;  2BYQ A;  3TLS A;  2PGZ A;  4X5T A;  3ZKR A;  2BYR A;  2XQ7 A;  4ILB A;  4HFD A;  4TNW A;  3UU6 A;  3UU8 A;  4QAA A;  4F8H A;  3U8J A;  5HCM A;  5LXB A;  3UQ4 A;  3WTJ A;  5AFJ A;  2YN6 A;  4UM3 S;  3WTN A;  5AFL A;  2BG9 E;  5HEO A;  3WTO A;  5HEJ A;  3WTK A;  2BR8 A;  5L4H A;  5L47 A;  4HFC A;  2PH9 A;  3U8M A;  3WIP A;  2YMD A;  5BP0 A;  4UM1 A;  5FJV A;  2Y7Y A;  3UU5 A;  4HFE A;  3TLV A;  2WZY A;  4UY2 A;  2BJ0 A;  2BG9 C;  4Z90 A;  4QAB A;  2W8F A;  4NZB A;  2XQ6 A;  5BRX A;  2XQ4 A;  5CFB A;  4HQP A;  2X00 D;  4AFT A;  4HFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...