4NZBA

Ns9283 bound to ls-achbp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
204
structure length
198
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Structural and Functional Studies of the Modulator NS9283 Reveal Agonist-Like Mechanism of Action at alpha4beta2 Nicotinic Acetylcholine Receptors
doi rcsb
molecule tags Acetylcholine-binding protein
total genus 47
structure length 198
sequence length 204
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O
ec nomenclature
pdb deposition date 2013-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4nzbA00
1UW6A 2XQ6A 2Y58A 5AFMA 5HCJA 3WTLA 1UX2A 1UV6A 3ZDHA 3P4WA 4TWDA 4UXUA 4AFHA 2Y57A 3RI5A 3WTIA 5HEOA 5CFBA 2BR7A 2XYSA 2XZ5A 3SQ9A 4PIRA 2PH9A 4HFIA 4QAAA 3WIPA 2BYRA 2PGZA 3IGQA 4UY2A 3UU5A 5CO5A 3EI0A 4HFCA 4HFDA 2BYPA 2BG9E 3U8KA 2YN6A 4D01A 5AFJA 3T4MA 5SYOA 5BP0A 5LXBA 3UQ4A 5J5IA 5AFLA 3UU3A 4ILCA 4FRRA 4LMKA 4ALXA 2XQ5A 4ZR6A 5AINA 4IL9A 5HCMA 4TWFA 3U8LA 2X00D 4LMLA 2WNLA 5J5FA 5AFNA 3RIAA 3TLWA 3JAFA 2ZJUA 4COFA 2W8GA 5J5GA 4TNWA 3TLTA 5HEJA 5AFMB 5L47A 2Y54A 3ZKRA 2XQAA 3SH1A 3U8MA 3LSVA 3C79A 4A97A 5FJVA 3C84A 3JAEA 2BYNA 3U8JA 3PEOA 3PMZA 2BG9B 5HEHA 4AFGA 4BQTA 2C9TA 4ZJTA 4ZK4A 4UM1A 3WTHA 5HEUA 3U8NA 2XZ6A 2XNTA 5KZUA 4DBMA 2Y7YA 2XNVA 2XQ4A 4ILAA 4F8HA 4B5DA 4Z91A 4LMJA 4QH5A 3ZDGA 4AFTA 3RQWA 2WNCA 4X5TA 4UM3S 5J5HA 4HQPA 2QC1B 3WTKA 2BYQA 4HFHA 2WZYA 4Z90A 4ZK1A 3UU6A 3WTMA 4QH1A 4BFQA 4ZRUA 2W8FA 3EAMA 4HFEA 4IL4A 4IREA 4A98A 5L4HA 2BR8A 4XK9A 2WNJA 2XQ7A 2BYSA 3GUAA 4NZBA 4UM3A 3TLVA 3UU8A 4TWHA 4QABA 5AFKA 4ZJSA 5AFHA 2UZ6A 4NPPA 4ZZCA 3SQ6A 5KE4A 2YKSA 5LG3A 5IUXA 2VL0A 4WV9A 4HFBA 2BG9C 3EHZA 3TLSA 2BG9A 3UQ7A 5BW2A 3JADA 3RIFA 2XQ9A 2BJ0A 5L4EA 3UUBA 3UU4A 2X00A 4QH4A 3SIOA 4ZZBA 4QACA 4ILBA 2XQ3A 3WTJA 1I9BA 3WTNA 3RQUA 2XNUA 2Y56A 2ZJVA 4UM3P 4XHEA 5JMEA 3WTOA 3P50A 2YMEA 5J0ZA 2XYTA 4TNVA 5HEGA 3RHWA 2YOEA 5TVCA 3TLUA 5BRXA 4EZ1A 2XQ8A 2YMDA 2WN9A
chains in the Genus database with same CATH superfamily
1UW6A 2XQ6A 2Y58A 5AFMA 5HCJA 3WTLA 1UX2A 1UV6A 3ZDHA 3P4WA 4TWDA 4UXUA 4AFHA 2Y57A 3RI5A 3WTIA 5HEOA 5CFBA 2BR7A 2XYSA 2XZ5A 3SQ9A 4PIRA 2PH9A 4HFIA 4QAAA 3WIPA 2BYRA 2PGZA 3IGQA 4UY2A 3UU5A 5CO5A 3EI0A 4HFCA 4HFDA 2BYPA 2BG9E 3U8KA 2YN6A 4D01A 5AFJA 3T4MA 5SYOA 5BP0A 5LXBA 3UQ4A 5J5IA 5AFLA 3UU3A 4ILCA 4FRRA 4LMKA 4ALXA 2XQ5A 4ZR6A 5AINA 4IL9A 5HCMA 4TWFA 3U8LA 2X00D 4LMLA 2WNLA 5J5FA 5AFNA 3RIAA 3TLWA 3JAFA 2ZJUA 4COFA 2W8GA 5J5GA 4TNWA 3TLTA 5HEJA 5AFMB 5L47A 2Y54A 3ZKRA 2XQAA 3SH1A 3U8MA 3LSVA 3C79A 4A97A 5FJVA 3C84A 3JAEA 2BYNA 3U8JA 3PEOA 3PMZA 2BG9B 5HEHA 4AFGA 4BQTA 2C9TA 4ZJTA 4ZK4A 4UM1A 3WTHA 5HEUA 3U8NA 2XZ6A 2XNTA 5KZUA 4DBMA 2Y7YA 2XNVA 2XQ4A 4ILAA 4F8HA 4B5DA 4Z91A 4LMJA 4QH5A 3ZDGA 4AFTA 3RQWA 2WNCA 4X5TA 4UM3S 5J5HA 4HQPA 2QC1B 3WTKA 2BYQA 4HFHA 2WZYA 4Z90A 4ZK1A 3UU6A 3WTMA 4QH1A 4BFQA 4ZRUA 2W8FA 3EAMA 4HFEA 4IL4A 4IREA 4A98A 5L4HA 2BR8A 4XK9A 2WNJA 2XQ7A 2BYSA 3GUAA 4NZBA 4UM3A 3TLVA 3UU8A 4TWHA 4QABA 5AFKA 4ZJSA 5AFHA 2UZ6A 4NPPA 4ZZCA 3SQ6A 5KE4A 2YKSA 5LG3A 5IUXA 2VL0A 4WV9A 4HFBA 2BG9C 3EHZA 3TLSA 2BG9A 3UQ7A 5BW2A 3JADA 3RIFA 2XQ9A 2BJ0A 5L4EA 3UUBA 3UU4A 2X00A 4QH4A 3SIOA 4ZZBA 4QACA 4ILBA 2XQ3A 3WTJA 1I9BA 3WTNA 3RQUA 2XNUA 2Y56A 2ZJVA 4UM3P 4XHEA 5JMEA 3WTOA 3P50A 2YMEA 5J0ZA 2XYTA 4TNVA 5HEGA 3RHWA 2YOEA 5TVCA 3TLUA 5BRXA 4EZ1A 2XQ8A 2YMDA 2WN9A
chains in the Genus database with same CATH topology
1UW6A 2XQ6A 2Y58A 5AFMA 5HCJA 3WTLA 1UX2A 1UV6A 3ZDHA 3P4WA 4TWDA 4UXUA 4AFHA 2Y57A 3RI5A 3WTIA 5HEOA 5CFBA 2BR7A 2XYSA 2XZ5A 3SQ9A 4PIRA 2PH9A 4HFIA 4QAAA 3WIPA 2BYRA 2PGZA 3IGQA 4UY2A 3UU5A 5CO5A 3EI0A 4HFCA 4HFDA 2BYPA 2BG9E 3U8KA 2YN6A 4D01A 5AFJA 3T4MA 5SYOA 5BP0A 5LXBA 3UQ4A 5J5IA 5AFLA 3UU3A 4ILCA 4FRRA 4LMKA 4ALXA 2XQ5A 4ZR6A 5AINA 4IL9A 5HCMA 4TWFA 3U8LA 2X00D 4LMLA 2WNLA 5J5FA 5AFNA 3RIAA 3TLWA 3JAFA 2ZJUA 4COFA 2W8GA 5J5GA 4TNWA 3TLTA 5HEJA 5AFMB 5L47A 2Y54A 3ZKRA 2XQAA 3SH1A 3U8MA 3LSVA 3C79A 4A97A 5FJVA 3C84A 3JAEA 2BYNA 3U8JA 3PEOA 3PMZA 2BG9B 5HEHA 4AFGA 4BQTA 2C9TA 4ZJTA 4ZK4A 4UM1A 3WTHA 5HEUA 3U8NA 2XZ6A 2XNTA 5KZUA 4DBMA 2Y7YA 2XNVA 2XQ4A 4ILAA 4F8HA 4B5DA 4Z91A 4LMJA 4QH5A 3ZDGA 4AFTA 3RQWA 2WNCA 4X5TA 4UM3S 5J5HA 4HQPA 2QC1B 3WTKA 2BYQA 4HFHA 2WZYA 4Z90A 4ZK1A 3UU6A 3WTMA 4QH1A 4BFQA 4ZRUA 2W8FA 3EAMA 4HFEA 4IL4A 4IREA 4A98A 5L4HA 2BR8A 4XK9A 2WNJA 2XQ7A 2BYSA 3GUAA 4NZBA 4UM3A 3TLVA 3UU8A 4TWHA 4QABA 5AFKA 4ZJSA 5AFHA 2UZ6A 4NPPA 4ZZCA 3SQ6A 5KE4A 2YKSA 5LG3A 5IUXA 2VL0A 4WV9A 4HFBA 2BG9C 3EHZA 3TLSA 2BG9A 3UQ7A 5BW2A 3JADA 3RIFA 2XQ9A 2BJ0A 5L4EA 3UUBA 3UU4A 2X00A 4QH4A 3SIOA 4ZZBA 4QACA 4ILBA 2XQ3A 3WTJA 1I9BA 3WTNA 3RQUA 2XNUA 2Y56A 2ZJVA 4UM3P 4XHEA 5JMEA 3WTOA 3P50A 2YMEA 5J0ZA 2XYTA 4TNVA 5HEGA 3RHWA 2YOEA 5TVCA 3TLUA 5BRXA 4EZ1A 2XQ8A 2YMDA 2WN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UW6 A;  2XQ6 A;  2Y58 A;  5AFM A;  5HCJ A;  3WTL A;  1UX2 A;  1UV6 A;  3ZDH A;  3P4W A;  4TWD A;  4UXU A;  4AFH A;  2Y57 A;  3RI5 A;  3WTI A;  5HEO A;  5CFB A;  2BR7 A;  2XYS A;  2XZ5 A;  3SQ9 A;  4PIR A;  2PH9 A;  4HFI A;  4QAA A;  3WIP A;  2BYR A;  2PGZ A;  3IGQ A;  4UY2 A;  3UU5 A;  5CO5 A;  3EI0 A;  4HFC A;  4HFD A;  2BYP A;  2BG9 E;  3U8K A;  2YN6 A;  4D01 A;  5AFJ A;  3T4M A;  5SYO A;  5BP0 A;  5LXB A;  3UQ4 A;  5J5I A;  5AFL A;  3UU3 A;  4ILC A;  4FRR A;  4LMK A;  4ALX A;  2XQ5 A;  4ZR6 A;  5AIN A;  4IL9 A;  5HCM A;  4TWF A;  3U8L A;  2X00 D;  4LML A;  2WNL A;  5J5F A;  5AFN A;  3RIA A;  3TLW A;  3JAF A;  2ZJU A;  4COF A;  2W8G A;  5J5G A;  4TNW A;  3TLT A;  5HEJ A;  5AFM B;  5L47 A;  2Y54 A;  3ZKR A;  2XQA A;  3SH1 A;  3U8M A;  3LSV A;  3C79 A;  4A97 A;  5FJV A;  3C84 A;  3JAE A;  2BYN A;  3U8J A;  3PEO A;  3PMZ A;  2BG9 B;  5HEH A;  4AFG A;  4BQT A;  2C9T A;  4ZJT A;  4ZK4 A;  4UM1 A;  3WTH A;  5HEU A;  3U8N A;  2XZ6 A;  2XNT A;  5KZU A;  4DBM A;  2Y7Y A;  2XNV A;  2XQ4 A;  4ILA A;  4F8H A;  4B5D A;  4Z91 A;  4LMJ A;  4QH5 A;  3ZDG A;  4AFT A;  3RQW A;  2WNC A;  4X5T A;  4UM3 S;  5J5H A;  4HQP A;  2QC1 B;  3WTK A;  2BYQ A;  4HFH A;  2WZY A;  4Z90 A;  4ZK1 A;  3UU6 A;  3WTM A;  4QH1 A;  4BFQ A;  4ZRU A;  2W8F A;  3EAM A;  4HFE A;  4IL4 A;  4IRE A;  4A98 A;  5L4H A;  2BR8 A;  4XK9 A;  2WNJ A;  2XQ7 A;  2BYS A;  3GUA A;  4NZB A;  4UM3 A;  3TLV A;  3UU8 A;  4TWH A;  4QAB A;  5AFK A;  4ZJS A;  5AFH A;  2UZ6 A;  4NPP A;  4ZZC A;  3SQ6 A;  5KE4 A;  2YKS A;  5LG3 A;  5IUX A;  2VL0 A;  4WV9 A;  4HFB A;  2BG9 C;  3EHZ A;  3TLS A;  2BG9 A;  3UQ7 A;  5BW2 A;  3JAD A;  3RIF A;  2XQ9 A;  2BJ0 A;  5L4E A;  3UUB A;  3UU4 A;  2X00 A;  4QH4 A;  3SIO A;  4ZZB A;  4QAC A;  4ILB A;  2XQ3 A;  3WTJ A;  1I9B A;  3WTN A;  3RQU A;  2XNU A;  2Y56 A;  2ZJV A;  4UM3 P;  4XHE A;  5JME A;  3WTO A;  3P50 A;  2YME A;  5J0Z A;  2XYT A;  4TNV A;  5HEG A;  3RHW A;  2YOE A;  5TVC A;  3TLU A;  5BRX A;  4EZ1 A;  2XQ8 A;  2YMD A;  2WN9 A; 
#chains in the Genus database with same CATH topology
 1UW6 A;  2XQ6 A;  2Y58 A;  5AFM A;  5HCJ A;  3WTL A;  1UX2 A;  1UV6 A;  3ZDH A;  3P4W A;  4TWD A;  4UXU A;  4AFH A;  2Y57 A;  3RI5 A;  3WTI A;  5HEO A;  5CFB A;  2BR7 A;  2XYS A;  2XZ5 A;  3SQ9 A;  4PIR A;  2PH9 A;  4HFI A;  4QAA A;  3WIP A;  2BYR A;  2PGZ A;  3IGQ A;  4UY2 A;  3UU5 A;  5CO5 A;  3EI0 A;  4HFC A;  4HFD A;  2BYP A;  2BG9 E;  3U8K A;  2YN6 A;  4D01 A;  5AFJ A;  3T4M A;  5SYO A;  5BP0 A;  5LXB A;  3UQ4 A;  5J5I A;  5AFL A;  3UU3 A;  4ILC A;  4FRR A;  4LMK A;  4ALX A;  2XQ5 A;  4ZR6 A;  5AIN A;  4IL9 A;  5HCM A;  4TWF A;  3U8L A;  2X00 D;  4LML A;  2WNL A;  5J5F A;  5AFN A;  3RIA A;  3TLW A;  3JAF A;  2ZJU A;  4COF A;  2W8G A;  5J5G A;  4TNW A;  3TLT A;  5HEJ A;  5AFM B;  5L47 A;  2Y54 A;  3ZKR A;  2XQA A;  3SH1 A;  3U8M A;  3LSV A;  3C79 A;  4A97 A;  5FJV A;  3C84 A;  3JAE A;  2BYN A;  3U8J A;  3PEO A;  3PMZ A;  2BG9 B;  5HEH A;  4AFG A;  4BQT A;  2C9T A;  4ZJT A;  4ZK4 A;  4UM1 A;  3WTH A;  5HEU A;  3U8N A;  2XZ6 A;  2XNT A;  5KZU A;  4DBM A;  2Y7Y A;  2XNV A;  2XQ4 A;  4ILA A;  4F8H A;  4B5D A;  4Z91 A;  4LMJ A;  4QH5 A;  3ZDG A;  4AFT A;  3RQW A;  2WNC A;  4X5T A;  4UM3 S;  5J5H A;  4HQP A;  2QC1 B;  3WTK A;  2BYQ A;  4HFH A;  2WZY A;  4Z90 A;  4ZK1 A;  3UU6 A;  3WTM A;  4QH1 A;  4BFQ A;  4ZRU A;  2W8F A;  3EAM A;  4HFE A;  4IL4 A;  4IRE A;  4A98 A;  5L4H A;  2BR8 A;  4XK9 A;  2WNJ A;  2XQ7 A;  2BYS A;  3GUA A;  4NZB A;  4UM3 A;  3TLV A;  3UU8 A;  4TWH A;  4QAB A;  5AFK A;  4ZJS A;  5AFH A;  2UZ6 A;  4NPP A;  4ZZC A;  3SQ6 A;  5KE4 A;  2YKS A;  5LG3 A;  5IUX A;  2VL0 A;  4WV9 A;  4HFB A;  2BG9 C;  3EHZ A;  3TLS A;  2BG9 A;  3UQ7 A;  5BW2 A;  3JAD A;  3RIF A;  2XQ9 A;  2BJ0 A;  5L4E A;  3UUB A;  3UU4 A;  2X00 A;  4QH4 A;  3SIO A;  4ZZB A;  4QAC A;  4ILB A;  2XQ3 A;  3WTJ A;  1I9B A;  3WTN A;  3RQU A;  2XNU A;  2Y56 A;  2ZJV A;  4UM3 P;  4XHE A;  5JME A;  3WTO A;  3P50 A;  2YME A;  5J0Z A;  2XYT A;  4TNV A;  5HEG A;  3RHW A;  2YOE A;  5TVC A;  3TLU A;  5BRX A;  4EZ1 A;  2XQ8 A;  2YMD A;  2WN9 A; 
#chains in the Genus database with same CATH homology
 1UW6 A;  2XQ6 A;  2Y58 A;  5AFM A;  5HCJ A;  3WTL A;  1UX2 A;  1UV6 A;  3ZDH A;  3P4W A;  4TWD A;  4UXU A;  4AFH A;  2Y57 A;  3RI5 A;  3WTI A;  5HEO A;  5CFB A;  2BR7 A;  2XYS A;  2XZ5 A;  3SQ9 A;  4PIR A;  2PH9 A;  4HFI A;  4QAA A;  3WIP A;  2BYR A;  2PGZ A;  3IGQ A;  4UY2 A;  3UU5 A;  5CO5 A;  3EI0 A;  4HFC A;  4HFD A;  2BYP A;  2BG9 E;  3U8K A;  2YN6 A;  4D01 A;  5AFJ A;  3T4M A;  5SYO A;  5BP0 A;  5LXB A;  3UQ4 A;  5J5I A;  5AFL A;  3UU3 A;  4ILC A;  4FRR A;  4LMK A;  4ALX A;  2XQ5 A;  4ZR6 A;  5AIN A;  4IL9 A;  5HCM A;  4TWF A;  3U8L A;  2X00 D;  4LML A;  2WNL A;  5J5F A;  5AFN A;  3RIA A;  3TLW A;  3JAF A;  2ZJU A;  4COF A;  2W8G A;  5J5G A;  4TNW A;  3TLT A;  5HEJ A;  5AFM B;  5L47 A;  2Y54 A;  3ZKR A;  2XQA A;  3SH1 A;  3U8M A;  3LSV A;  3C79 A;  4A97 A;  5FJV A;  3C84 A;  3JAE A;  2BYN A;  3U8J A;  3PEO A;  3PMZ A;  2BG9 B;  5HEH A;  4AFG A;  4BQT A;  2C9T A;  4ZJT A;  4ZK4 A;  4UM1 A;  3WTH A;  5HEU A;  3U8N A;  2XZ6 A;  2XNT A;  5KZU A;  4DBM A;  2Y7Y A;  2XNV A;  2XQ4 A;  4ILA A;  4F8H A;  4B5D A;  4Z91 A;  4LMJ A;  4QH5 A;  3ZDG A;  4AFT A;  3RQW A;  2WNC A;  4X5T A;  4UM3 S;  5J5H A;  4HQP A;  2QC1 B;  3WTK A;  2BYQ A;  4HFH A;  2WZY A;  4Z90 A;  4ZK1 A;  3UU6 A;  3WTM A;  4QH1 A;  4BFQ A;  4ZRU A;  2W8F A;  3EAM A;  4HFE A;  4IL4 A;  4IRE A;  4A98 A;  5L4H A;  2BR8 A;  4XK9 A;  2WNJ A;  2XQ7 A;  2BYS A;  3GUA A;  4NZB A;  4UM3 A;  3TLV A;  3UU8 A;  4TWH A;  4QAB A;  5AFK A;  4ZJS A;  5AFH A;  2UZ6 A;  4NPP A;  4ZZC A;  3SQ6 A;  5KE4 A;  2YKS A;  5LG3 A;  5IUX A;  2VL0 A;  4WV9 A;  4HFB A;  2BG9 C;  3EHZ A;  3TLS A;  2BG9 A;  3UQ7 A;  5BW2 A;  3JAD A;  3RIF A;  2XQ9 A;  2BJ0 A;  5L4E A;  3UUB A;  3UU4 A;  2X00 A;  4QH4 A;  3SIO A;  4ZZB A;  4QAC A;  4ILB A;  2XQ3 A;  3WTJ A;  1I9B A;  3WTN A;  3RQU A;  2XNU A;  2Y56 A;  2ZJV A;  4UM3 P;  4XHE A;  5JME A;  3WTO A;  3P50 A;  2YME A;  5J0Z A;  2XYT A;  4TNV A;  5HEG A;  3RHW A;  2YOE A;  5TVC A;  3TLU A;  5BRX A;  4EZ1 A;  2XQ8 A;  2YMD A;  2WN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...