4NZBA

Ns9283 bound to ls-achbp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
204
structure length
198
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein
molecule keywords Acetylcholine-binding protein
publication title Structural and Functional Studies of the Modulator NS9283 Reveal Agonist-Like Mechanism of Action at alpha4beta2 Nicotinic Acetylcholine Receptors
doi rcsb
total genus 47
structure length 198
sequence length 204
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O
ec nomenclature
pdb deposition date 2013-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4nzbA00
3EHZA 2XZ6A 4TWFA 3EAMA 2PH9A 5LXBA 2WNCA 4ILAA 4QH1A 2BYSA 5AFHA 4UY2A 4QACA 3PEOA 2Y57A 2XYSA 2Y58A 4ILBA 4COFA 4ZZBA 5HEJA 4ZR6A 3ZDHA 4XHEA 3UU8A 2BR8A 4UXUA 4HFEA 3RI5A 4HFDA 4ZZCA 4XK9A 4IREA 3JAEA 2WNJA 3RIAA 4QABA 3TLUA 2BYPA 2ZJUA 3UQ4A 3JADA 5BP0A 1UW6A 3JAFA 5AFNA 3RQWA 5AFLA 4ALXA 2BG9C 2XQ7A 5JMEA 4QH4A 3WTNA 3P50A 5AFMB 5J5IA 2XQ9A 4ILCA 2Y56A 3TLSA 2YMEA 3U8NA 2C9TA 2XQ8A 4ZJSA 2X00D 5J0ZA 2YOEA 3WTIA 4LMJA 2YKSA 2YN6A 3UUBA 4ZJTA 5BRXA 2W8FA 4BQTA 3ZDGA 3T4MA 4BFQA 2BJ0A 4F8HA 4B5DA 3EI0A 4TWHA 3RIFA 5AFMA 4ZK4A 4AFGA 4A98A 3UU5A 2YMDA 4HQPA 5AFKA 4D01A 1I9BA 2XQ3A 3U8LA 5TVCA 5KE4A 2BYQA 3TLWA 3WIPA 4EZ1A 3C79A 4TWDA 4UM3P 1UX2A 2ZJVA 4IL4A 3RHWA 5L4HA 5CFBA 3WTKA 4UM3S 2Y54A 5HEOA 2BG9B 5IUXA 4HFCA 3UU6A 3SIOA 2W8GA 4UM1A 5CO5A 5J5GA 4LMLA 3U8KA 5SYOA 5HEHA 2XQAA 4TNWA 2BYNA 5BW2A 5HEUA 2WNLA 2BR7A 4Z90A 2WN9A 5FJVA 3U8JA 3UU3A 3UU4A 3RQUA 2XNUA 2UZ6A 3WTHA 2XQ4A 2QC1B 5HCMA 4NPPA 2X00A 2BG9A 4HFIA 3TLVA 2Y7YA 4IL9A 3SH1A 2VL0A 5L47A 4DBMA 4A97A 3ZKRA 2XYTA 2PGZA 4FRRA 4UM3A 3WTJA 4WV9A 2XZ5A 5HCJA 5LG3A 2XQ5A 3IGQA 4X5TA 3LSVA 3UQ7A 3SQ9A 4AFHA 4ZK1A 4NZBA 4HFBA 3WTMA 5J5FA 4Z91A 3TLTA 4PIRA 5KZUA 5HEGA 3P4WA 2XNTA 4LMKA 4HFHA 3WTLA 2BG9E 2XNVA 2BYRA 5AFJA 3GUAA 2WZYA 5J5HA 4QH5A 4QAAA 5AINA 3WTOA 3U8MA 2XQ6A 4AFTA 4ZRUA 5L4EA 3C84A 4TNVA 1UV6A 3SQ6A 3PMZA
chains in the Genus database with same CATH superfamily
3EHZA 2XZ6A 4TWFA 3EAMA 2PH9A 5LXBA 2WNCA 4ILAA 4QH1A 2BYSA 5AFHA 4UY2A 4QACA 3PEOA 2Y57A 2XYSA 2Y58A 4ILBA 4COFA 4ZZBA 5HEJA 4ZR6A 3ZDHA 4XHEA 3UU8A 2BR8A 4UXUA 4HFEA 3RI5A 4HFDA 4ZZCA 4XK9A 4IREA 3JAEA 2WNJA 3RIAA 4QABA 3TLUA 2BYPA 2ZJUA 3UQ4A 3JADA 5BP0A 1UW6A 3JAFA 5AFNA 3RQWA 5AFLA 4ALXA 2BG9C 2XQ7A 5JMEA 4QH4A 3WTNA 3P50A 5AFMB 5J5IA 2XQ9A 4ILCA 2Y56A 3TLSA 2YMEA 3U8NA 2C9TA 2XQ8A 4ZJSA 2X00D 5J0ZA 2YOEA 3WTIA 4LMJA 2YKSA 2YN6A 3UUBA 4ZJTA 5BRXA 2W8FA 4BQTA 3ZDGA 3T4MA 4BFQA 2BJ0A 4F8HA 4B5DA 3EI0A 4TWHA 3RIFA 5AFMA 4ZK4A 4AFGA 4A98A 3UU5A 2YMDA 4HQPA 5AFKA 4D01A 1I9BA 2XQ3A 3U8LA 5TVCA 5KE4A 2BYQA 3TLWA 3WIPA 4EZ1A 3C79A 4TWDA 4UM3P 1UX2A 2ZJVA 4IL4A 3RHWA 5L4HA 5CFBA 3WTKA 4UM3S 2Y54A 5HEOA 2BG9B 5IUXA 4HFCA 3UU6A 3SIOA 2W8GA 4UM1A 5CO5A 5J5GA 4LMLA 3U8KA 5SYOA 5HEHA 2XQAA 4TNWA 2BYNA 5BW2A 5HEUA 2WNLA 2BR7A 4Z90A 2WN9A 5FJVA 3U8JA 3UU3A 3UU4A 3RQUA 2XNUA 2UZ6A 3WTHA 2XQ4A 2QC1B 5HCMA 4NPPA 2X00A 2BG9A 4HFIA 3TLVA 2Y7YA 4IL9A 3SH1A 2VL0A 5L47A 4DBMA 4A97A 3ZKRA 2XYTA 2PGZA 4FRRA 4UM3A 3WTJA 4WV9A 2XZ5A 5HCJA 5LG3A 2XQ5A 3IGQA 4X5TA 3LSVA 3UQ7A 3SQ9A 4AFHA 4ZK1A 4NZBA 4HFBA 3WTMA 5J5FA 4Z91A 3TLTA 4PIRA 5KZUA 5HEGA 3P4WA 2XNTA 4LMKA 4HFHA 3WTLA 2BG9E 2XNVA 2BYRA 5AFJA 3GUAA 2WZYA 5J5HA 4QH5A 4QAAA 5AINA 3WTOA 3U8MA 2XQ6A 4AFTA 4ZRUA 5L4EA 3C84A 4TNVA 1UV6A 3SQ6A 3PMZA
chains in the Genus database with same CATH topology
3EHZA 2XZ6A 4TWFA 3EAMA 2PH9A 5LXBA 2WNCA 4ILAA 4QH1A 2BYSA 5AFHA 4UY2A 4QACA 3PEOA 2Y57A 2XYSA 2Y58A 4ILBA 4COFA 4ZZBA 5HEJA 4ZR6A 3ZDHA 4XHEA 3UU8A 2BR8A 4UXUA 4HFEA 3RI5A 4HFDA 4ZZCA 4XK9A 4IREA 3JAEA 2WNJA 3RIAA 4QABA 3TLUA 2BYPA 2ZJUA 3UQ4A 3JADA 5BP0A 1UW6A 3JAFA 5AFNA 3RQWA 5AFLA 4ALXA 2BG9C 2XQ7A 5JMEA 4QH4A 3WTNA 3P50A 5AFMB 5J5IA 2XQ9A 4ILCA 2Y56A 3TLSA 2YMEA 3U8NA 2C9TA 2XQ8A 4ZJSA 2X00D 5J0ZA 2YOEA 3WTIA 4LMJA 2YKSA 2YN6A 3UUBA 4ZJTA 5BRXA 2W8FA 4BQTA 3ZDGA 3T4MA 4BFQA 2BJ0A 4F8HA 4B5DA 3EI0A 4TWHA 3RIFA 5AFMA 4ZK4A 4AFGA 4A98A 3UU5A 2YMDA 4HQPA 5AFKA 4D01A 1I9BA 2XQ3A 3U8LA 5TVCA 5KE4A 2BYQA 3TLWA 3WIPA 4EZ1A 3C79A 4TWDA 4UM3P 1UX2A 2ZJVA 4IL4A 3RHWA 5L4HA 5CFBA 3WTKA 4UM3S 2Y54A 5HEOA 2BG9B 5IUXA 4HFCA 3UU6A 3SIOA 2W8GA 4UM1A 5CO5A 5J5GA 4LMLA 3U8KA 5SYOA 5HEHA 2XQAA 4TNWA 2BYNA 5BW2A 5HEUA 2WNLA 2BR7A 4Z90A 2WN9A 5FJVA 3U8JA 3UU3A 3UU4A 3RQUA 2XNUA 2UZ6A 3WTHA 2XQ4A 2QC1B 5HCMA 4NPPA 2X00A 2BG9A 4HFIA 3TLVA 2Y7YA 4IL9A 3SH1A 2VL0A 5L47A 4DBMA 4A97A 3ZKRA 2XYTA 2PGZA 4FRRA 4UM3A 3WTJA 4WV9A 2XZ5A 5HCJA 5LG3A 2XQ5A 3IGQA 4X5TA 3LSVA 3UQ7A 3SQ9A 4AFHA 4ZK1A 4NZBA 4HFBA 3WTMA 5J5FA 4Z91A 3TLTA 4PIRA 5KZUA 5HEGA 3P4WA 2XNTA 4LMKA 4HFHA 3WTLA 2BG9E 2XNVA 2BYRA 5AFJA 3GUAA 2WZYA 5J5HA 4QH5A 4QAAA 5AINA 3WTOA 3U8MA 2XQ6A 4AFTA 4ZRUA 5L4EA 3C84A 4TNVA 1UV6A 3SQ6A 3PMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHZ A;  2XZ6 A;  4TWF A;  3EAM A;  2PH9 A;  5LXB A;  2WNC A;  4ILA A;  4QH1 A;  2BYS A;  5AFH A;  4UY2 A;  4QAC A;  3PEO A;  2Y57 A;  2XYS A;  2Y58 A;  4ILB A;  4COF A;  4ZZB A;  5HEJ A;  4ZR6 A;  3ZDH A;  4XHE A;  3UU8 A;  2BR8 A;  4UXU A;  4HFE A;  3RI5 A;  4HFD A;  4ZZC A;  4XK9 A;  4IRE A;  3JAE A;  2WNJ A;  3RIA A;  4QAB A;  3TLU A;  2BYP A;  2ZJU A;  3UQ4 A;  3JAD A;  5BP0 A;  1UW6 A;  3JAF A;  5AFN A;  3RQW A;  5AFL A;  4ALX A;  2BG9 C;  2XQ7 A;  5JME A;  4QH4 A;  3WTN A;  3P50 A;  5AFM B;  5J5I A;  2XQ9 A;  4ILC A;  2Y56 A;  3TLS A;  2YME A;  3U8N A;  2C9T A;  2XQ8 A;  4ZJS A;  2X00 D;  5J0Z A;  2YOE A;  3WTI A;  4LMJ A;  2YKS A;  2YN6 A;  3UUB A;  4ZJT A;  5BRX A;  2W8F A;  4BQT A;  3ZDG A;  3T4M A;  4BFQ A;  2BJ0 A;  4F8H A;  4B5D A;  3EI0 A;  4TWH A;  3RIF A;  5AFM A;  4ZK4 A;  4AFG A;  4A98 A;  3UU5 A;  2YMD A;  4HQP A;  5AFK A;  4D01 A;  1I9B A;  2XQ3 A;  3U8L A;  5TVC A;  5KE4 A;  2BYQ A;  3TLW A;  3WIP A;  4EZ1 A;  3C79 A;  4TWD A;  4UM3 P;  1UX2 A;  2ZJV A;  4IL4 A;  3RHW A;  5L4H A;  5CFB A;  3WTK A;  4UM3 S;  2Y54 A;  5HEO A;  2BG9 B;  5IUX A;  4HFC A;  3UU6 A;  3SIO A;  2W8G A;  4UM1 A;  5CO5 A;  5J5G A;  4LML A;  3U8K A;  5SYO A;  5HEH A;  2XQA A;  4TNW A;  2BYN A;  5BW2 A;  5HEU A;  2WNL A;  2BR7 A;  4Z90 A;  2WN9 A;  5FJV A;  3U8J A;  3UU3 A;  3UU4 A;  3RQU A;  2XNU A;  2UZ6 A;  3WTH A;  2XQ4 A;  2QC1 B;  5HCM A;  4NPP A;  2X00 A;  2BG9 A;  4HFI A;  3TLV A;  2Y7Y A;  4IL9 A;  3SH1 A;  2VL0 A;  5L47 A;  4DBM A;  4A97 A;  3ZKR A;  2XYT A;  2PGZ A;  4FRR A;  4UM3 A;  3WTJ A;  4WV9 A;  2XZ5 A;  5HCJ A;  5LG3 A;  2XQ5 A;  3IGQ A;  4X5T A;  3LSV A;  3UQ7 A;  3SQ9 A;  4AFH A;  4ZK1 A;  4NZB A;  4HFB A;  3WTM A;  5J5F A;  4Z91 A;  3TLT A;  4PIR A;  5KZU A;  5HEG A;  3P4W A;  2XNT A;  4LMK A;  4HFH A;  3WTL A;  2BG9 E;  2XNV A;  2BYR A;  5AFJ A;  3GUA A;  2WZY A;  5J5H A;  4QH5 A;  4QAA A;  5AIN A;  3WTO A;  3U8M A;  2XQ6 A;  4AFT A;  4ZRU A;  5L4E A;  3C84 A;  4TNV A;  1UV6 A;  3SQ6 A;  3PMZ A; 
#chains in the Genus database with same CATH topology
 3EHZ A;  2XZ6 A;  4TWF A;  3EAM A;  2PH9 A;  5LXB A;  2WNC A;  4ILA A;  4QH1 A;  2BYS A;  5AFH A;  4UY2 A;  4QAC A;  3PEO A;  2Y57 A;  2XYS A;  2Y58 A;  4ILB A;  4COF A;  4ZZB A;  5HEJ A;  4ZR6 A;  3ZDH A;  4XHE A;  3UU8 A;  2BR8 A;  4UXU A;  4HFE A;  3RI5 A;  4HFD A;  4ZZC A;  4XK9 A;  4IRE A;  3JAE A;  2WNJ A;  3RIA A;  4QAB A;  3TLU A;  2BYP A;  2ZJU A;  3UQ4 A;  3JAD A;  5BP0 A;  1UW6 A;  3JAF A;  5AFN A;  3RQW A;  5AFL A;  4ALX A;  2BG9 C;  2XQ7 A;  5JME A;  4QH4 A;  3WTN A;  3P50 A;  5AFM B;  5J5I A;  2XQ9 A;  4ILC A;  2Y56 A;  3TLS A;  2YME A;  3U8N A;  2C9T A;  2XQ8 A;  4ZJS A;  2X00 D;  5J0Z A;  2YOE A;  3WTI A;  4LMJ A;  2YKS A;  2YN6 A;  3UUB A;  4ZJT A;  5BRX A;  2W8F A;  4BQT A;  3ZDG A;  3T4M A;  4BFQ A;  2BJ0 A;  4F8H A;  4B5D A;  3EI0 A;  4TWH A;  3RIF A;  5AFM A;  4ZK4 A;  4AFG A;  4A98 A;  3UU5 A;  2YMD A;  4HQP A;  5AFK A;  4D01 A;  1I9B A;  2XQ3 A;  3U8L A;  5TVC A;  5KE4 A;  2BYQ A;  3TLW A;  3WIP A;  4EZ1 A;  3C79 A;  4TWD A;  4UM3 P;  1UX2 A;  2ZJV A;  4IL4 A;  3RHW A;  5L4H A;  5CFB A;  3WTK A;  4UM3 S;  2Y54 A;  5HEO A;  2BG9 B;  5IUX A;  4HFC A;  3UU6 A;  3SIO A;  2W8G A;  4UM1 A;  5CO5 A;  5J5G A;  4LML A;  3U8K A;  5SYO A;  5HEH A;  2XQA A;  4TNW A;  2BYN A;  5BW2 A;  5HEU A;  2WNL A;  2BR7 A;  4Z90 A;  2WN9 A;  5FJV A;  3U8J A;  3UU3 A;  3UU4 A;  3RQU A;  2XNU A;  2UZ6 A;  3WTH A;  2XQ4 A;  2QC1 B;  5HCM A;  4NPP A;  2X00 A;  2BG9 A;  4HFI A;  3TLV A;  2Y7Y A;  4IL9 A;  3SH1 A;  2VL0 A;  5L47 A;  4DBM A;  4A97 A;  3ZKR A;  2XYT A;  2PGZ A;  4FRR A;  4UM3 A;  3WTJ A;  4WV9 A;  2XZ5 A;  5HCJ A;  5LG3 A;  2XQ5 A;  3IGQ A;  4X5T A;  3LSV A;  3UQ7 A;  3SQ9 A;  4AFH A;  4ZK1 A;  4NZB A;  4HFB A;  3WTM A;  5J5F A;  4Z91 A;  3TLT A;  4PIR A;  5KZU A;  5HEG A;  3P4W A;  2XNT A;  4LMK A;  4HFH A;  3WTL A;  2BG9 E;  2XNV A;  2BYR A;  5AFJ A;  3GUA A;  2WZY A;  5J5H A;  4QH5 A;  4QAA A;  5AIN A;  3WTO A;  3U8M A;  2XQ6 A;  4AFT A;  4ZRU A;  5L4E A;  3C84 A;  4TNV A;  1UV6 A;  3SQ6 A;  3PMZ A; 
#chains in the Genus database with same CATH homology
 3EHZ A;  2XZ6 A;  4TWF A;  3EAM A;  2PH9 A;  5LXB A;  2WNC A;  4ILA A;  4QH1 A;  2BYS A;  5AFH A;  4UY2 A;  4QAC A;  3PEO A;  2Y57 A;  2XYS A;  2Y58 A;  4ILB A;  4COF A;  4ZZB A;  5HEJ A;  4ZR6 A;  3ZDH A;  4XHE A;  3UU8 A;  2BR8 A;  4UXU A;  4HFE A;  3RI5 A;  4HFD A;  4ZZC A;  4XK9 A;  4IRE A;  3JAE A;  2WNJ A;  3RIA A;  4QAB A;  3TLU A;  2BYP A;  2ZJU A;  3UQ4 A;  3JAD A;  5BP0 A;  1UW6 A;  3JAF A;  5AFN A;  3RQW A;  5AFL A;  4ALX A;  2BG9 C;  2XQ7 A;  5JME A;  4QH4 A;  3WTN A;  3P50 A;  5AFM B;  5J5I A;  2XQ9 A;  4ILC A;  2Y56 A;  3TLS A;  2YME A;  3U8N A;  2C9T A;  2XQ8 A;  4ZJS A;  2X00 D;  5J0Z A;  2YOE A;  3WTI A;  4LMJ A;  2YKS A;  2YN6 A;  3UUB A;  4ZJT A;  5BRX A;  2W8F A;  4BQT A;  3ZDG A;  3T4M A;  4BFQ A;  2BJ0 A;  4F8H A;  4B5D A;  3EI0 A;  4TWH A;  3RIF A;  5AFM A;  4ZK4 A;  4AFG A;  4A98 A;  3UU5 A;  2YMD A;  4HQP A;  5AFK A;  4D01 A;  1I9B A;  2XQ3 A;  3U8L A;  5TVC A;  5KE4 A;  2BYQ A;  3TLW A;  3WIP A;  4EZ1 A;  3C79 A;  4TWD A;  4UM3 P;  1UX2 A;  2ZJV A;  4IL4 A;  3RHW A;  5L4H A;  5CFB A;  3WTK A;  4UM3 S;  2Y54 A;  5HEO A;  2BG9 B;  5IUX A;  4HFC A;  3UU6 A;  3SIO A;  2W8G A;  4UM1 A;  5CO5 A;  5J5G A;  4LML A;  3U8K A;  5SYO A;  5HEH A;  2XQA A;  4TNW A;  2BYN A;  5BW2 A;  5HEU A;  2WNL A;  2BR7 A;  4Z90 A;  2WN9 A;  5FJV A;  3U8J A;  3UU3 A;  3UU4 A;  3RQU A;  2XNU A;  2UZ6 A;  3WTH A;  2XQ4 A;  2QC1 B;  5HCM A;  4NPP A;  2X00 A;  2BG9 A;  4HFI A;  3TLV A;  2Y7Y A;  4IL9 A;  3SH1 A;  2VL0 A;  5L47 A;  4DBM A;  4A97 A;  3ZKR A;  2XYT A;  2PGZ A;  4FRR A;  4UM3 A;  3WTJ A;  4WV9 A;  2XZ5 A;  5HCJ A;  5LG3 A;  2XQ5 A;  3IGQ A;  4X5T A;  3LSV A;  3UQ7 A;  3SQ9 A;  4AFH A;  4ZK1 A;  4NZB A;  4HFB A;  3WTM A;  5J5F A;  4Z91 A;  3TLT A;  4PIR A;  5KZU A;  5HEG A;  3P4W A;  2XNT A;  4LMK A;  4HFH A;  3WTL A;  2BG9 E;  2XNV A;  2BYR A;  5AFJ A;  3GUA A;  2WZY A;  5J5H A;  4QH5 A;  4QAA A;  5AIN A;  3WTO A;  3U8M A;  2XQ6 A;  4AFT A;  4ZRU A;  5L4E A;  3C84 A;  4TNV A;  1UV6 A;  3SQ6 A;  3PMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...