2Y56A

Fragment growing induces conformational changes in acetylcholine- binding protein: a structural and thermodynamic analysis - (compound 3)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Fragment Growing Induces Conformational Changes in Acetylcholine-Binding Protein: A Structural and Thermodynamic Analysis.
pubmed doi rcsb
source organism Aplysia californica
total genus 45
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2y56A00
3U8LA 2WN9A 4HFCA 4QH1A 2BG9C 2Y56A 5SYOA 2UZ6A 2BG9B 5AFMA 5AFKA 3RHWA 3WIPA 3U8NA 3ZDHA 4ILCA 5IUXA 1UX2A 4WV9A 5HEJA 4TNWA 4LMKA 2BYPA 2Y54A 2ZJUA 1I9BA 5AFNA 5LG3A 4FRRA 4BFQA 2BR8A 2PH9A 5KZUA 4AFTA 2BYSA 4QACA 4QH4A 4UM3P 2PGZA 3SIOA 5KE4A 3SH1A 1UW6A 4TWDA 5L47A 2BG9E 4UY2A 4LMJA 4IREA 3WTLA 5AFMB 2XQ6A 3SQ9A 4DBMA 2W8FA 2YMEA 5L4EA 3RI5A 4EZ1A 4Z90A 4TWFA 4F8HA 2Y58A 2YN6A 4ALXA 3C84A 3UQ4A 3UU8A 2XZ5A 2BYNA 5HEUA 3EAMA 5BW2A 5J0ZA 4BQTA 3PMZA 3UU3A 2XQAA 2W8GA 4TWHA 2XQ5A 4TNVA 3JAFA 3PEOA 4HFBA 5FJVA 3T4MA 3UU4A 5AFHA 3UUBA 3GUAA 5HCJA 4IL9A 4COFA 5J5HA 2WZYA 3P4WA 5HEHA 3P50A 2XNUA 3EI0A 2XNTA 5JMEA 2XQ8A 5BP0A 4HQPA 3TLVA 5J5FA 5TVCA 3U8KA 3WTMA 3WTJA 3TLSA 3WTKA 4UM3S 2BYRA 5L4HA 3U8JA 4UM3A 4UXUA 2XYTA 3RQWA 3ZKRA 4NZBA 5HEGA 3EHZA 5LXBA 4ZJSA 2WNJA 3SQ6A 2BYQA 3C79A 4ZZBA 2BR7A 2XQ7A 2YMDA 4HFIA 4LMLA 2QC1B 3JAEA 4XK9A 3U8MA 2XNVA 4QH5A 5J5IA 5HEOA 4B5DA 4NPPA 3WTOA 4A97A 1UV6A 4AFHA 4D01A 2XQ3A 2YKSA 4HFHA 4ILBA 3WTNA 4ZZCA 3UQ7A 2C9TA 2ZJVA 3RIAA 5CO5A 3WTIA 3UU6A 2X00A 3LSVA 3ZDGA 5AINA 3TLTA 3RIFA 3TLWA 5CFBA 4Z91A 4ZRUA 4QABA 4ZK1A 2YOEA 4XHEA 4ZR6A 3JADA 4PIRA 3IGQA 4HFEA 4UM1A 4A98A 2WNLA 2XYSA 5J5GA 2XQ4A 5HCMA 2XZ6A 3TLUA 2Y57A 2BJ0A 4IL4A 2XQ9A 4QAAA 3RQUA 2BG9A 3UU5A 4AFGA 4X5TA 2X00D 5AFJA 4HFDA 2VL0A 2Y7YA 4ZJTA 5AFLA 4ILAA 5BRXA 3WTHA 4ZK4A 2WNCA
chains in the Genus database with same CATH superfamily
3U8LA 2WN9A 4HFCA 4QH1A 2BG9C 2Y56A 5SYOA 2UZ6A 2BG9B 5AFMA 5AFKA 3RHWA 3WIPA 3U8NA 3ZDHA 4ILCA 5IUXA 1UX2A 4WV9A 5HEJA 4TNWA 4LMKA 2BYPA 2Y54A 2ZJUA 1I9BA 5AFNA 5LG3A 4FRRA 4BFQA 2BR8A 2PH9A 5KZUA 4AFTA 2BYSA 4QACA 4QH4A 4UM3P 2PGZA 3SIOA 5KE4A 3SH1A 1UW6A 4TWDA 5L47A 2BG9E 4UY2A 4LMJA 4IREA 3WTLA 5AFMB 2XQ6A 3SQ9A 4DBMA 2W8FA 2YMEA 5L4EA 3RI5A 4EZ1A 4Z90A 4TWFA 4F8HA 2Y58A 2YN6A 4ALXA 3C84A 3UQ4A 3UU8A 2XZ5A 2BYNA 5HEUA 3EAMA 5BW2A 5J0ZA 4BQTA 3PMZA 3UU3A 2XQAA 2W8GA 4TWHA 2XQ5A 4TNVA 3JAFA 3PEOA 4HFBA 5FJVA 3T4MA 3UU4A 5AFHA 3UUBA 3GUAA 5HCJA 4IL9A 4COFA 5J5HA 2WZYA 3P4WA 5HEHA 3P50A 2XNUA 3EI0A 2XNTA 5JMEA 2XQ8A 5BP0A 4HQPA 3TLVA 5J5FA 5TVCA 3U8KA 3WTMA 3WTJA 3TLSA 3WTKA 4UM3S 2BYRA 5L4HA 3U8JA 4UM3A 4UXUA 2XYTA 3RQWA 3ZKRA 4NZBA 5HEGA 3EHZA 5LXBA 4ZJSA 2WNJA 3SQ6A 2BYQA 3C79A 4ZZBA 2BR7A 2XQ7A 2YMDA 4HFIA 4LMLA 2QC1B 3JAEA 4XK9A 3U8MA 2XNVA 4QH5A 5J5IA 5HEOA 4B5DA 4NPPA 3WTOA 4A97A 1UV6A 4AFHA 4D01A 2XQ3A 2YKSA 4HFHA 4ILBA 3WTNA 4ZZCA 3UQ7A 2C9TA 2ZJVA 3RIAA 5CO5A 3WTIA 3UU6A 2X00A 3LSVA 3ZDGA 5AINA 3TLTA 3RIFA 3TLWA 5CFBA 4Z91A 4ZRUA 4QABA 4ZK1A 2YOEA 4XHEA 4ZR6A 3JADA 4PIRA 3IGQA 4HFEA 4UM1A 4A98A 2WNLA 2XYSA 5J5GA 2XQ4A 5HCMA 2XZ6A 3TLUA 2Y57A 2BJ0A 4IL4A 2XQ9A 4QAAA 3RQUA 2BG9A 3UU5A 4AFGA 4X5TA 2X00D 5AFJA 4HFDA 2VL0A 2Y7YA 4ZJTA 5AFLA 4ILAA 5BRXA 3WTHA 4ZK4A 2WNCA
chains in the Genus database with same CATH topology
3U8LA 2WN9A 4HFCA 4QH1A 2BG9C 2Y56A 5SYOA 2UZ6A 2BG9B 5AFMA 5AFKA 3RHWA 3WIPA 3U8NA 3ZDHA 4ILCA 5IUXA 1UX2A 4WV9A 5HEJA 4TNWA 4LMKA 2BYPA 2Y54A 2ZJUA 1I9BA 5AFNA 5LG3A 4FRRA 4BFQA 2BR8A 2PH9A 5KZUA 4AFTA 2BYSA 4QACA 4QH4A 4UM3P 2PGZA 3SIOA 5KE4A 3SH1A 1UW6A 4TWDA 5L47A 2BG9E 4UY2A 4LMJA 4IREA 3WTLA 5AFMB 2XQ6A 3SQ9A 4DBMA 2W8FA 2YMEA 5L4EA 3RI5A 4EZ1A 4Z90A 4TWFA 4F8HA 2Y58A 2YN6A 4ALXA 3C84A 3UQ4A 3UU8A 2XZ5A 2BYNA 5HEUA 3EAMA 5BW2A 5J0ZA 4BQTA 3PMZA 3UU3A 2XQAA 2W8GA 4TWHA 2XQ5A 4TNVA 3JAFA 3PEOA 4HFBA 5FJVA 3T4MA 3UU4A 5AFHA 3UUBA 3GUAA 5HCJA 4IL9A 4COFA 5J5HA 2WZYA 3P4WA 5HEHA 3P50A 2XNUA 3EI0A 2XNTA 5JMEA 2XQ8A 5BP0A 4HQPA 3TLVA 5J5FA 5TVCA 3U8KA 3WTMA 3WTJA 3TLSA 3WTKA 4UM3S 2BYRA 5L4HA 3U8JA 4UM3A 4UXUA 2XYTA 3RQWA 3ZKRA 4NZBA 5HEGA 3EHZA 5LXBA 4ZJSA 2WNJA 3SQ6A 2BYQA 3C79A 4ZZBA 2BR7A 2XQ7A 2YMDA 4HFIA 4LMLA 2QC1B 3JAEA 4XK9A 3U8MA 2XNVA 4QH5A 5J5IA 5HEOA 4B5DA 4NPPA 3WTOA 4A97A 1UV6A 4AFHA 4D01A 2XQ3A 2YKSA 4HFHA 4ILBA 3WTNA 4ZZCA 3UQ7A 2C9TA 2ZJVA 3RIAA 5CO5A 3WTIA 3UU6A 2X00A 3LSVA 3ZDGA 5AINA 3TLTA 3RIFA 3TLWA 5CFBA 4Z91A 4ZRUA 4QABA 4ZK1A 2YOEA 4XHEA 4ZR6A 3JADA 4PIRA 3IGQA 4HFEA 4UM1A 4A98A 2WNLA 2XYSA 5J5GA 2XQ4A 5HCMA 2XZ6A 3TLUA 2Y57A 2BJ0A 4IL4A 2XQ9A 4QAAA 3RQUA 2BG9A 3UU5A 4AFGA 4X5TA 2X00D 5AFJA 4HFDA 2VL0A 2Y7YA 4ZJTA 5AFLA 4ILAA 5BRXA 3WTHA 4ZK4A 2WNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8L A;  2WN9 A;  4HFC A;  4QH1 A;  2BG9 C;  2Y56 A;  5SYO A;  2UZ6 A;  2BG9 B;  5AFM A;  5AFK A;  3RHW A;  3WIP A;  3U8N A;  3ZDH A;  4ILC A;  5IUX A;  1UX2 A;  4WV9 A;  5HEJ A;  4TNW A;  4LMK A;  2BYP A;  2Y54 A;  2ZJU A;  1I9B A;  5AFN A;  5LG3 A;  4FRR A;  4BFQ A;  2BR8 A;  2PH9 A;  5KZU A;  4AFT A;  2BYS A;  4QAC A;  4QH4 A;  4UM3 P;  2PGZ A;  3SIO A;  5KE4 A;  3SH1 A;  1UW6 A;  4TWD A;  5L47 A;  2BG9 E;  4UY2 A;  4LMJ A;  4IRE A;  3WTL A;  5AFM B;  2XQ6 A;  3SQ9 A;  4DBM A;  2W8F A;  2YME A;  5L4E A;  3RI5 A;  4EZ1 A;  4Z90 A;  4TWF A;  4F8H A;  2Y58 A;  2YN6 A;  4ALX A;  3C84 A;  3UQ4 A;  3UU8 A;  2XZ5 A;  2BYN A;  5HEU A;  3EAM A;  5BW2 A;  5J0Z A;  4BQT A;  3PMZ A;  3UU3 A;  2XQA A;  2W8G A;  4TWH A;  2XQ5 A;  4TNV A;  3JAF A;  3PEO A;  4HFB A;  5FJV A;  3T4M A;  3UU4 A;  5AFH A;  3UUB A;  3GUA A;  5HCJ A;  4IL9 A;  4COF A;  5J5H A;  2WZY A;  3P4W A;  5HEH A;  3P50 A;  2XNU A;  3EI0 A;  2XNT A;  5JME A;  2XQ8 A;  5BP0 A;  4HQP A;  3TLV A;  5J5F A;  5TVC A;  3U8K A;  3WTM A;  3WTJ A;  3TLS A;  3WTK A;  4UM3 S;  2BYR A;  5L4H A;  3U8J A;  4UM3 A;  4UXU A;  2XYT A;  3RQW A;  3ZKR A;  4NZB A;  5HEG A;  3EHZ A;  5LXB A;  4ZJS A;  2WNJ A;  3SQ6 A;  2BYQ A;  3C79 A;  4ZZB A;  2BR7 A;  2XQ7 A;  2YMD A;  4HFI A;  4LML A;  2QC1 B;  3JAE A;  4XK9 A;  3U8M A;  2XNV A;  4QH5 A;  5J5I A;  5HEO A;  4B5D A;  4NPP A;  3WTO A;  4A97 A;  1UV6 A;  4AFH A;  4D01 A;  2XQ3 A;  2YKS A;  4HFH A;  4ILB A;  3WTN A;  4ZZC A;  3UQ7 A;  2C9T A;  2ZJV A;  3RIA A;  5CO5 A;  3WTI A;  3UU6 A;  2X00 A;  3LSV A;  3ZDG A;  5AIN A;  3TLT A;  3RIF A;  3TLW A;  5CFB A;  4Z91 A;  4ZRU A;  4QAB A;  4ZK1 A;  2YOE A;  4XHE A;  4ZR6 A;  3JAD A;  4PIR A;  3IGQ A;  4HFE A;  4UM1 A;  4A98 A;  2WNL A;  2XYS A;  5J5G A;  2XQ4 A;  5HCM A;  2XZ6 A;  3TLU A;  2Y57 A;  2BJ0 A;  4IL4 A;  2XQ9 A;  4QAA A;  3RQU A;  2BG9 A;  3UU5 A;  4AFG A;  4X5T A;  2X00 D;  5AFJ A;  4HFD A;  2VL0 A;  2Y7Y A;  4ZJT A;  5AFL A;  4ILA A;  5BRX A;  3WTH A;  4ZK4 A;  2WNC A; 
#chains in the Genus database with same CATH topology
 3U8L A;  2WN9 A;  4HFC A;  4QH1 A;  2BG9 C;  2Y56 A;  5SYO A;  2UZ6 A;  2BG9 B;  5AFM A;  5AFK A;  3RHW A;  3WIP A;  3U8N A;  3ZDH A;  4ILC A;  5IUX A;  1UX2 A;  4WV9 A;  5HEJ A;  4TNW A;  4LMK A;  2BYP A;  2Y54 A;  2ZJU A;  1I9B A;  5AFN A;  5LG3 A;  4FRR A;  4BFQ A;  2BR8 A;  2PH9 A;  5KZU A;  4AFT A;  2BYS A;  4QAC A;  4QH4 A;  4UM3 P;  2PGZ A;  3SIO A;  5KE4 A;  3SH1 A;  1UW6 A;  4TWD A;  5L47 A;  2BG9 E;  4UY2 A;  4LMJ A;  4IRE A;  3WTL A;  5AFM B;  2XQ6 A;  3SQ9 A;  4DBM A;  2W8F A;  2YME A;  5L4E A;  3RI5 A;  4EZ1 A;  4Z90 A;  4TWF A;  4F8H A;  2Y58 A;  2YN6 A;  4ALX A;  3C84 A;  3UQ4 A;  3UU8 A;  2XZ5 A;  2BYN A;  5HEU A;  3EAM A;  5BW2 A;  5J0Z A;  4BQT A;  3PMZ A;  3UU3 A;  2XQA A;  2W8G A;  4TWH A;  2XQ5 A;  4TNV A;  3JAF A;  3PEO A;  4HFB A;  5FJV A;  3T4M A;  3UU4 A;  5AFH A;  3UUB A;  3GUA A;  5HCJ A;  4IL9 A;  4COF A;  5J5H A;  2WZY A;  3P4W A;  5HEH A;  3P50 A;  2XNU A;  3EI0 A;  2XNT A;  5JME A;  2XQ8 A;  5BP0 A;  4HQP A;  3TLV A;  5J5F A;  5TVC A;  3U8K A;  3WTM A;  3WTJ A;  3TLS A;  3WTK A;  4UM3 S;  2BYR A;  5L4H A;  3U8J A;  4UM3 A;  4UXU A;  2XYT A;  3RQW A;  3ZKR A;  4NZB A;  5HEG A;  3EHZ A;  5LXB A;  4ZJS A;  2WNJ A;  3SQ6 A;  2BYQ A;  3C79 A;  4ZZB A;  2BR7 A;  2XQ7 A;  2YMD A;  4HFI A;  4LML A;  2QC1 B;  3JAE A;  4XK9 A;  3U8M A;  2XNV A;  4QH5 A;  5J5I A;  5HEO A;  4B5D A;  4NPP A;  3WTO A;  4A97 A;  1UV6 A;  4AFH A;  4D01 A;  2XQ3 A;  2YKS A;  4HFH A;  4ILB A;  3WTN A;  4ZZC A;  3UQ7 A;  2C9T A;  2ZJV A;  3RIA A;  5CO5 A;  3WTI A;  3UU6 A;  2X00 A;  3LSV A;  3ZDG A;  5AIN A;  3TLT A;  3RIF A;  3TLW A;  5CFB A;  4Z91 A;  4ZRU A;  4QAB A;  4ZK1 A;  2YOE A;  4XHE A;  4ZR6 A;  3JAD A;  4PIR A;  3IGQ A;  4HFE A;  4UM1 A;  4A98 A;  2WNL A;  2XYS A;  5J5G A;  2XQ4 A;  5HCM A;  2XZ6 A;  3TLU A;  2Y57 A;  2BJ0 A;  4IL4 A;  2XQ9 A;  4QAA A;  3RQU A;  2BG9 A;  3UU5 A;  4AFG A;  4X5T A;  2X00 D;  5AFJ A;  4HFD A;  2VL0 A;  2Y7Y A;  4ZJT A;  5AFL A;  4ILA A;  5BRX A;  3WTH A;  4ZK4 A;  2WNC A; 
#chains in the Genus database with same CATH homology
 3U8L A;  2WN9 A;  4HFC A;  4QH1 A;  2BG9 C;  2Y56 A;  5SYO A;  2UZ6 A;  2BG9 B;  5AFM A;  5AFK A;  3RHW A;  3WIP A;  3U8N A;  3ZDH A;  4ILC A;  5IUX A;  1UX2 A;  4WV9 A;  5HEJ A;  4TNW A;  4LMK A;  2BYP A;  2Y54 A;  2ZJU A;  1I9B A;  5AFN A;  5LG3 A;  4FRR A;  4BFQ A;  2BR8 A;  2PH9 A;  5KZU A;  4AFT A;  2BYS A;  4QAC A;  4QH4 A;  4UM3 P;  2PGZ A;  3SIO A;  5KE4 A;  3SH1 A;  1UW6 A;  4TWD A;  5L47 A;  2BG9 E;  4UY2 A;  4LMJ A;  4IRE A;  3WTL A;  5AFM B;  2XQ6 A;  3SQ9 A;  4DBM A;  2W8F A;  2YME A;  5L4E A;  3RI5 A;  4EZ1 A;  4Z90 A;  4TWF A;  4F8H A;  2Y58 A;  2YN6 A;  4ALX A;  3C84 A;  3UQ4 A;  3UU8 A;  2XZ5 A;  2BYN A;  5HEU A;  3EAM A;  5BW2 A;  5J0Z A;  4BQT A;  3PMZ A;  3UU3 A;  2XQA A;  2W8G A;  4TWH A;  2XQ5 A;  4TNV A;  3JAF A;  3PEO A;  4HFB A;  5FJV A;  3T4M A;  3UU4 A;  5AFH A;  3UUB A;  3GUA A;  5HCJ A;  4IL9 A;  4COF A;  5J5H A;  2WZY A;  3P4W A;  5HEH A;  3P50 A;  2XNU A;  3EI0 A;  2XNT A;  5JME A;  2XQ8 A;  5BP0 A;  4HQP A;  3TLV A;  5J5F A;  5TVC A;  3U8K A;  3WTM A;  3WTJ A;  3TLS A;  3WTK A;  4UM3 S;  2BYR A;  5L4H A;  3U8J A;  4UM3 A;  4UXU A;  2XYT A;  3RQW A;  3ZKR A;  4NZB A;  5HEG A;  3EHZ A;  5LXB A;  4ZJS A;  2WNJ A;  3SQ6 A;  2BYQ A;  3C79 A;  4ZZB A;  2BR7 A;  2XQ7 A;  2YMD A;  4HFI A;  4LML A;  2QC1 B;  3JAE A;  4XK9 A;  3U8M A;  2XNV A;  4QH5 A;  5J5I A;  5HEO A;  4B5D A;  4NPP A;  3WTO A;  4A97 A;  1UV6 A;  4AFH A;  4D01 A;  2XQ3 A;  2YKS A;  4HFH A;  4ILB A;  3WTN A;  4ZZC A;  3UQ7 A;  2C9T A;  2ZJV A;  3RIA A;  5CO5 A;  3WTI A;  3UU6 A;  2X00 A;  3LSV A;  3ZDG A;  5AIN A;  3TLT A;  3RIF A;  3TLW A;  5CFB A;  4Z91 A;  4ZRU A;  4QAB A;  4ZK1 A;  2YOE A;  4XHE A;  4ZR6 A;  3JAD A;  4PIR A;  3IGQ A;  4HFE A;  4UM1 A;  4A98 A;  2WNL A;  2XYS A;  5J5G A;  2XQ4 A;  5HCM A;  2XZ6 A;  3TLU A;  2Y57 A;  2BJ0 A;  4IL4 A;  2XQ9 A;  4QAA A;  3RQU A;  2BG9 A;  3UU5 A;  4AFG A;  4X5T A;  2X00 D;  5AFJ A;  4HFD A;  2VL0 A;  2Y7Y A;  4ZJT A;  5AFL A;  4ILA A;  5BRX A;  3WTH A;  4ZK4 A;  2WNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...