3SH1A

Ac-achbp ligand binding domain mutated to human alpha-7 nachr
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVYLSFSLLDIVKADSSTNEVDLVYWEQQSWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQNALVNSSGHVQYLPAQRLSFMCDPTGVDSEEGATCAVKFGSWSYGGWEIDLKTDTDQVDLSSYYASSKYEILSATQTRSERFYECCKEPYPDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords Soluble acetylcholine receptor
publication title Creating an alpha-7 nicotinic acetylcholine recognition domain from the acetylcholine binding protein: crystallographic and ligand selectivity analyses
pubmed doi rcsb
source organism Aplysia californica
total genus 50
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3sh1A00
5HEUA 4TNWA 2XQ6A 5HCMA 3P50A 4EZ1A 4QH4A 4ZK1A 2WNLA 2BYQA 1UX2A 4ZZBA 3UQ7A 2PH9A 5AINA 4X5TA 4ILAA 4NPPA 2VL0A 3WTOA 4HFEA 1UV6A 2YOEA 5J5IA 2BR7A 3UU8A 3RQUA 4TNVA 2WN9A 5SYOA 4HFCA 5BW2A 4TWFA 2W8GA 2WNCA 4UXUA 5TVCA 3ZDHA 4ILBA 3JAEA 2YMDA 4XK9A 3UU5A 3TLTA 5AFMA 4LMLA 4PIRA 2XNUA 2BR8A 2X00D 3TLSA 4Z90A 3U8LA 4HQPA 2XQ9A 2ZJVA 4UM1A 3SH1A 4XHEA 3WTMA 4ZR6A 5AFJA 4NZBA 3WTNA 2BG9E 4AFHA 4BQTA 3WTHA 5AFKA 5HEOA 4B5DA 4HFIA 4IL4A 5AFNA 3SQ9A 4QAAA 3C84A 2WZYA 3RI5A 3T4MA 2BJ0A 2W8FA 2X00A 3EHZA 4IL9A 4UY2A 3SIOA 2BG9C 2XQ5A 4ZRUA 3U8MA 3EI0A 5BP0A 4UM3P 2XQ4A 5CO5A 2ZJUA 2XZ5A 3UUBA 5HEHA 4ILCA 5IUXA 2Y57A 5J0ZA 2QC1B 3WIPA 2XNVA 4HFHA 3WTKA 4UM3A 3C79A 3IGQA 4ZK4A 4QH1A 4DBMA 3EAMA 3UU6A 4LMKA 4COFA 4AFGA 4F8HA 3RHWA 4ZJTA 2UZ6A 2C9TA 4TWHA 2XYSA 2YN6A 4HFDA 3RIAA 5L4HA 2YKSA 5J5FA 4D01A 3P4WA 2WNJA 5FJVA 3U8NA 5LXBA 2YMEA 5JMEA 2BYNA 4QABA 4QACA 3TLVA 3TLUA 3JAFA 5BRXA 3GUAA 4LMJA 2XZ6A 3U8KA 4A97A 2XNTA 3ZKRA 4ZJSA 4AFTA 4UM3S 2XQ8A 2BG9B 2Y54A 4TWDA 5KZUA 5AFHA 2XQ3A 2XYTA 4FRRA 2Y58A 2BG9A 2Y56A 3RIFA 3RQWA 3JADA 5HEJA 5CFBA 3UU3A 3WTJA 2BYRA 3SQ6A 3UU4A 3UQ4A 2BYSA 5HCJA 5J5GA 4ALXA 5LG3A 2PGZA 4ZZCA 3PMZA 5HEGA 4BFQA 3LSVA 2Y7YA 4A98A 4IREA 3PEOA 4Z91A 5AFLA 4HFBA 5L4EA 5J5HA 3WTLA 3WTIA 5AFMB 5KE4A 1I9BA 3U8JA 2BYPA 1UW6A 4QH5A 2XQAA 3TLWA 5L47A 4WV9A 3ZDGA 2XQ7A
chains in the Genus database with same CATH superfamily
5HEUA 4TNWA 2XQ6A 5HCMA 3P50A 4EZ1A 4QH4A 4ZK1A 2WNLA 2BYQA 1UX2A 4ZZBA 3UQ7A 2PH9A 5AINA 4X5TA 4ILAA 4NPPA 2VL0A 3WTOA 4HFEA 1UV6A 2YOEA 5J5IA 2BR7A 3UU8A 3RQUA 4TNVA 2WN9A 5SYOA 4HFCA 5BW2A 4TWFA 2W8GA 2WNCA 4UXUA 5TVCA 3ZDHA 4ILBA 3JAEA 2YMDA 4XK9A 3UU5A 3TLTA 5AFMA 4LMLA 4PIRA 2XNUA 2BR8A 2X00D 3TLSA 4Z90A 3U8LA 4HQPA 2XQ9A 2ZJVA 4UM1A 3SH1A 4XHEA 3WTMA 4ZR6A 5AFJA 4NZBA 3WTNA 2BG9E 4AFHA 4BQTA 3WTHA 5AFKA 5HEOA 4B5DA 4HFIA 4IL4A 5AFNA 3SQ9A 4QAAA 3C84A 2WZYA 3RI5A 3T4MA 2BJ0A 2W8FA 2X00A 3EHZA 4IL9A 4UY2A 3SIOA 2BG9C 2XQ5A 4ZRUA 3U8MA 3EI0A 5BP0A 4UM3P 2XQ4A 5CO5A 2ZJUA 2XZ5A 3UUBA 5HEHA 4ILCA 5IUXA 2Y57A 5J0ZA 2QC1B 3WIPA 2XNVA 4HFHA 3WTKA 4UM3A 3C79A 3IGQA 4ZK4A 4QH1A 4DBMA 3EAMA 3UU6A 4LMKA 4COFA 4AFGA 4F8HA 3RHWA 4ZJTA 2UZ6A 2C9TA 4TWHA 2XYSA 2YN6A 4HFDA 3RIAA 5L4HA 2YKSA 5J5FA 4D01A 3P4WA 2WNJA 5FJVA 3U8NA 5LXBA 2YMEA 5JMEA 2BYNA 4QABA 4QACA 3TLVA 3TLUA 3JAFA 5BRXA 3GUAA 4LMJA 2XZ6A 3U8KA 4A97A 2XNTA 3ZKRA 4ZJSA 4AFTA 4UM3S 2XQ8A 2BG9B 2Y54A 4TWDA 5KZUA 5AFHA 2XQ3A 2XYTA 4FRRA 2Y58A 2BG9A 2Y56A 3RIFA 3RQWA 3JADA 5HEJA 5CFBA 3UU3A 3WTJA 2BYRA 3SQ6A 3UU4A 3UQ4A 2BYSA 5HCJA 5J5GA 4ALXA 5LG3A 2PGZA 4ZZCA 3PMZA 5HEGA 4BFQA 3LSVA 2Y7YA 4A98A 4IREA 3PEOA 4Z91A 5AFLA 4HFBA 5L4EA 5J5HA 3WTLA 3WTIA 5AFMB 5KE4A 1I9BA 3U8JA 2BYPA 1UW6A 4QH5A 2XQAA 3TLWA 5L47A 4WV9A 3ZDGA 2XQ7A
chains in the Genus database with same CATH topology
5HEUA 4TNWA 2XQ6A 5HCMA 3P50A 4EZ1A 4QH4A 4ZK1A 2WNLA 2BYQA 1UX2A 4ZZBA 3UQ7A 2PH9A 5AINA 4X5TA 4ILAA 4NPPA 2VL0A 3WTOA 4HFEA 1UV6A 2YOEA 5J5IA 2BR7A 3UU8A 3RQUA 4TNVA 2WN9A 5SYOA 4HFCA 5BW2A 4TWFA 2W8GA 2WNCA 4UXUA 5TVCA 3ZDHA 4ILBA 3JAEA 2YMDA 4XK9A 3UU5A 3TLTA 5AFMA 4LMLA 4PIRA 2XNUA 2BR8A 2X00D 3TLSA 4Z90A 3U8LA 4HQPA 2XQ9A 2ZJVA 4UM1A 3SH1A 4XHEA 3WTMA 4ZR6A 5AFJA 4NZBA 3WTNA 2BG9E 4AFHA 4BQTA 3WTHA 5AFKA 5HEOA 4B5DA 4HFIA 4IL4A 5AFNA 3SQ9A 4QAAA 3C84A 2WZYA 3RI5A 3T4MA 2BJ0A 2W8FA 2X00A 3EHZA 4IL9A 4UY2A 3SIOA 2BG9C 2XQ5A 4ZRUA 3U8MA 3EI0A 5BP0A 4UM3P 2XQ4A 5CO5A 2ZJUA 2XZ5A 3UUBA 5HEHA 4ILCA 5IUXA 2Y57A 5J0ZA 2QC1B 3WIPA 2XNVA 4HFHA 3WTKA 4UM3A 3C79A 3IGQA 4ZK4A 4QH1A 4DBMA 3EAMA 3UU6A 4LMKA 4COFA 4AFGA 4F8HA 3RHWA 4ZJTA 2UZ6A 2C9TA 4TWHA 2XYSA 2YN6A 4HFDA 3RIAA 5L4HA 2YKSA 5J5FA 4D01A 3P4WA 2WNJA 5FJVA 3U8NA 5LXBA 2YMEA 5JMEA 2BYNA 4QABA 4QACA 3TLVA 3TLUA 3JAFA 5BRXA 3GUAA 4LMJA 2XZ6A 3U8KA 4A97A 2XNTA 3ZKRA 4ZJSA 4AFTA 4UM3S 2XQ8A 2BG9B 2Y54A 4TWDA 5KZUA 5AFHA 2XQ3A 2XYTA 4FRRA 2Y58A 2BG9A 2Y56A 3RIFA 3RQWA 3JADA 5HEJA 5CFBA 3UU3A 3WTJA 2BYRA 3SQ6A 3UU4A 3UQ4A 2BYSA 5HCJA 5J5GA 4ALXA 5LG3A 2PGZA 4ZZCA 3PMZA 5HEGA 4BFQA 3LSVA 2Y7YA 4A98A 4IREA 3PEOA 4Z91A 5AFLA 4HFBA 5L4EA 5J5HA 3WTLA 3WTIA 5AFMB 5KE4A 1I9BA 3U8JA 2BYPA 1UW6A 4QH5A 2XQAA 3TLWA 5L47A 4WV9A 3ZDGA 2XQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEU A;  4TNW A;  2XQ6 A;  5HCM A;  3P50 A;  4EZ1 A;  4QH4 A;  4ZK1 A;  2WNL A;  2BYQ A;  1UX2 A;  4ZZB A;  3UQ7 A;  2PH9 A;  5AIN A;  4X5T A;  4ILA A;  4NPP A;  2VL0 A;  3WTO A;  4HFE A;  1UV6 A;  2YOE A;  5J5I A;  2BR7 A;  3UU8 A;  3RQU A;  4TNV A;  2WN9 A;  5SYO A;  4HFC A;  5BW2 A;  4TWF A;  2W8G A;  2WNC A;  4UXU A;  5TVC A;  3ZDH A;  4ILB A;  3JAE A;  2YMD A;  4XK9 A;  3UU5 A;  3TLT A;  5AFM A;  4LML A;  4PIR A;  2XNU A;  2BR8 A;  2X00 D;  3TLS A;  4Z90 A;  3U8L A;  4HQP A;  2XQ9 A;  2ZJV A;  4UM1 A;  3SH1 A;  4XHE A;  3WTM A;  4ZR6 A;  5AFJ A;  4NZB A;  3WTN A;  2BG9 E;  4AFH A;  4BQT A;  3WTH A;  5AFK A;  5HEO A;  4B5D A;  4HFI A;  4IL4 A;  5AFN A;  3SQ9 A;  4QAA A;  3C84 A;  2WZY A;  3RI5 A;  3T4M A;  2BJ0 A;  2W8F A;  2X00 A;  3EHZ A;  4IL9 A;  4UY2 A;  3SIO A;  2BG9 C;  2XQ5 A;  4ZRU A;  3U8M A;  3EI0 A;  5BP0 A;  4UM3 P;  2XQ4 A;  5CO5 A;  2ZJU A;  2XZ5 A;  3UUB A;  5HEH A;  4ILC A;  5IUX A;  2Y57 A;  5J0Z A;  2QC1 B;  3WIP A;  2XNV A;  4HFH A;  3WTK A;  4UM3 A;  3C79 A;  3IGQ A;  4ZK4 A;  4QH1 A;  4DBM A;  3EAM A;  3UU6 A;  4LMK A;  4COF A;  4AFG A;  4F8H A;  3RHW A;  4ZJT A;  2UZ6 A;  2C9T A;  4TWH A;  2XYS A;  2YN6 A;  4HFD A;  3RIA A;  5L4H A;  2YKS A;  5J5F A;  4D01 A;  3P4W A;  2WNJ A;  5FJV A;  3U8N A;  5LXB A;  2YME A;  5JME A;  2BYN A;  4QAB A;  4QAC A;  3TLV A;  3TLU A;  3JAF A;  5BRX A;  3GUA A;  4LMJ A;  2XZ6 A;  3U8K A;  4A97 A;  2XNT A;  3ZKR A;  4ZJS A;  4AFT A;  4UM3 S;  2XQ8 A;  2BG9 B;  2Y54 A;  4TWD A;  5KZU A;  5AFH A;  2XQ3 A;  2XYT A;  4FRR A;  2Y58 A;  2BG9 A;  2Y56 A;  3RIF A;  3RQW A;  3JAD A;  5HEJ A;  5CFB A;  3UU3 A;  3WTJ A;  2BYR A;  3SQ6 A;  3UU4 A;  3UQ4 A;  2BYS A;  5HCJ A;  5J5G A;  4ALX A;  5LG3 A;  2PGZ A;  4ZZC A;  3PMZ A;  5HEG A;  4BFQ A;  3LSV A;  2Y7Y A;  4A98 A;  4IRE A;  3PEO A;  4Z91 A;  5AFL A;  4HFB A;  5L4E A;  5J5H A;  3WTL A;  3WTI A;  5AFM B;  5KE4 A;  1I9B A;  3U8J A;  2BYP A;  1UW6 A;  4QH5 A;  2XQA A;  3TLW A;  5L47 A;  4WV9 A;  3ZDG A;  2XQ7 A; 
#chains in the Genus database with same CATH topology
 5HEU A;  4TNW A;  2XQ6 A;  5HCM A;  3P50 A;  4EZ1 A;  4QH4 A;  4ZK1 A;  2WNL A;  2BYQ A;  1UX2 A;  4ZZB A;  3UQ7 A;  2PH9 A;  5AIN A;  4X5T A;  4ILA A;  4NPP A;  2VL0 A;  3WTO A;  4HFE A;  1UV6 A;  2YOE A;  5J5I A;  2BR7 A;  3UU8 A;  3RQU A;  4TNV A;  2WN9 A;  5SYO A;  4HFC A;  5BW2 A;  4TWF A;  2W8G A;  2WNC A;  4UXU A;  5TVC A;  3ZDH A;  4ILB A;  3JAE A;  2YMD A;  4XK9 A;  3UU5 A;  3TLT A;  5AFM A;  4LML A;  4PIR A;  2XNU A;  2BR8 A;  2X00 D;  3TLS A;  4Z90 A;  3U8L A;  4HQP A;  2XQ9 A;  2ZJV A;  4UM1 A;  3SH1 A;  4XHE A;  3WTM A;  4ZR6 A;  5AFJ A;  4NZB A;  3WTN A;  2BG9 E;  4AFH A;  4BQT A;  3WTH A;  5AFK A;  5HEO A;  4B5D A;  4HFI A;  4IL4 A;  5AFN A;  3SQ9 A;  4QAA A;  3C84 A;  2WZY A;  3RI5 A;  3T4M A;  2BJ0 A;  2W8F A;  2X00 A;  3EHZ A;  4IL9 A;  4UY2 A;  3SIO A;  2BG9 C;  2XQ5 A;  4ZRU A;  3U8M A;  3EI0 A;  5BP0 A;  4UM3 P;  2XQ4 A;  5CO5 A;  2ZJU A;  2XZ5 A;  3UUB A;  5HEH A;  4ILC A;  5IUX A;  2Y57 A;  5J0Z A;  2QC1 B;  3WIP A;  2XNV A;  4HFH A;  3WTK A;  4UM3 A;  3C79 A;  3IGQ A;  4ZK4 A;  4QH1 A;  4DBM A;  3EAM A;  3UU6 A;  4LMK A;  4COF A;  4AFG A;  4F8H A;  3RHW A;  4ZJT A;  2UZ6 A;  2C9T A;  4TWH A;  2XYS A;  2YN6 A;  4HFD A;  3RIA A;  5L4H A;  2YKS A;  5J5F A;  4D01 A;  3P4W A;  2WNJ A;  5FJV A;  3U8N A;  5LXB A;  2YME A;  5JME A;  2BYN A;  4QAB A;  4QAC A;  3TLV A;  3TLU A;  3JAF A;  5BRX A;  3GUA A;  4LMJ A;  2XZ6 A;  3U8K A;  4A97 A;  2XNT A;  3ZKR A;  4ZJS A;  4AFT A;  4UM3 S;  2XQ8 A;  2BG9 B;  2Y54 A;  4TWD A;  5KZU A;  5AFH A;  2XQ3 A;  2XYT A;  4FRR A;  2Y58 A;  2BG9 A;  2Y56 A;  3RIF A;  3RQW A;  3JAD A;  5HEJ A;  5CFB A;  3UU3 A;  3WTJ A;  2BYR A;  3SQ6 A;  3UU4 A;  3UQ4 A;  2BYS A;  5HCJ A;  5J5G A;  4ALX A;  5LG3 A;  2PGZ A;  4ZZC A;  3PMZ A;  5HEG A;  4BFQ A;  3LSV A;  2Y7Y A;  4A98 A;  4IRE A;  3PEO A;  4Z91 A;  5AFL A;  4HFB A;  5L4E A;  5J5H A;  3WTL A;  3WTI A;  5AFM B;  5KE4 A;  1I9B A;  3U8J A;  2BYP A;  1UW6 A;  4QH5 A;  2XQA A;  3TLW A;  5L47 A;  4WV9 A;  3ZDG A;  2XQ7 A; 
#chains in the Genus database with same CATH homology
 5HEU A;  4TNW A;  2XQ6 A;  5HCM A;  3P50 A;  4EZ1 A;  4QH4 A;  4ZK1 A;  2WNL A;  2BYQ A;  1UX2 A;  4ZZB A;  3UQ7 A;  2PH9 A;  5AIN A;  4X5T A;  4ILA A;  4NPP A;  2VL0 A;  3WTO A;  4HFE A;  1UV6 A;  2YOE A;  5J5I A;  2BR7 A;  3UU8 A;  3RQU A;  4TNV A;  2WN9 A;  5SYO A;  4HFC A;  5BW2 A;  4TWF A;  2W8G A;  2WNC A;  4UXU A;  5TVC A;  3ZDH A;  4ILB A;  3JAE A;  2YMD A;  4XK9 A;  3UU5 A;  3TLT A;  5AFM A;  4LML A;  4PIR A;  2XNU A;  2BR8 A;  2X00 D;  3TLS A;  4Z90 A;  3U8L A;  4HQP A;  2XQ9 A;  2ZJV A;  4UM1 A;  3SH1 A;  4XHE A;  3WTM A;  4ZR6 A;  5AFJ A;  4NZB A;  3WTN A;  2BG9 E;  4AFH A;  4BQT A;  3WTH A;  5AFK A;  5HEO A;  4B5D A;  4HFI A;  4IL4 A;  5AFN A;  3SQ9 A;  4QAA A;  3C84 A;  2WZY A;  3RI5 A;  3T4M A;  2BJ0 A;  2W8F A;  2X00 A;  3EHZ A;  4IL9 A;  4UY2 A;  3SIO A;  2BG9 C;  2XQ5 A;  4ZRU A;  3U8M A;  3EI0 A;  5BP0 A;  4UM3 P;  2XQ4 A;  5CO5 A;  2ZJU A;  2XZ5 A;  3UUB A;  5HEH A;  4ILC A;  5IUX A;  2Y57 A;  5J0Z A;  2QC1 B;  3WIP A;  2XNV A;  4HFH A;  3WTK A;  4UM3 A;  3C79 A;  3IGQ A;  4ZK4 A;  4QH1 A;  4DBM A;  3EAM A;  3UU6 A;  4LMK A;  4COF A;  4AFG A;  4F8H A;  3RHW A;  4ZJT A;  2UZ6 A;  2C9T A;  4TWH A;  2XYS A;  2YN6 A;  4HFD A;  3RIA A;  5L4H A;  2YKS A;  5J5F A;  4D01 A;  3P4W A;  2WNJ A;  5FJV A;  3U8N A;  5LXB A;  2YME A;  5JME A;  2BYN A;  4QAB A;  4QAC A;  3TLV A;  3TLU A;  3JAF A;  5BRX A;  3GUA A;  4LMJ A;  2XZ6 A;  3U8K A;  4A97 A;  2XNT A;  3ZKR A;  4ZJS A;  4AFT A;  4UM3 S;  2XQ8 A;  2BG9 B;  2Y54 A;  4TWD A;  5KZU A;  5AFH A;  2XQ3 A;  2XYT A;  4FRR A;  2Y58 A;  2BG9 A;  2Y56 A;  3RIF A;  3RQW A;  3JAD A;  5HEJ A;  5CFB A;  3UU3 A;  3WTJ A;  2BYR A;  3SQ6 A;  3UU4 A;  3UQ4 A;  2BYS A;  5HCJ A;  5J5G A;  4ALX A;  5LG3 A;  2PGZ A;  4ZZC A;  3PMZ A;  5HEG A;  4BFQ A;  3LSV A;  2Y7Y A;  4A98 A;  4IRE A;  3PEO A;  4Z91 A;  5AFL A;  4HFB A;  5L4E A;  5J5H A;  3WTL A;  3WTI A;  5AFM B;  5KE4 A;  1I9B A;  3U8J A;  2BYP A;  1UW6 A;  4QH5 A;  2XQA A;  3TLW A;  5L47 A;  4WV9 A;  3ZDG A;  2XQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...