5AFJA

Alpha7-achbp in complex with lobeline and fragment 1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
204
structure length
204
Chain Sequence
b'EFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 47
structure length 204
sequence length 204
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afjA00
4ILCA 2BG9B 3RI5A 4WV9A 3T4MA 2WN9A 3UU6A 4ZK4A 2Y58A 4LMKA 5AFMA 4HFBA 3UU3A 4HFDA 3WTNA 3WTJA 4AFHA 2Y7YA 2WNJA 3U8NA 2YOEA 3U8LA 4FRRA 2BJ0A 1UV6A 4NPPA 4UM3P 4Z91A 2W8FA 2PH9A 5AFKA 2XYSA 4HFIA 5HEHA 3C79A 5AFNA 4QH4A 3UQ4A 3U8KA 4COFA 4HQPA 2UZ6A 4UM3A 4Z90A 3RQUA 2BYSA 3RIFA 2BYRA 5KE4A 4D01A 4HFHA 5HEUA 2Y56A 3SQ9A 4X5TA 4QABA 3WTMA 4NZBA 4ZRUA 4IREA 2YMEA 4TWHA 2BYQA 4A97A 3JAEA 2WNCA 2QC1B 3PMZA 3TLWA 4F8HA 5BW2A 4XHEA 5J5GA 2WZYA 4ILAA 3WTOA 4LMJA 4DBMA 2ZJVA 3P50A 3EAMA 4IL9A 2XZ5A 3TLUA 3U8JA 3UU8A 4ZK1A 4UM1A 4A98A 3JADA 2Y54A 2YKSA 1UW6A 2XQAA 5J5FA 4EZ1A 4B5DA 3WTLA 2XNUA 4UXUA 3WTIA 4UM3S 4ZZBA 3UQ7A 3SH1A 2W8GA 3WIPA 3SQ6A 2XNTA 4IL4A 5AFMB 2BR7A 4ALXA 5J0ZA 3SIOA 2XYTA 3ZDGA 4XK9A 2XNVA 5TVCA 4ZJTA 2XQ3A 5HCJA 2BYPA 3EI0A 3UU5A 5CFBA 4QACA 2BG9A 5AFLA 3ZKRA 5L47A 3IGQA 2BG9C 5AFJA 3C84A 4BQTA 2C9TA 3RHWA 5LXBA 4HFEA 5HEGA 3U8MA 4TWFA 4TWDA 2XZ6A 4ILBA 5SYOA 3LSVA 1UX2A 2X00A 2XQ5A 3TLVA 3ZDHA 5L4HA 3JAFA 5J5IA 3UU4A 2BYNA 2BG9E 3GUAA 4ZR6A 5HEOA 2BR8A 4BFQA 3WTKA 5IUXA 3P4WA 5LG3A 2YN6A 4QH1A 1I9BA 3WTHA 5AFHA 4ZJSA 3PEOA 5HEJA 2Y57A 2XQ8A 3TLTA 4HFCA 2VL0A 3EHZA 2WNLA 4LMLA 4TNVA 2XQ6A 3RQWA 5BP0A 5L4EA 3TLSA 5BRXA 2XQ9A 2XQ4A 3RIAA 5J5HA 2X00D 5CO5A 5AINA 2ZJUA 3UUBA 4QAAA 5HCMA 2XQ7A 5FJVA 4UY2A 2YMDA 4QH5A 4TNWA 5JMEA 2PGZA 4PIRA 4AFTA 4AFGA 5KZUA 4ZZCA
chains in the Genus database with same CATH superfamily
4ILCA 2BG9B 3RI5A 4WV9A 3T4MA 2WN9A 3UU6A 4ZK4A 2Y58A 4LMKA 5AFMA 4HFBA 3UU3A 4HFDA 3WTNA 3WTJA 4AFHA 2Y7YA 2WNJA 3U8NA 2YOEA 3U8LA 4FRRA 2BJ0A 1UV6A 4NPPA 4UM3P 4Z91A 2W8FA 2PH9A 5AFKA 2XYSA 4HFIA 5HEHA 3C79A 5AFNA 4QH4A 3UQ4A 3U8KA 4COFA 4HQPA 2UZ6A 4UM3A 4Z90A 3RQUA 2BYSA 3RIFA 2BYRA 5KE4A 4D01A 4HFHA 5HEUA 2Y56A 3SQ9A 4X5TA 4QABA 3WTMA 4NZBA 4ZRUA 4IREA 2YMEA 4TWHA 2BYQA 4A97A 3JAEA 2WNCA 2QC1B 3PMZA 3TLWA 4F8HA 5BW2A 4XHEA 5J5GA 2WZYA 4ILAA 3WTOA 4LMJA 4DBMA 2ZJVA 3P50A 3EAMA 4IL9A 2XZ5A 3TLUA 3U8JA 3UU8A 4ZK1A 4UM1A 4A98A 3JADA 2Y54A 2YKSA 1UW6A 2XQAA 5J5FA 4EZ1A 4B5DA 3WTLA 2XNUA 4UXUA 3WTIA 4UM3S 4ZZBA 3UQ7A 3SH1A 2W8GA 3WIPA 3SQ6A 2XNTA 4IL4A 5AFMB 2BR7A 4ALXA 5J0ZA 3SIOA 2XYTA 3ZDGA 4XK9A 2XNVA 5TVCA 4ZJTA 2XQ3A 5HCJA 2BYPA 3EI0A 3UU5A 5CFBA 4QACA 2BG9A 5AFLA 3ZKRA 5L47A 3IGQA 2BG9C 5AFJA 3C84A 4BQTA 2C9TA 3RHWA 5LXBA 4HFEA 5HEGA 3U8MA 4TWFA 4TWDA 2XZ6A 4ILBA 5SYOA 3LSVA 1UX2A 2X00A 2XQ5A 3TLVA 3ZDHA 5L4HA 3JAFA 5J5IA 3UU4A 2BYNA 2BG9E 3GUAA 4ZR6A 5HEOA 2BR8A 4BFQA 3WTKA 5IUXA 3P4WA 5LG3A 2YN6A 4QH1A 1I9BA 3WTHA 5AFHA 4ZJSA 3PEOA 5HEJA 2Y57A 2XQ8A 3TLTA 4HFCA 2VL0A 3EHZA 2WNLA 4LMLA 4TNVA 2XQ6A 3RQWA 5BP0A 5L4EA 3TLSA 5BRXA 2XQ9A 2XQ4A 3RIAA 5J5HA 2X00D 5CO5A 5AINA 2ZJUA 3UUBA 4QAAA 5HCMA 2XQ7A 5FJVA 4UY2A 2YMDA 4QH5A 4TNWA 5JMEA 2PGZA 4PIRA 4AFTA 4AFGA 5KZUA 4ZZCA
chains in the Genus database with same CATH topology
4ILCA 2BG9B 3RI5A 4WV9A 3T4MA 2WN9A 3UU6A 4ZK4A 2Y58A 4LMKA 5AFMA 4HFBA 3UU3A 4HFDA 3WTNA 3WTJA 4AFHA 2Y7YA 2WNJA 3U8NA 2YOEA 3U8LA 4FRRA 2BJ0A 1UV6A 4NPPA 4UM3P 4Z91A 2W8FA 2PH9A 5AFKA 2XYSA 4HFIA 5HEHA 3C79A 5AFNA 4QH4A 3UQ4A 3U8KA 4COFA 4HQPA 2UZ6A 4UM3A 4Z90A 3RQUA 2BYSA 3RIFA 2BYRA 5KE4A 4D01A 4HFHA 5HEUA 2Y56A 3SQ9A 4X5TA 4QABA 3WTMA 4NZBA 4ZRUA 4IREA 2YMEA 4TWHA 2BYQA 4A97A 3JAEA 2WNCA 2QC1B 3PMZA 3TLWA 4F8HA 5BW2A 4XHEA 5J5GA 2WZYA 4ILAA 3WTOA 4LMJA 4DBMA 2ZJVA 3P50A 3EAMA 4IL9A 2XZ5A 3TLUA 3U8JA 3UU8A 4ZK1A 4UM1A 4A98A 3JADA 2Y54A 2YKSA 1UW6A 2XQAA 5J5FA 4EZ1A 4B5DA 3WTLA 2XNUA 4UXUA 3WTIA 4UM3S 4ZZBA 3UQ7A 3SH1A 2W8GA 3WIPA 3SQ6A 2XNTA 4IL4A 5AFMB 2BR7A 4ALXA 5J0ZA 3SIOA 2XYTA 3ZDGA 4XK9A 2XNVA 5TVCA 4ZJTA 2XQ3A 5HCJA 2BYPA 3EI0A 3UU5A 5CFBA 4QACA 2BG9A 5AFLA 3ZKRA 5L47A 3IGQA 2BG9C 5AFJA 3C84A 4BQTA 2C9TA 3RHWA 5LXBA 4HFEA 5HEGA 3U8MA 4TWFA 4TWDA 2XZ6A 4ILBA 5SYOA 3LSVA 1UX2A 2X00A 2XQ5A 3TLVA 3ZDHA 5L4HA 3JAFA 5J5IA 3UU4A 2BYNA 2BG9E 3GUAA 4ZR6A 5HEOA 2BR8A 4BFQA 3WTKA 5IUXA 3P4WA 5LG3A 2YN6A 4QH1A 1I9BA 3WTHA 5AFHA 4ZJSA 3PEOA 5HEJA 2Y57A 2XQ8A 3TLTA 4HFCA 2VL0A 3EHZA 2WNLA 4LMLA 4TNVA 2XQ6A 3RQWA 5BP0A 5L4EA 3TLSA 5BRXA 2XQ9A 2XQ4A 3RIAA 5J5HA 2X00D 5CO5A 5AINA 2ZJUA 3UUBA 4QAAA 5HCMA 2XQ7A 5FJVA 4UY2A 2YMDA 4QH5A 4TNWA 5JMEA 2PGZA 4PIRA 4AFTA 4AFGA 5KZUA 4ZZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILC A;  2BG9 B;  3RI5 A;  4WV9 A;  3T4M A;  2WN9 A;  3UU6 A;  4ZK4 A;  2Y58 A;  4LMK A;  5AFM A;  4HFB A;  3UU3 A;  4HFD A;  3WTN A;  3WTJ A;  4AFH A;  2Y7Y A;  2WNJ A;  3U8N A;  2YOE A;  3U8L A;  4FRR A;  2BJ0 A;  1UV6 A;  4NPP A;  4UM3 P;  4Z91 A;  2W8F A;  2PH9 A;  5AFK A;  2XYS A;  4HFI A;  5HEH A;  3C79 A;  5AFN A;  4QH4 A;  3UQ4 A;  3U8K A;  4COF A;  4HQP A;  2UZ6 A;  4UM3 A;  4Z90 A;  3RQU A;  2BYS A;  3RIF A;  2BYR A;  5KE4 A;  4D01 A;  4HFH A;  5HEU A;  2Y56 A;  3SQ9 A;  4X5T A;  4QAB A;  3WTM A;  4NZB A;  4ZRU A;  4IRE A;  2YME A;  4TWH A;  2BYQ A;  4A97 A;  3JAE A;  2WNC A;  2QC1 B;  3PMZ A;  3TLW A;  4F8H A;  5BW2 A;  4XHE A;  5J5G A;  2WZY A;  4ILA A;  3WTO A;  4LMJ A;  4DBM A;  2ZJV A;  3P50 A;  3EAM A;  4IL9 A;  2XZ5 A;  3TLU A;  3U8J A;  3UU8 A;  4ZK1 A;  4UM1 A;  4A98 A;  3JAD A;  2Y54 A;  2YKS A;  1UW6 A;  2XQA A;  5J5F A;  4EZ1 A;  4B5D A;  3WTL A;  2XNU A;  4UXU A;  3WTI A;  4UM3 S;  4ZZB A;  3UQ7 A;  3SH1 A;  2W8G A;  3WIP A;  3SQ6 A;  2XNT A;  4IL4 A;  5AFM B;  2BR7 A;  4ALX A;  5J0Z A;  3SIO A;  2XYT A;  3ZDG A;  4XK9 A;  2XNV A;  5TVC A;  4ZJT A;  2XQ3 A;  5HCJ A;  2BYP A;  3EI0 A;  3UU5 A;  5CFB A;  4QAC A;  2BG9 A;  5AFL A;  3ZKR A;  5L47 A;  3IGQ A;  2BG9 C;  5AFJ A;  3C84 A;  4BQT A;  2C9T A;  3RHW A;  5LXB A;  4HFE A;  5HEG A;  3U8M A;  4TWF A;  4TWD A;  2XZ6 A;  4ILB A;  5SYO A;  3LSV A;  1UX2 A;  2X00 A;  2XQ5 A;  3TLV A;  3ZDH A;  5L4H A;  3JAF A;  5J5I A;  3UU4 A;  2BYN A;  2BG9 E;  3GUA A;  4ZR6 A;  5HEO A;  2BR8 A;  4BFQ A;  3WTK A;  5IUX A;  3P4W A;  5LG3 A;  2YN6 A;  4QH1 A;  1I9B A;  3WTH A;  5AFH A;  4ZJS A;  3PEO A;  5HEJ A;  2Y57 A;  2XQ8 A;  3TLT A;  4HFC A;  2VL0 A;  3EHZ A;  2WNL A;  4LML A;  4TNV A;  2XQ6 A;  3RQW A;  5BP0 A;  5L4E A;  3TLS A;  5BRX A;  2XQ9 A;  2XQ4 A;  3RIA A;  5J5H A;  2X00 D;  5CO5 A;  5AIN A;  2ZJU A;  3UUB A;  4QAA A;  5HCM A;  2XQ7 A;  5FJV A;  4UY2 A;  2YMD A;  4QH5 A;  4TNW A;  5JME A;  2PGZ A;  4PIR A;  4AFT A;  4AFG A;  5KZU A;  4ZZC A; 
#chains in the Genus database with same CATH topology
 4ILC A;  2BG9 B;  3RI5 A;  4WV9 A;  3T4M A;  2WN9 A;  3UU6 A;  4ZK4 A;  2Y58 A;  4LMK A;  5AFM A;  4HFB A;  3UU3 A;  4HFD A;  3WTN A;  3WTJ A;  4AFH A;  2Y7Y A;  2WNJ A;  3U8N A;  2YOE A;  3U8L A;  4FRR A;  2BJ0 A;  1UV6 A;  4NPP A;  4UM3 P;  4Z91 A;  2W8F A;  2PH9 A;  5AFK A;  2XYS A;  4HFI A;  5HEH A;  3C79 A;  5AFN A;  4QH4 A;  3UQ4 A;  3U8K A;  4COF A;  4HQP A;  2UZ6 A;  4UM3 A;  4Z90 A;  3RQU A;  2BYS A;  3RIF A;  2BYR A;  5KE4 A;  4D01 A;  4HFH A;  5HEU A;  2Y56 A;  3SQ9 A;  4X5T A;  4QAB A;  3WTM A;  4NZB A;  4ZRU A;  4IRE A;  2YME A;  4TWH A;  2BYQ A;  4A97 A;  3JAE A;  2WNC A;  2QC1 B;  3PMZ A;  3TLW A;  4F8H A;  5BW2 A;  4XHE A;  5J5G A;  2WZY A;  4ILA A;  3WTO A;  4LMJ A;  4DBM A;  2ZJV A;  3P50 A;  3EAM A;  4IL9 A;  2XZ5 A;  3TLU A;  3U8J A;  3UU8 A;  4ZK1 A;  4UM1 A;  4A98 A;  3JAD A;  2Y54 A;  2YKS A;  1UW6 A;  2XQA A;  5J5F A;  4EZ1 A;  4B5D A;  3WTL A;  2XNU A;  4UXU A;  3WTI A;  4UM3 S;  4ZZB A;  3UQ7 A;  3SH1 A;  2W8G A;  3WIP A;  3SQ6 A;  2XNT A;  4IL4 A;  5AFM B;  2BR7 A;  4ALX A;  5J0Z A;  3SIO A;  2XYT A;  3ZDG A;  4XK9 A;  2XNV A;  5TVC A;  4ZJT A;  2XQ3 A;  5HCJ A;  2BYP A;  3EI0 A;  3UU5 A;  5CFB A;  4QAC A;  2BG9 A;  5AFL A;  3ZKR A;  5L47 A;  3IGQ A;  2BG9 C;  5AFJ A;  3C84 A;  4BQT A;  2C9T A;  3RHW A;  5LXB A;  4HFE A;  5HEG A;  3U8M A;  4TWF A;  4TWD A;  2XZ6 A;  4ILB A;  5SYO A;  3LSV A;  1UX2 A;  2X00 A;  2XQ5 A;  3TLV A;  3ZDH A;  5L4H A;  3JAF A;  5J5I A;  3UU4 A;  2BYN A;  2BG9 E;  3GUA A;  4ZR6 A;  5HEO A;  2BR8 A;  4BFQ A;  3WTK A;  5IUX A;  3P4W A;  5LG3 A;  2YN6 A;  4QH1 A;  1I9B A;  3WTH A;  5AFH A;  4ZJS A;  3PEO A;  5HEJ A;  2Y57 A;  2XQ8 A;  3TLT A;  4HFC A;  2VL0 A;  3EHZ A;  2WNL A;  4LML A;  4TNV A;  2XQ6 A;  3RQW A;  5BP0 A;  5L4E A;  3TLS A;  5BRX A;  2XQ9 A;  2XQ4 A;  3RIA A;  5J5H A;  2X00 D;  5CO5 A;  5AIN A;  2ZJU A;  3UUB A;  4QAA A;  5HCM A;  2XQ7 A;  5FJV A;  4UY2 A;  2YMD A;  4QH5 A;  4TNW A;  5JME A;  2PGZ A;  4PIR A;  4AFT A;  4AFG A;  5KZU A;  4ZZC A; 
#chains in the Genus database with same CATH homology
 4ILC A;  2BG9 B;  3RI5 A;  4WV9 A;  3T4M A;  2WN9 A;  3UU6 A;  4ZK4 A;  2Y58 A;  4LMK A;  5AFM A;  4HFB A;  3UU3 A;  4HFD A;  3WTN A;  3WTJ A;  4AFH A;  2Y7Y A;  2WNJ A;  3U8N A;  2YOE A;  3U8L A;  4FRR A;  2BJ0 A;  1UV6 A;  4NPP A;  4UM3 P;  4Z91 A;  2W8F A;  2PH9 A;  5AFK A;  2XYS A;  4HFI A;  5HEH A;  3C79 A;  5AFN A;  4QH4 A;  3UQ4 A;  3U8K A;  4COF A;  4HQP A;  2UZ6 A;  4UM3 A;  4Z90 A;  3RQU A;  2BYS A;  3RIF A;  2BYR A;  5KE4 A;  4D01 A;  4HFH A;  5HEU A;  2Y56 A;  3SQ9 A;  4X5T A;  4QAB A;  3WTM A;  4NZB A;  4ZRU A;  4IRE A;  2YME A;  4TWH A;  2BYQ A;  4A97 A;  3JAE A;  2WNC A;  2QC1 B;  3PMZ A;  3TLW A;  4F8H A;  5BW2 A;  4XHE A;  5J5G A;  2WZY A;  4ILA A;  3WTO A;  4LMJ A;  4DBM A;  2ZJV A;  3P50 A;  3EAM A;  4IL9 A;  2XZ5 A;  3TLU A;  3U8J A;  3UU8 A;  4ZK1 A;  4UM1 A;  4A98 A;  3JAD A;  2Y54 A;  2YKS A;  1UW6 A;  2XQA A;  5J5F A;  4EZ1 A;  4B5D A;  3WTL A;  2XNU A;  4UXU A;  3WTI A;  4UM3 S;  4ZZB A;  3UQ7 A;  3SH1 A;  2W8G A;  3WIP A;  3SQ6 A;  2XNT A;  4IL4 A;  5AFM B;  2BR7 A;  4ALX A;  5J0Z A;  3SIO A;  2XYT A;  3ZDG A;  4XK9 A;  2XNV A;  5TVC A;  4ZJT A;  2XQ3 A;  5HCJ A;  2BYP A;  3EI0 A;  3UU5 A;  5CFB A;  4QAC A;  2BG9 A;  5AFL A;  3ZKR A;  5L47 A;  3IGQ A;  2BG9 C;  5AFJ A;  3C84 A;  4BQT A;  2C9T A;  3RHW A;  5LXB A;  4HFE A;  5HEG A;  3U8M A;  4TWF A;  4TWD A;  2XZ6 A;  4ILB A;  5SYO A;  3LSV A;  1UX2 A;  2X00 A;  2XQ5 A;  3TLV A;  3ZDH A;  5L4H A;  3JAF A;  5J5I A;  3UU4 A;  2BYN A;  2BG9 E;  3GUA A;  4ZR6 A;  5HEO A;  2BR8 A;  4BFQ A;  3WTK A;  5IUX A;  3P4W A;  5LG3 A;  2YN6 A;  4QH1 A;  1I9B A;  3WTH A;  5AFH A;  4ZJS A;  3PEO A;  5HEJ A;  2Y57 A;  2XQ8 A;  3TLT A;  4HFC A;  2VL0 A;  3EHZ A;  2WNL A;  4LML A;  4TNV A;  2XQ6 A;  3RQW A;  5BP0 A;  5L4E A;  3TLS A;  5BRX A;  2XQ9 A;  2XQ4 A;  3RIA A;  5J5H A;  2X00 D;  5CO5 A;  5AIN A;  2ZJU A;  3UUB A;  4QAA A;  5HCM A;  2XQ7 A;  5FJV A;  4UY2 A;  2YMD A;  4QH5 A;  4TNW A;  5JME A;  2PGZ A;  4PIR A;  4AFT A;  4AFG A;  5KZU A;  4ZZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...