5AFJA

Alpha7-achbp in complex with lobeline and fragment 1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
204
structure length
204
Chain Sequence
EFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 47
structure length 204
sequence length 204
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afjA00
2X00D 3WTOA 5HCJA 5CO5A 2W8FA 3TLVA 5AFNA 3C79A 5HEUA 3TLWA 3WTNA 4QAAA 2YOEA 4ZJSA 3TLUA 2XYSA 4A97A 3WTLA 3U8MA 4ZK1A 2W8GA 2XQ8A 3GUAA 4TNVA 2XZ6A 3C84A 5AFJA 5AFMB 4XK9A 4NPPA 3LSVA 3SIOA 2WNJA 2Y57A 5HEHA 2PH9A 4QABA 4ALXA 2XQ6A 4B5DA 5SYOA 2VL0A 2WNCA 1UW6A 3T4MA 5HCMA 2XNUA 3SQ9A 4COFA 4A98A 2UZ6A 2XQ3A 3TLSA 2XNTA 4DBMA 5L4EA 4ZZCA 2ZJUA 4D01A 3UU8A 3TLTA 4QH1A 4UM1A 2XYTA 3RQUA 3ZKRA 5LG3A 4HFDA 5AFMA 2XNVA 3ZDGA 4QACA 3U8JA 3WTHA 3UU6A 2WNLA 3P50A 4HFHA 4NZBA 4WV9A 5TVCA 5HEOA 3U8KA 5J5IA 3JAFA 2BYQA 3RI5A 5IUXA 2XQAA 4XHEA 2Y58A 5J0ZA 4UM3P 4BQTA 3WTJA 2WN9A 4ZK4A 2BG9A 2BG9B 2XQ5A 2YMEA 2BYSA 3IGQA 4ILAA 4BFQA 3EAMA 2Y54A 5BRXA 2BR7A 2XZ5A 4UY2A 3RHWA 2C9TA 3UQ4A 2BR8A 2XQ7A 5J5HA 3PEOA 4HFCA 4LMKA 5L47A 2YKSA 3JAEA 4FRRA 2X00A 3RIAA 3WIPA 5LXBA 2YN6A 4ZRUA 4ILCA 2QC1B 3P4WA 3WTIA 3ZDHA 5KZUA 4IREA 3WTMA 3U8LA 2Y7YA 5HEGA 5AFLA 4PIRA 3RIFA 5AFKA 3UQ7A 3RQWA 4UM3A 3U8NA 5FJVA 4ILBA 5BW2A 4TWDA 4QH5A 2PGZA 2YMDA 5HEJA 4TNWA 5AFHA 5AINA 4AFTA 1UV6A 3JADA 4LMJA 3PMZA 4TWHA 2XQ4A 3SQ6A 3UU4A 4EZ1A 2BG9C 2WZYA 3UU5A 5KE4A 5BP0A 4ZJTA 2BYRA 4UM3S 5L4HA 4X5TA 4HFEA 2BG9E 2XQ9A 1UX2A 5J5FA 3EHZA 4HFBA 4HFIA 4IL9A 3UUBA 2BYNA 4AFGA 4AFHA 4LMLA 2BYPA 4Z90A 4HQPA 4ZZBA 3EI0A 4TWFA 5J5GA 3UU3A 4QH4A 4ZR6A 4UXUA 5CFBA 1I9BA 4IL4A 4Z91A 2Y56A 3SH1A 2ZJVA 4F8HA 5JMEA 3WTKA 2BJ0A
chains in the Genus database with same CATH superfamily
2X00D 3WTOA 5HCJA 5CO5A 2W8FA 3TLVA 5AFNA 3C79A 5HEUA 3TLWA 3WTNA 4QAAA 2YOEA 4ZJSA 3TLUA 2XYSA 4A97A 3WTLA 3U8MA 4ZK1A 2W8GA 2XQ8A 3GUAA 4TNVA 2XZ6A 3C84A 5AFJA 5AFMB 4XK9A 4NPPA 3LSVA 3SIOA 2WNJA 2Y57A 5HEHA 2PH9A 4QABA 4ALXA 2XQ6A 4B5DA 5SYOA 2VL0A 2WNCA 1UW6A 3T4MA 5HCMA 2XNUA 3SQ9A 4COFA 4A98A 2UZ6A 2XQ3A 3TLSA 2XNTA 4DBMA 5L4EA 4ZZCA 2ZJUA 4D01A 3UU8A 3TLTA 4QH1A 4UM1A 2XYTA 3RQUA 3ZKRA 5LG3A 4HFDA 5AFMA 2XNVA 3ZDGA 4QACA 3U8JA 3WTHA 3UU6A 2WNLA 3P50A 4HFHA 4NZBA 4WV9A 5TVCA 5HEOA 3U8KA 5J5IA 3JAFA 2BYQA 3RI5A 5IUXA 2XQAA 4XHEA 2Y58A 5J0ZA 4UM3P 4BQTA 3WTJA 2WN9A 4ZK4A 2BG9A 2BG9B 2XQ5A 2YMEA 2BYSA 3IGQA 4ILAA 4BFQA 3EAMA 2Y54A 5BRXA 2BR7A 2XZ5A 4UY2A 3RHWA 2C9TA 3UQ4A 2BR8A 2XQ7A 5J5HA 3PEOA 4HFCA 4LMKA 5L47A 2YKSA 3JAEA 4FRRA 2X00A 3RIAA 3WIPA 5LXBA 2YN6A 4ZRUA 4ILCA 2QC1B 3P4WA 3WTIA 3ZDHA 5KZUA 4IREA 3WTMA 3U8LA 2Y7YA 5HEGA 5AFLA 4PIRA 3RIFA 5AFKA 3UQ7A 3RQWA 4UM3A 3U8NA 5FJVA 4ILBA 5BW2A 4TWDA 4QH5A 2PGZA 2YMDA 5HEJA 4TNWA 5AFHA 5AINA 4AFTA 1UV6A 3JADA 4LMJA 3PMZA 4TWHA 2XQ4A 3SQ6A 3UU4A 4EZ1A 2BG9C 2WZYA 3UU5A 5KE4A 5BP0A 4ZJTA 2BYRA 4UM3S 5L4HA 4X5TA 4HFEA 2BG9E 2XQ9A 1UX2A 5J5FA 3EHZA 4HFBA 4HFIA 4IL9A 3UUBA 2BYNA 4AFGA 4AFHA 4LMLA 2BYPA 4Z90A 4HQPA 4ZZBA 3EI0A 4TWFA 5J5GA 3UU3A 4QH4A 4ZR6A 4UXUA 5CFBA 1I9BA 4IL4A 4Z91A 2Y56A 3SH1A 2ZJVA 4F8HA 5JMEA 3WTKA 2BJ0A
chains in the Genus database with same CATH topology
2X00D 3WTOA 5HCJA 5CO5A 2W8FA 3TLVA 5AFNA 3C79A 5HEUA 3TLWA 3WTNA 4QAAA 2YOEA 4ZJSA 3TLUA 2XYSA 4A97A 3WTLA 3U8MA 4ZK1A 2W8GA 2XQ8A 3GUAA 4TNVA 2XZ6A 3C84A 5AFJA 5AFMB 4XK9A 4NPPA 3LSVA 3SIOA 2WNJA 2Y57A 5HEHA 2PH9A 4QABA 4ALXA 2XQ6A 4B5DA 5SYOA 2VL0A 2WNCA 1UW6A 3T4MA 5HCMA 2XNUA 3SQ9A 4COFA 4A98A 2UZ6A 2XQ3A 3TLSA 2XNTA 4DBMA 5L4EA 4ZZCA 2ZJUA 4D01A 3UU8A 3TLTA 4QH1A 4UM1A 2XYTA 3RQUA 3ZKRA 5LG3A 4HFDA 5AFMA 2XNVA 3ZDGA 4QACA 3U8JA 3WTHA 3UU6A 2WNLA 3P50A 4HFHA 4NZBA 4WV9A 5TVCA 5HEOA 3U8KA 5J5IA 3JAFA 2BYQA 3RI5A 5IUXA 2XQAA 4XHEA 2Y58A 5J0ZA 4UM3P 4BQTA 3WTJA 2WN9A 4ZK4A 2BG9A 2BG9B 2XQ5A 2YMEA 2BYSA 3IGQA 4ILAA 4BFQA 3EAMA 2Y54A 5BRXA 2BR7A 2XZ5A 4UY2A 3RHWA 2C9TA 3UQ4A 2BR8A 2XQ7A 5J5HA 3PEOA 4HFCA 4LMKA 5L47A 2YKSA 3JAEA 4FRRA 2X00A 3RIAA 3WIPA 5LXBA 2YN6A 4ZRUA 4ILCA 2QC1B 3P4WA 3WTIA 3ZDHA 5KZUA 4IREA 3WTMA 3U8LA 2Y7YA 5HEGA 5AFLA 4PIRA 3RIFA 5AFKA 3UQ7A 3RQWA 4UM3A 3U8NA 5FJVA 4ILBA 5BW2A 4TWDA 4QH5A 2PGZA 2YMDA 5HEJA 4TNWA 5AFHA 5AINA 4AFTA 1UV6A 3JADA 4LMJA 3PMZA 4TWHA 2XQ4A 3SQ6A 3UU4A 4EZ1A 2BG9C 2WZYA 3UU5A 5KE4A 5BP0A 4ZJTA 2BYRA 4UM3S 5L4HA 4X5TA 4HFEA 2BG9E 2XQ9A 1UX2A 5J5FA 3EHZA 4HFBA 4HFIA 4IL9A 3UUBA 2BYNA 4AFGA 4AFHA 4LMLA 2BYPA 4Z90A 4HQPA 4ZZBA 3EI0A 4TWFA 5J5GA 3UU3A 4QH4A 4ZR6A 4UXUA 5CFBA 1I9BA 4IL4A 4Z91A 2Y56A 3SH1A 2ZJVA 4F8HA 5JMEA 3WTKA 2BJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X00 D;  3WTO A;  5HCJ A;  5CO5 A;  2W8F A;  3TLV A;  5AFN A;  3C79 A;  5HEU A;  3TLW A;  3WTN A;  4QAA A;  2YOE A;  4ZJS A;  3TLU A;  2XYS A;  4A97 A;  3WTL A;  3U8M A;  4ZK1 A;  2W8G A;  2XQ8 A;  3GUA A;  4TNV A;  2XZ6 A;  3C84 A;  5AFJ A;  5AFM B;  4XK9 A;  4NPP A;  3LSV A;  3SIO A;  2WNJ A;  2Y57 A;  5HEH A;  2PH9 A;  4QAB A;  4ALX A;  2XQ6 A;  4B5D A;  5SYO A;  2VL0 A;  2WNC A;  1UW6 A;  3T4M A;  5HCM A;  2XNU A;  3SQ9 A;  4COF A;  4A98 A;  2UZ6 A;  2XQ3 A;  3TLS A;  2XNT A;  4DBM A;  5L4E A;  4ZZC A;  2ZJU A;  4D01 A;  3UU8 A;  3TLT A;  4QH1 A;  4UM1 A;  2XYT A;  3RQU A;  3ZKR A;  5LG3 A;  4HFD A;  5AFM A;  2XNV A;  3ZDG A;  4QAC A;  3U8J A;  3WTH A;  3UU6 A;  2WNL A;  3P50 A;  4HFH A;  4NZB A;  4WV9 A;  5TVC A;  5HEO A;  3U8K A;  5J5I A;  3JAF A;  2BYQ A;  3RI5 A;  5IUX A;  2XQA A;  4XHE A;  2Y58 A;  5J0Z A;  4UM3 P;  4BQT A;  3WTJ A;  2WN9 A;  4ZK4 A;  2BG9 A;  2BG9 B;  2XQ5 A;  2YME A;  2BYS A;  3IGQ A;  4ILA A;  4BFQ A;  3EAM A;  2Y54 A;  5BRX A;  2BR7 A;  2XZ5 A;  4UY2 A;  3RHW A;  2C9T A;  3UQ4 A;  2BR8 A;  2XQ7 A;  5J5H A;  3PEO A;  4HFC A;  4LMK A;  5L47 A;  2YKS A;  3JAE A;  4FRR A;  2X00 A;  3RIA A;  3WIP A;  5LXB A;  2YN6 A;  4ZRU A;  4ILC A;  2QC1 B;  3P4W A;  3WTI A;  3ZDH A;  5KZU A;  4IRE A;  3WTM A;  3U8L A;  2Y7Y A;  5HEG A;  5AFL A;  4PIR A;  3RIF A;  5AFK A;  3UQ7 A;  3RQW A;  4UM3 A;  3U8N A;  5FJV A;  4ILB A;  5BW2 A;  4TWD A;  4QH5 A;  2PGZ A;  2YMD A;  5HEJ A;  4TNW A;  5AFH A;  5AIN A;  4AFT A;  1UV6 A;  3JAD A;  4LMJ A;  3PMZ A;  4TWH A;  2XQ4 A;  3SQ6 A;  3UU4 A;  4EZ1 A;  2BG9 C;  2WZY A;  3UU5 A;  5KE4 A;  5BP0 A;  4ZJT A;  2BYR A;  4UM3 S;  5L4H A;  4X5T A;  4HFE A;  2BG9 E;  2XQ9 A;  1UX2 A;  5J5F A;  3EHZ A;  4HFB A;  4HFI A;  4IL9 A;  3UUB A;  2BYN A;  4AFG A;  4AFH A;  4LML A;  2BYP A;  4Z90 A;  4HQP A;  4ZZB A;  3EI0 A;  4TWF A;  5J5G A;  3UU3 A;  4QH4 A;  4ZR6 A;  4UXU A;  5CFB A;  1I9B A;  4IL4 A;  4Z91 A;  2Y56 A;  3SH1 A;  2ZJV A;  4F8H A;  5JME A;  3WTK A;  2BJ0 A; 
#chains in the Genus database with same CATH topology
 2X00 D;  3WTO A;  5HCJ A;  5CO5 A;  2W8F A;  3TLV A;  5AFN A;  3C79 A;  5HEU A;  3TLW A;  3WTN A;  4QAA A;  2YOE A;  4ZJS A;  3TLU A;  2XYS A;  4A97 A;  3WTL A;  3U8M A;  4ZK1 A;  2W8G A;  2XQ8 A;  3GUA A;  4TNV A;  2XZ6 A;  3C84 A;  5AFJ A;  5AFM B;  4XK9 A;  4NPP A;  3LSV A;  3SIO A;  2WNJ A;  2Y57 A;  5HEH A;  2PH9 A;  4QAB A;  4ALX A;  2XQ6 A;  4B5D A;  5SYO A;  2VL0 A;  2WNC A;  1UW6 A;  3T4M A;  5HCM A;  2XNU A;  3SQ9 A;  4COF A;  4A98 A;  2UZ6 A;  2XQ3 A;  3TLS A;  2XNT A;  4DBM A;  5L4E A;  4ZZC A;  2ZJU A;  4D01 A;  3UU8 A;  3TLT A;  4QH1 A;  4UM1 A;  2XYT A;  3RQU A;  3ZKR A;  5LG3 A;  4HFD A;  5AFM A;  2XNV A;  3ZDG A;  4QAC A;  3U8J A;  3WTH A;  3UU6 A;  2WNL A;  3P50 A;  4HFH A;  4NZB A;  4WV9 A;  5TVC A;  5HEO A;  3U8K A;  5J5I A;  3JAF A;  2BYQ A;  3RI5 A;  5IUX A;  2XQA A;  4XHE A;  2Y58 A;  5J0Z A;  4UM3 P;  4BQT A;  3WTJ A;  2WN9 A;  4ZK4 A;  2BG9 A;  2BG9 B;  2XQ5 A;  2YME A;  2BYS A;  3IGQ A;  4ILA A;  4BFQ A;  3EAM A;  2Y54 A;  5BRX A;  2BR7 A;  2XZ5 A;  4UY2 A;  3RHW A;  2C9T A;  3UQ4 A;  2BR8 A;  2XQ7 A;  5J5H A;  3PEO A;  4HFC A;  4LMK A;  5L47 A;  2YKS A;  3JAE A;  4FRR A;  2X00 A;  3RIA A;  3WIP A;  5LXB A;  2YN6 A;  4ZRU A;  4ILC A;  2QC1 B;  3P4W A;  3WTI A;  3ZDH A;  5KZU A;  4IRE A;  3WTM A;  3U8L A;  2Y7Y A;  5HEG A;  5AFL A;  4PIR A;  3RIF A;  5AFK A;  3UQ7 A;  3RQW A;  4UM3 A;  3U8N A;  5FJV A;  4ILB A;  5BW2 A;  4TWD A;  4QH5 A;  2PGZ A;  2YMD A;  5HEJ A;  4TNW A;  5AFH A;  5AIN A;  4AFT A;  1UV6 A;  3JAD A;  4LMJ A;  3PMZ A;  4TWH A;  2XQ4 A;  3SQ6 A;  3UU4 A;  4EZ1 A;  2BG9 C;  2WZY A;  3UU5 A;  5KE4 A;  5BP0 A;  4ZJT A;  2BYR A;  4UM3 S;  5L4H A;  4X5T A;  4HFE A;  2BG9 E;  2XQ9 A;  1UX2 A;  5J5F A;  3EHZ A;  4HFB A;  4HFI A;  4IL9 A;  3UUB A;  2BYN A;  4AFG A;  4AFH A;  4LML A;  2BYP A;  4Z90 A;  4HQP A;  4ZZB A;  3EI0 A;  4TWF A;  5J5G A;  3UU3 A;  4QH4 A;  4ZR6 A;  4UXU A;  5CFB A;  1I9B A;  4IL4 A;  4Z91 A;  2Y56 A;  3SH1 A;  2ZJV A;  4F8H A;  5JME A;  3WTK A;  2BJ0 A; 
#chains in the Genus database with same CATH homology
 2X00 D;  3WTO A;  5HCJ A;  5CO5 A;  2W8F A;  3TLV A;  5AFN A;  3C79 A;  5HEU A;  3TLW A;  3WTN A;  4QAA A;  2YOE A;  4ZJS A;  3TLU A;  2XYS A;  4A97 A;  3WTL A;  3U8M A;  4ZK1 A;  2W8G A;  2XQ8 A;  3GUA A;  4TNV A;  2XZ6 A;  3C84 A;  5AFJ A;  5AFM B;  4XK9 A;  4NPP A;  3LSV A;  3SIO A;  2WNJ A;  2Y57 A;  5HEH A;  2PH9 A;  4QAB A;  4ALX A;  2XQ6 A;  4B5D A;  5SYO A;  2VL0 A;  2WNC A;  1UW6 A;  3T4M A;  5HCM A;  2XNU A;  3SQ9 A;  4COF A;  4A98 A;  2UZ6 A;  2XQ3 A;  3TLS A;  2XNT A;  4DBM A;  5L4E A;  4ZZC A;  2ZJU A;  4D01 A;  3UU8 A;  3TLT A;  4QH1 A;  4UM1 A;  2XYT A;  3RQU A;  3ZKR A;  5LG3 A;  4HFD A;  5AFM A;  2XNV A;  3ZDG A;  4QAC A;  3U8J A;  3WTH A;  3UU6 A;  2WNL A;  3P50 A;  4HFH A;  4NZB A;  4WV9 A;  5TVC A;  5HEO A;  3U8K A;  5J5I A;  3JAF A;  2BYQ A;  3RI5 A;  5IUX A;  2XQA A;  4XHE A;  2Y58 A;  5J0Z A;  4UM3 P;  4BQT A;  3WTJ A;  2WN9 A;  4ZK4 A;  2BG9 A;  2BG9 B;  2XQ5 A;  2YME A;  2BYS A;  3IGQ A;  4ILA A;  4BFQ A;  3EAM A;  2Y54 A;  5BRX A;  2BR7 A;  2XZ5 A;  4UY2 A;  3RHW A;  2C9T A;  3UQ4 A;  2BR8 A;  2XQ7 A;  5J5H A;  3PEO A;  4HFC A;  4LMK A;  5L47 A;  2YKS A;  3JAE A;  4FRR A;  2X00 A;  3RIA A;  3WIP A;  5LXB A;  2YN6 A;  4ZRU A;  4ILC A;  2QC1 B;  3P4W A;  3WTI A;  3ZDH A;  5KZU A;  4IRE A;  3WTM A;  3U8L A;  2Y7Y A;  5HEG A;  5AFL A;  4PIR A;  3RIF A;  5AFK A;  3UQ7 A;  3RQW A;  4UM3 A;  3U8N A;  5FJV A;  4ILB A;  5BW2 A;  4TWD A;  4QH5 A;  2PGZ A;  2YMD A;  5HEJ A;  4TNW A;  5AFH A;  5AIN A;  4AFT A;  1UV6 A;  3JAD A;  4LMJ A;  3PMZ A;  4TWH A;  2XQ4 A;  3SQ6 A;  3UU4 A;  4EZ1 A;  2BG9 C;  2WZY A;  3UU5 A;  5KE4 A;  5BP0 A;  4ZJT A;  2BYR A;  4UM3 S;  5L4H A;  4X5T A;  4HFE A;  2BG9 E;  2XQ9 A;  1UX2 A;  5J5F A;  3EHZ A;  4HFB A;  4HFI A;  4IL9 A;  3UUB A;  2BYN A;  4AFG A;  4AFH A;  4LML A;  2BYP A;  4Z90 A;  4HQP A;  4ZZB A;  3EI0 A;  4TWF A;  5J5G A;  3UU3 A;  4QH4 A;  4ZR6 A;  4UXU A;  5CFB A;  1I9B A;  4IL4 A;  4Z91 A;  2Y56 A;  3SH1 A;  2ZJV A;  4F8H A;  5JME A;  3WTK A;  2BJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...