5AFJA

Alpha7-achbp in complex with lobeline and fragment 1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
204
structure length
204
Chain Sequence
EFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 204
sequence length 204
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afjA00
1UX2A 4LMKA 5L4HA 2WNJA 5HEOA 3RIFA 5BRXA 3RI5A 4HQPA 3JADA 4QH5A 4HFHA 5HCMA 5LG3A 2BJ0A 4HFCA 3UQ7A 3SQ9A 5AFKA 5TVCA 1I9BA 2YN6A 4UM3S 2XQ8A 2XNUA 3SQ6A 3UU6A 2BG9C 4LMJA 5IUXA 5KE4A 2WNCA 3C84A 4UM3P 4HFDA 2YKSA 3TLUA 3TLTA 3U8NA 2WZYA 2XNVA 2XQ9A 4X5TA 2W8GA 3RQWA 2XQ3A 2X00A 4ZRUA 2BG9A 2XQ7A 4EZ1A 2C9TA 2WNLA 3JAFA 2XNTA 3EHZA 4QH4A 4UY2A 5HEGA 3SH1A 2BYNA 3ZDGA 4A97A 4BFQA 3WTJA 2BG9E 3UU3A 3WTIA 3C79A 2XQ5A 3U8KA 4A98A 2VL0A 2XZ5A 4AFHA 4TNWA 2XQ4A 2YMEA 3WTOA 3TLWA 4FRRA 4DBMA 3RQUA 4Z90A 3UU8A 3WTMA 5L4EA 5CFBA 3TLSA 3UU5A 4ILAA 3T4MA 4UM1A 5AINA 4UM3A 5J5FA 5JMEA 4QACA 5J0ZA 3U8LA 3WTNA 1UV6A 3P50A 2XQAA 4HFBA 3WTKA 4BQTA 3TLVA 5J5HA 5LXBA 2WN9A 2BG9B 4NPPA 2W8FA 5BP0A 2BYQA 2BYRA 5AFMA 5J5IA 2UZ6A 4LMLA 5HEHA 3PMZA 5KZUA 2BYPA 4TNVA 4ZJTA 4XHEA 2YOEA 3EI0A 2XYTA 3LSVA 4WV9A 3WTLA 2QC1B 1UW6A 3U8JA 3ZDHA 4AFTA 2ZJUA 3RHWA 4B5DA 3U8MA 4COFA 2XZ6A 2Y56A 3UU4A 5AFNA 2BR8A 5FJVA 5SYOA 2XQ6A 3P4WA 3WIPA 5HEJA 3JAEA 5AFMB 2Y54A 3PEOA 4ZK4A 4IREA 4ILCA 4Z91A 3RIAA 2ZJVA 2BR7A 4QH1A 3ZKRA 5CO5A 3IGQA 4D01A 5AFHA 3UQ4A 4HFIA 4PIRA 4ALXA 4XK9A 4QABA 4UXUA 2PGZA 5HCJA 5AFJA 4NZBA 2YMDA 4HFEA 4IL9A 4QAAA 3WTHA 5L47A 2BYSA 4AFGA 2Y7YA 4ZR6A 4TWHA 3UUBA 2Y58A 2Y57A 2X00D 5BW2A 5HEUA 5J5GA 4TWFA 4ZZBA 2XYSA 4ZZCA 4TWDA 3EAMA 4F8HA 4ZK1A 3GUAA 2PH9A 3SIOA 5AFLA 4IL4A 4ZJSA 4ILBA
chains in the Genus database with same CATH superfamily
1UX2A 4LMKA 5L4HA 2WNJA 5HEOA 3RIFA 5BRXA 3RI5A 4HQPA 3JADA 4QH5A 4HFHA 5HCMA 5LG3A 2BJ0A 4HFCA 3UQ7A 3SQ9A 5AFKA 5TVCA 1I9BA 2YN6A 4UM3S 2XQ8A 2XNUA 3SQ6A 3UU6A 2BG9C 4LMJA 5IUXA 5KE4A 2WNCA 3C84A 4UM3P 4HFDA 2YKSA 3TLUA 3TLTA 3U8NA 2WZYA 2XNVA 2XQ9A 4X5TA 2W8GA 3RQWA 2XQ3A 2X00A 4ZRUA 2BG9A 2XQ7A 4EZ1A 2C9TA 2WNLA 3JAFA 2XNTA 3EHZA 4QH4A 4UY2A 5HEGA 3SH1A 2BYNA 3ZDGA 4A97A 4BFQA 3WTJA 2BG9E 3UU3A 3WTIA 3C79A 2XQ5A 3U8KA 4A98A 2VL0A 2XZ5A 4AFHA 4TNWA 2XQ4A 2YMEA 3WTOA 3TLWA 4FRRA 4DBMA 3RQUA 4Z90A 3UU8A 3WTMA 5L4EA 5CFBA 3TLSA 3UU5A 4ILAA 3T4MA 4UM1A 5AINA 4UM3A 5J5FA 5JMEA 4QACA 5J0ZA 3U8LA 3WTNA 1UV6A 3P50A 2XQAA 4HFBA 3WTKA 4BQTA 3TLVA 5J5HA 5LXBA 2WN9A 2BG9B 4NPPA 2W8FA 5BP0A 2BYQA 2BYRA 5AFMA 5J5IA 2UZ6A 4LMLA 5HEHA 3PMZA 5KZUA 2BYPA 4TNVA 4ZJTA 4XHEA 2YOEA 3EI0A 2XYTA 3LSVA 4WV9A 3WTLA 2QC1B 1UW6A 3U8JA 3ZDHA 4AFTA 2ZJUA 3RHWA 4B5DA 3U8MA 4COFA 2XZ6A 2Y56A 3UU4A 5AFNA 2BR8A 5FJVA 5SYOA 2XQ6A 3P4WA 3WIPA 5HEJA 3JAEA 5AFMB 2Y54A 3PEOA 4ZK4A 4IREA 4ILCA 4Z91A 3RIAA 2ZJVA 2BR7A 4QH1A 3ZKRA 5CO5A 3IGQA 4D01A 5AFHA 3UQ4A 4HFIA 4PIRA 4ALXA 4XK9A 4QABA 4UXUA 2PGZA 5HCJA 5AFJA 4NZBA 2YMDA 4HFEA 4IL9A 4QAAA 3WTHA 5L47A 2BYSA 4AFGA 2Y7YA 4ZR6A 4TWHA 3UUBA 2Y58A 2Y57A 2X00D 5BW2A 5HEUA 5J5GA 4TWFA 4ZZBA 2XYSA 4ZZCA 4TWDA 3EAMA 4F8HA 4ZK1A 3GUAA 2PH9A 3SIOA 5AFLA 4IL4A 4ZJSA 4ILBA
chains in the Genus database with same CATH topology
1UX2A 4LMKA 5L4HA 2WNJA 5HEOA 3RIFA 5BRXA 3RI5A 4HQPA 3JADA 4QH5A 4HFHA 5HCMA 5LG3A 2BJ0A 4HFCA 3UQ7A 3SQ9A 5AFKA 5TVCA 1I9BA 2YN6A 4UM3S 2XQ8A 2XNUA 3SQ6A 3UU6A 2BG9C 4LMJA 5IUXA 5KE4A 2WNCA 3C84A 4UM3P 4HFDA 2YKSA 3TLUA 3TLTA 3U8NA 2WZYA 2XNVA 2XQ9A 4X5TA 2W8GA 3RQWA 2XQ3A 2X00A 4ZRUA 2BG9A 2XQ7A 4EZ1A 2C9TA 2WNLA 3JAFA 2XNTA 3EHZA 4QH4A 4UY2A 5HEGA 3SH1A 2BYNA 3ZDGA 4A97A 4BFQA 3WTJA 2BG9E 3UU3A 3WTIA 3C79A 2XQ5A 3U8KA 4A98A 2VL0A 2XZ5A 4AFHA 4TNWA 2XQ4A 2YMEA 3WTOA 3TLWA 4FRRA 4DBMA 3RQUA 4Z90A 3UU8A 3WTMA 5L4EA 5CFBA 3TLSA 3UU5A 4ILAA 3T4MA 4UM1A 5AINA 4UM3A 5J5FA 5JMEA 4QACA 5J0ZA 3U8LA 3WTNA 1UV6A 3P50A 2XQAA 4HFBA 3WTKA 4BQTA 3TLVA 5J5HA 5LXBA 2WN9A 2BG9B 4NPPA 2W8FA 5BP0A 2BYQA 2BYRA 5AFMA 5J5IA 2UZ6A 4LMLA 5HEHA 3PMZA 5KZUA 2BYPA 4TNVA 4ZJTA 4XHEA 2YOEA 3EI0A 2XYTA 3LSVA 4WV9A 3WTLA 2QC1B 1UW6A 3U8JA 3ZDHA 4AFTA 2ZJUA 3RHWA 4B5DA 3U8MA 4COFA 2XZ6A 2Y56A 3UU4A 5AFNA 2BR8A 5FJVA 5SYOA 2XQ6A 3P4WA 3WIPA 5HEJA 3JAEA 5AFMB 2Y54A 3PEOA 4ZK4A 4IREA 4ILCA 4Z91A 3RIAA 2ZJVA 2BR7A 4QH1A 3ZKRA 5CO5A 3IGQA 4D01A 5AFHA 3UQ4A 4HFIA 4PIRA 4ALXA 4XK9A 4QABA 4UXUA 2PGZA 5HCJA 5AFJA 4NZBA 2YMDA 4HFEA 4IL9A 4QAAA 3WTHA 5L47A 2BYSA 4AFGA 2Y7YA 4ZR6A 4TWHA 3UUBA 2Y58A 2Y57A 2X00D 5BW2A 5HEUA 5J5GA 4TWFA 4ZZBA 2XYSA 4ZZCA 4TWDA 3EAMA 4F8HA 4ZK1A 3GUAA 2PH9A 3SIOA 5AFLA 4IL4A 4ZJSA 4ILBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UX2 A;  4LMK A;  5L4H A;  2WNJ A;  5HEO A;  3RIF A;  5BRX A;  3RI5 A;  4HQP A;  3JAD A;  4QH5 A;  4HFH A;  5HCM A;  5LG3 A;  2BJ0 A;  4HFC A;  3UQ7 A;  3SQ9 A;  5AFK A;  5TVC A;  1I9B A;  2YN6 A;  4UM3 S;  2XQ8 A;  2XNU A;  3SQ6 A;  3UU6 A;  2BG9 C;  4LMJ A;  5IUX A;  5KE4 A;  2WNC A;  3C84 A;  4UM3 P;  4HFD A;  2YKS A;  3TLU A;  3TLT A;  3U8N A;  2WZY A;  2XNV A;  2XQ9 A;  4X5T A;  2W8G A;  3RQW A;  2XQ3 A;  2X00 A;  4ZRU A;  2BG9 A;  2XQ7 A;  4EZ1 A;  2C9T A;  2WNL A;  3JAF A;  2XNT A;  3EHZ A;  4QH4 A;  4UY2 A;  5HEG A;  3SH1 A;  2BYN A;  3ZDG A;  4A97 A;  4BFQ A;  3WTJ A;  2BG9 E;  3UU3 A;  3WTI A;  3C79 A;  2XQ5 A;  3U8K A;  4A98 A;  2VL0 A;  2XZ5 A;  4AFH A;  4TNW A;  2XQ4 A;  2YME A;  3WTO A;  3TLW A;  4FRR A;  4DBM A;  3RQU A;  4Z90 A;  3UU8 A;  3WTM A;  5L4E A;  5CFB A;  3TLS A;  3UU5 A;  4ILA A;  3T4M A;  4UM1 A;  5AIN A;  4UM3 A;  5J5F A;  5JME A;  4QAC A;  5J0Z A;  3U8L A;  3WTN A;  1UV6 A;  3P50 A;  2XQA A;  4HFB A;  3WTK A;  4BQT A;  3TLV A;  5J5H A;  5LXB A;  2WN9 A;  2BG9 B;  4NPP A;  2W8F A;  5BP0 A;  2BYQ A;  2BYR A;  5AFM A;  5J5I A;  2UZ6 A;  4LML A;  5HEH A;  3PMZ A;  5KZU A;  2BYP A;  4TNV A;  4ZJT A;  4XHE A;  2YOE A;  3EI0 A;  2XYT A;  3LSV A;  4WV9 A;  3WTL A;  2QC1 B;  1UW6 A;  3U8J A;  3ZDH A;  4AFT A;  2ZJU A;  3RHW A;  4B5D A;  3U8M A;  4COF A;  2XZ6 A;  2Y56 A;  3UU4 A;  5AFN A;  2BR8 A;  5FJV A;  5SYO A;  2XQ6 A;  3P4W A;  3WIP A;  5HEJ A;  3JAE A;  5AFM B;  2Y54 A;  3PEO A;  4ZK4 A;  4IRE A;  4ILC A;  4Z91 A;  3RIA A;  2ZJV A;  2BR7 A;  4QH1 A;  3ZKR A;  5CO5 A;  3IGQ A;  4D01 A;  5AFH A;  3UQ4 A;  4HFI A;  4PIR A;  4ALX A;  4XK9 A;  4QAB A;  4UXU A;  2PGZ A;  5HCJ A;  5AFJ A;  4NZB A;  2YMD A;  4HFE A;  4IL9 A;  4QAA A;  3WTH A;  5L47 A;  2BYS A;  4AFG A;  2Y7Y A;  4ZR6 A;  4TWH A;  3UUB A;  2Y58 A;  2Y57 A;  2X00 D;  5BW2 A;  5HEU A;  5J5G A;  4TWF A;  4ZZB A;  2XYS A;  4ZZC A;  4TWD A;  3EAM A;  4F8H A;  4ZK1 A;  3GUA A;  2PH9 A;  3SIO A;  5AFL A;  4IL4 A;  4ZJS A;  4ILB A; 
#chains in the Genus database with same CATH topology
 1UX2 A;  4LMK A;  5L4H A;  2WNJ A;  5HEO A;  3RIF A;  5BRX A;  3RI5 A;  4HQP A;  3JAD A;  4QH5 A;  4HFH A;  5HCM A;  5LG3 A;  2BJ0 A;  4HFC A;  3UQ7 A;  3SQ9 A;  5AFK A;  5TVC A;  1I9B A;  2YN6 A;  4UM3 S;  2XQ8 A;  2XNU A;  3SQ6 A;  3UU6 A;  2BG9 C;  4LMJ A;  5IUX A;  5KE4 A;  2WNC A;  3C84 A;  4UM3 P;  4HFD A;  2YKS A;  3TLU A;  3TLT A;  3U8N A;  2WZY A;  2XNV A;  2XQ9 A;  4X5T A;  2W8G A;  3RQW A;  2XQ3 A;  2X00 A;  4ZRU A;  2BG9 A;  2XQ7 A;  4EZ1 A;  2C9T A;  2WNL A;  3JAF A;  2XNT A;  3EHZ A;  4QH4 A;  4UY2 A;  5HEG A;  3SH1 A;  2BYN A;  3ZDG A;  4A97 A;  4BFQ A;  3WTJ A;  2BG9 E;  3UU3 A;  3WTI A;  3C79 A;  2XQ5 A;  3U8K A;  4A98 A;  2VL0 A;  2XZ5 A;  4AFH A;  4TNW A;  2XQ4 A;  2YME A;  3WTO A;  3TLW A;  4FRR A;  4DBM A;  3RQU A;  4Z90 A;  3UU8 A;  3WTM A;  5L4E A;  5CFB A;  3TLS A;  3UU5 A;  4ILA A;  3T4M A;  4UM1 A;  5AIN A;  4UM3 A;  5J5F A;  5JME A;  4QAC A;  5J0Z A;  3U8L A;  3WTN A;  1UV6 A;  3P50 A;  2XQA A;  4HFB A;  3WTK A;  4BQT A;  3TLV A;  5J5H A;  5LXB A;  2WN9 A;  2BG9 B;  4NPP A;  2W8F A;  5BP0 A;  2BYQ A;  2BYR A;  5AFM A;  5J5I A;  2UZ6 A;  4LML A;  5HEH A;  3PMZ A;  5KZU A;  2BYP A;  4TNV A;  4ZJT A;  4XHE A;  2YOE A;  3EI0 A;  2XYT A;  3LSV A;  4WV9 A;  3WTL A;  2QC1 B;  1UW6 A;  3U8J A;  3ZDH A;  4AFT A;  2ZJU A;  3RHW A;  4B5D A;  3U8M A;  4COF A;  2XZ6 A;  2Y56 A;  3UU4 A;  5AFN A;  2BR8 A;  5FJV A;  5SYO A;  2XQ6 A;  3P4W A;  3WIP A;  5HEJ A;  3JAE A;  5AFM B;  2Y54 A;  3PEO A;  4ZK4 A;  4IRE A;  4ILC A;  4Z91 A;  3RIA A;  2ZJV A;  2BR7 A;  4QH1 A;  3ZKR A;  5CO5 A;  3IGQ A;  4D01 A;  5AFH A;  3UQ4 A;  4HFI A;  4PIR A;  4ALX A;  4XK9 A;  4QAB A;  4UXU A;  2PGZ A;  5HCJ A;  5AFJ A;  4NZB A;  2YMD A;  4HFE A;  4IL9 A;  4QAA A;  3WTH A;  5L47 A;  2BYS A;  4AFG A;  2Y7Y A;  4ZR6 A;  4TWH A;  3UUB A;  2Y58 A;  2Y57 A;  2X00 D;  5BW2 A;  5HEU A;  5J5G A;  4TWF A;  4ZZB A;  2XYS A;  4ZZC A;  4TWD A;  3EAM A;  4F8H A;  4ZK1 A;  3GUA A;  2PH9 A;  3SIO A;  5AFL A;  4IL4 A;  4ZJS A;  4ILB A; 
#chains in the Genus database with same CATH homology
 1UX2 A;  4LMK A;  5L4H A;  2WNJ A;  5HEO A;  3RIF A;  5BRX A;  3RI5 A;  4HQP A;  3JAD A;  4QH5 A;  4HFH A;  5HCM A;  5LG3 A;  2BJ0 A;  4HFC A;  3UQ7 A;  3SQ9 A;  5AFK A;  5TVC A;  1I9B A;  2YN6 A;  4UM3 S;  2XQ8 A;  2XNU A;  3SQ6 A;  3UU6 A;  2BG9 C;  4LMJ A;  5IUX A;  5KE4 A;  2WNC A;  3C84 A;  4UM3 P;  4HFD A;  2YKS A;  3TLU A;  3TLT A;  3U8N A;  2WZY A;  2XNV A;  2XQ9 A;  4X5T A;  2W8G A;  3RQW A;  2XQ3 A;  2X00 A;  4ZRU A;  2BG9 A;  2XQ7 A;  4EZ1 A;  2C9T A;  2WNL A;  3JAF A;  2XNT A;  3EHZ A;  4QH4 A;  4UY2 A;  5HEG A;  3SH1 A;  2BYN A;  3ZDG A;  4A97 A;  4BFQ A;  3WTJ A;  2BG9 E;  3UU3 A;  3WTI A;  3C79 A;  2XQ5 A;  3U8K A;  4A98 A;  2VL0 A;  2XZ5 A;  4AFH A;  4TNW A;  2XQ4 A;  2YME A;  3WTO A;  3TLW A;  4FRR A;  4DBM A;  3RQU A;  4Z90 A;  3UU8 A;  3WTM A;  5L4E A;  5CFB A;  3TLS A;  3UU5 A;  4ILA A;  3T4M A;  4UM1 A;  5AIN A;  4UM3 A;  5J5F A;  5JME A;  4QAC A;  5J0Z A;  3U8L A;  3WTN A;  1UV6 A;  3P50 A;  2XQA A;  4HFB A;  3WTK A;  4BQT A;  3TLV A;  5J5H A;  5LXB A;  2WN9 A;  2BG9 B;  4NPP A;  2W8F A;  5BP0 A;  2BYQ A;  2BYR A;  5AFM A;  5J5I A;  2UZ6 A;  4LML A;  5HEH A;  3PMZ A;  5KZU A;  2BYP A;  4TNV A;  4ZJT A;  4XHE A;  2YOE A;  3EI0 A;  2XYT A;  3LSV A;  4WV9 A;  3WTL A;  2QC1 B;  1UW6 A;  3U8J A;  3ZDH A;  4AFT A;  2ZJU A;  3RHW A;  4B5D A;  3U8M A;  4COF A;  2XZ6 A;  2Y56 A;  3UU4 A;  5AFN A;  2BR8 A;  5FJV A;  5SYO A;  2XQ6 A;  3P4W A;  3WIP A;  5HEJ A;  3JAE A;  5AFM B;  2Y54 A;  3PEO A;  4ZK4 A;  4IRE A;  4ILC A;  4Z91 A;  3RIA A;  2ZJV A;  2BR7 A;  4QH1 A;  3ZKR A;  5CO5 A;  3IGQ A;  4D01 A;  5AFH A;  3UQ4 A;  4HFI A;  4PIR A;  4ALX A;  4XK9 A;  4QAB A;  4UXU A;  2PGZ A;  5HCJ A;  5AFJ A;  4NZB A;  2YMD A;  4HFE A;  4IL9 A;  4QAA A;  3WTH A;  5L47 A;  2BYS A;  4AFG A;  2Y7Y A;  4ZR6 A;  4TWH A;  3UUB A;  2Y58 A;  2Y57 A;  2X00 D;  5BW2 A;  5HEU A;  5J5G A;  4TWF A;  4ZZB A;  2XYS A;  4ZZC A;  4TWD A;  3EAM A;  4F8H A;  4ZK1 A;  3GUA A;  2PH9 A;  3SIO A;  5AFL A;  4IL4 A;  4ZJS A;  4ILB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...