4FRRA

X-ray structure of acetylcholine binding protein from aplysia californica in presence of 3-((s)-azetidin-2-ylmethoxy)-5-((1s,2r)-2-(2-methoxyethyl)cyclopropyl)pyridine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
209
structure length
208
Chain Sequence
LHSQANLMRLKSDLFNRSPYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title X-ray structure of Acetylcholine binding protein from Aplysia californica in presence of 3-((S)-azetidin-2-ylmethoxy)-5-((1S,2R)-2-(2-methoxyethyl)cyclopropyl)pyridine
rcsb
source organism Aplysia californica
molecule tags Acetylcholine binding protein
total genus 50
structure length 208
sequence length 209
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4frrA00
3WTJA 2VL0A 5HEOA 3SQ9A 4QAAA 5HEUA 4LMLA 3EHZA 3PMZA 3WTLA 4Z91A 4ALXA 5HEGA 2ZJVA 4F8HA 2XQAA 4HFDA 4ZK1A 4DBMA 5HCMA 3U8LA 3U8MA 3UU6A 4HFHA 5L4HA 5HEHA 4ZRUA 4UY2A 3RI5A 3WTKA 4A98A 4ZZBA 2XZ5A 4XHEA 2W8GA 5SYOA 3U8KA 2BG9E 3RQWA 2YKSA 2X00A 4QH1A 4XK9A 2XYSA 3TLWA 2BG9C 4IREA 3UQ7A 2QC1B 3UU3A 2XNTA 5J5IA 2BYSA 3C84A 3JAFA 4WV9A 3RQUA 3TLUA 3WTOA 3ZDHA 4TNVA 4TWDA 4FRRA 4UXUA 4X5TA 4A97A 2BJ0A 2XQ8A 4BFQA 4LMJA 3UU8A 2ZJUA 2Y54A 2Y56A 3UU5A 2XQ6A 5IUXA 2BYRA 4QACA 2PH9A 3ZKRA 3PEOA 5HEJA 3JAEA 2BG9B 2YN6A 2Y7YA 4ZR6A 2WNJA 2WNCA 3C79A 4QH5A 5LG3A 2XNVA 2UZ6A 2YOEA 4HFIA 4ILCA 3WTMA 2BR7A 3T4MA 1UX2A 5LXBA 5AFMB 5J5HA 4NPPA 3P50A 2XYTA 2BYNA 2XQ4A 4TWFA 2Y58A 4NZBA 2XQ5A 3RIFA 4ILAA 4BQTA 5KZUA 4PIRA 2XZ6A 3GUAA 5JMEA 3ZDGA 4QH4A 3SIOA 4AFHA 4HFEA 5BP0A 4UM3P 5AFLA 2C9TA 3TLVA 5CO5A 1UW6A 2BR8A 2WN9A 1UV6A 2XQ7A 3LSVA 5TVCA 4AFTA 3RHWA 3RIAA 4IL4A 3EAMA 3SH1A 4HFCA 4TNWA 5L4EA 2XQ9A 5KE4A 4ILBA 1I9BA 4UM3A 3U8NA 2BYQA 4HQPA 5HCJA 3WTIA 2BYPA 5AFKA 3UUBA 4IL9A 5J5GA 2PGZA 4ZJSA 4ZZCA 5L47A 2BG9A 3UU4A 5J0ZA 3P4WA 5J5FA 3IGQA 2XNUA 5AINA 2WZYA 4LMKA 3U8JA 2W8FA 4EZ1A 2YMEA 4TWHA 3WTHA 2X00D 5BRXA 2YMDA 4ZJTA 4QABA 5AFMA 3UQ4A 4HFBA 3TLSA 5BW2A 4COFA 5CFBA 3TLTA 3WIPA 2Y57A 3JADA 4Z90A 2WNLA 3EI0A 4B5DA 4ZK4A 5AFJA 3WTNA 5AFNA 5FJVA 4UM3S 4AFGA 4D01A 5AFHA 2XQ3A 3SQ6A 4UM1A
chains in the Genus database with same CATH superfamily
3WTJA 2VL0A 5HEOA 3SQ9A 4QAAA 5HEUA 4LMLA 3EHZA 3PMZA 3WTLA 4Z91A 4ALXA 5HEGA 2ZJVA 4F8HA 2XQAA 4HFDA 4ZK1A 4DBMA 5HCMA 3U8LA 3U8MA 3UU6A 4HFHA 5L4HA 5HEHA 4ZRUA 4UY2A 3RI5A 3WTKA 4A98A 4ZZBA 2XZ5A 4XHEA 2W8GA 5SYOA 3U8KA 2BG9E 3RQWA 2YKSA 2X00A 4QH1A 4XK9A 2XYSA 3TLWA 2BG9C 4IREA 3UQ7A 2QC1B 3UU3A 2XNTA 5J5IA 2BYSA 3C84A 3JAFA 4WV9A 3RQUA 3TLUA 3WTOA 3ZDHA 4TNVA 4TWDA 4FRRA 4UXUA 4X5TA 4A97A 2BJ0A 2XQ8A 4BFQA 4LMJA 3UU8A 2ZJUA 2Y54A 2Y56A 3UU5A 2XQ6A 5IUXA 2BYRA 4QACA 2PH9A 3ZKRA 3PEOA 5HEJA 3JAEA 2BG9B 2YN6A 2Y7YA 4ZR6A 2WNJA 2WNCA 3C79A 4QH5A 5LG3A 2XNVA 2UZ6A 2YOEA 4HFIA 4ILCA 3WTMA 2BR7A 3T4MA 1UX2A 5LXBA 5AFMB 5J5HA 4NPPA 3P50A 2XYTA 2BYNA 2XQ4A 4TWFA 2Y58A 4NZBA 2XQ5A 3RIFA 4ILAA 4BQTA 5KZUA 4PIRA 2XZ6A 3GUAA 5JMEA 3ZDGA 4QH4A 3SIOA 4AFHA 4HFEA 5BP0A 4UM3P 5AFLA 2C9TA 3TLVA 5CO5A 1UW6A 2BR8A 2WN9A 1UV6A 2XQ7A 3LSVA 5TVCA 4AFTA 3RHWA 3RIAA 4IL4A 3EAMA 3SH1A 4HFCA 4TNWA 5L4EA 2XQ9A 5KE4A 4ILBA 1I9BA 4UM3A 3U8NA 2BYQA 4HQPA 5HCJA 3WTIA 2BYPA 5AFKA 3UUBA 4IL9A 5J5GA 2PGZA 4ZJSA 4ZZCA 5L47A 2BG9A 3UU4A 5J0ZA 3P4WA 5J5FA 3IGQA 2XNUA 5AINA 2WZYA 4LMKA 3U8JA 2W8FA 4EZ1A 2YMEA 4TWHA 3WTHA 2X00D 5BRXA 2YMDA 4ZJTA 4QABA 5AFMA 3UQ4A 4HFBA 3TLSA 5BW2A 4COFA 5CFBA 3TLTA 3WIPA 2Y57A 3JADA 4Z90A 2WNLA 3EI0A 4B5DA 4ZK4A 5AFJA 3WTNA 5AFNA 5FJVA 4UM3S 4AFGA 4D01A 5AFHA 2XQ3A 3SQ6A 4UM1A
chains in the Genus database with same CATH topology
3WTJA 2VL0A 5HEOA 3SQ9A 4QAAA 5HEUA 4LMLA 3EHZA 3PMZA 3WTLA 4Z91A 4ALXA 5HEGA 2ZJVA 4F8HA 2XQAA 4HFDA 4ZK1A 4DBMA 5HCMA 3U8LA 3U8MA 3UU6A 4HFHA 5L4HA 5HEHA 4ZRUA 4UY2A 3RI5A 3WTKA 4A98A 4ZZBA 2XZ5A 4XHEA 2W8GA 5SYOA 3U8KA 2BG9E 3RQWA 2YKSA 2X00A 4QH1A 4XK9A 2XYSA 3TLWA 2BG9C 4IREA 3UQ7A 2QC1B 3UU3A 2XNTA 5J5IA 2BYSA 3C84A 3JAFA 4WV9A 3RQUA 3TLUA 3WTOA 3ZDHA 4TNVA 4TWDA 4FRRA 4UXUA 4X5TA 4A97A 2BJ0A 2XQ8A 4BFQA 4LMJA 3UU8A 2ZJUA 2Y54A 2Y56A 3UU5A 2XQ6A 5IUXA 2BYRA 4QACA 2PH9A 3ZKRA 3PEOA 5HEJA 3JAEA 2BG9B 2YN6A 2Y7YA 4ZR6A 2WNJA 2WNCA 3C79A 4QH5A 5LG3A 2XNVA 2UZ6A 2YOEA 4HFIA 4ILCA 3WTMA 2BR7A 3T4MA 1UX2A 5LXBA 5AFMB 5J5HA 4NPPA 3P50A 2XYTA 2BYNA 2XQ4A 4TWFA 2Y58A 4NZBA 2XQ5A 3RIFA 4ILAA 4BQTA 5KZUA 4PIRA 2XZ6A 3GUAA 5JMEA 3ZDGA 4QH4A 3SIOA 4AFHA 4HFEA 5BP0A 4UM3P 5AFLA 2C9TA 3TLVA 5CO5A 1UW6A 2BR8A 2WN9A 1UV6A 2XQ7A 3LSVA 5TVCA 4AFTA 3RHWA 3RIAA 4IL4A 3EAMA 3SH1A 4HFCA 4TNWA 5L4EA 2XQ9A 5KE4A 4ILBA 1I9BA 4UM3A 3U8NA 2BYQA 4HQPA 5HCJA 3WTIA 2BYPA 5AFKA 3UUBA 4IL9A 5J5GA 2PGZA 4ZJSA 4ZZCA 5L47A 2BG9A 3UU4A 5J0ZA 3P4WA 5J5FA 3IGQA 2XNUA 5AINA 2WZYA 4LMKA 3U8JA 2W8FA 4EZ1A 2YMEA 4TWHA 3WTHA 2X00D 5BRXA 2YMDA 4ZJTA 4QABA 5AFMA 3UQ4A 4HFBA 3TLSA 5BW2A 4COFA 5CFBA 3TLTA 3WIPA 2Y57A 3JADA 4Z90A 2WNLA 3EI0A 4B5DA 4ZK4A 5AFJA 3WTNA 5AFNA 5FJVA 4UM3S 4AFGA 4D01A 5AFHA 2XQ3A 3SQ6A 4UM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTJ A;  2VL0 A;  5HEO A;  3SQ9 A;  4QAA A;  5HEU A;  4LML A;  3EHZ A;  3PMZ A;  3WTL A;  4Z91 A;  4ALX A;  5HEG A;  2ZJV A;  4F8H A;  2XQA A;  4HFD A;  4ZK1 A;  4DBM A;  5HCM A;  3U8L A;  3U8M A;  3UU6 A;  4HFH A;  5L4H A;  5HEH A;  4ZRU A;  4UY2 A;  3RI5 A;  3WTK A;  4A98 A;  4ZZB A;  2XZ5 A;  4XHE A;  2W8G A;  5SYO A;  3U8K A;  2BG9 E;  3RQW A;  2YKS A;  2X00 A;  4QH1 A;  4XK9 A;  2XYS A;  3TLW A;  2BG9 C;  4IRE A;  3UQ7 A;  2QC1 B;  3UU3 A;  2XNT A;  5J5I A;  2BYS A;  3C84 A;  3JAF A;  4WV9 A;  3RQU A;  3TLU A;  3WTO A;  3ZDH A;  4TNV A;  4TWD A;  4FRR A;  4UXU A;  4X5T A;  4A97 A;  2BJ0 A;  2XQ8 A;  4BFQ A;  4LMJ A;  3UU8 A;  2ZJU A;  2Y54 A;  2Y56 A;  3UU5 A;  2XQ6 A;  5IUX A;  2BYR A;  4QAC A;  2PH9 A;  3ZKR A;  3PEO A;  5HEJ A;  3JAE A;  2BG9 B;  2YN6 A;  2Y7Y A;  4ZR6 A;  2WNJ A;  2WNC A;  3C79 A;  4QH5 A;  5LG3 A;  2XNV A;  2UZ6 A;  2YOE A;  4HFI A;  4ILC A;  3WTM A;  2BR7 A;  3T4M A;  1UX2 A;  5LXB A;  5AFM B;  5J5H A;  4NPP A;  3P50 A;  2XYT A;  2BYN A;  2XQ4 A;  4TWF A;  2Y58 A;  4NZB A;  2XQ5 A;  3RIF A;  4ILA A;  4BQT A;  5KZU A;  4PIR A;  2XZ6 A;  3GUA A;  5JME A;  3ZDG A;  4QH4 A;  3SIO A;  4AFH A;  4HFE A;  5BP0 A;  4UM3 P;  5AFL A;  2C9T A;  3TLV A;  5CO5 A;  1UW6 A;  2BR8 A;  2WN9 A;  1UV6 A;  2XQ7 A;  3LSV A;  5TVC A;  4AFT A;  3RHW A;  3RIA A;  4IL4 A;  3EAM A;  3SH1 A;  4HFC A;  4TNW A;  5L4E A;  2XQ9 A;  5KE4 A;  4ILB A;  1I9B A;  4UM3 A;  3U8N A;  2BYQ A;  4HQP A;  5HCJ A;  3WTI A;  2BYP A;  5AFK A;  3UUB A;  4IL9 A;  5J5G A;  2PGZ A;  4ZJS A;  4ZZC A;  5L47 A;  2BG9 A;  3UU4 A;  5J0Z A;  3P4W A;  5J5F A;  3IGQ A;  2XNU A;  5AIN A;  2WZY A;  4LMK A;  3U8J A;  2W8F A;  4EZ1 A;  2YME A;  4TWH A;  3WTH A;  2X00 D;  5BRX A;  2YMD A;  4ZJT A;  4QAB A;  5AFM A;  3UQ4 A;  4HFB A;  3TLS A;  5BW2 A;  4COF A;  5CFB A;  3TLT A;  3WIP A;  2Y57 A;  3JAD A;  4Z90 A;  2WNL A;  3EI0 A;  4B5D A;  4ZK4 A;  5AFJ A;  3WTN A;  5AFN A;  5FJV A;  4UM3 S;  4AFG A;  4D01 A;  5AFH A;  2XQ3 A;  3SQ6 A;  4UM1 A; 
#chains in the Genus database with same CATH topology
 3WTJ A;  2VL0 A;  5HEO A;  3SQ9 A;  4QAA A;  5HEU A;  4LML A;  3EHZ A;  3PMZ A;  3WTL A;  4Z91 A;  4ALX A;  5HEG A;  2ZJV A;  4F8H A;  2XQA A;  4HFD A;  4ZK1 A;  4DBM A;  5HCM A;  3U8L A;  3U8M A;  3UU6 A;  4HFH A;  5L4H A;  5HEH A;  4ZRU A;  4UY2 A;  3RI5 A;  3WTK A;  4A98 A;  4ZZB A;  2XZ5 A;  4XHE A;  2W8G A;  5SYO A;  3U8K A;  2BG9 E;  3RQW A;  2YKS A;  2X00 A;  4QH1 A;  4XK9 A;  2XYS A;  3TLW A;  2BG9 C;  4IRE A;  3UQ7 A;  2QC1 B;  3UU3 A;  2XNT A;  5J5I A;  2BYS A;  3C84 A;  3JAF A;  4WV9 A;  3RQU A;  3TLU A;  3WTO A;  3ZDH A;  4TNV A;  4TWD A;  4FRR A;  4UXU A;  4X5T A;  4A97 A;  2BJ0 A;  2XQ8 A;  4BFQ A;  4LMJ A;  3UU8 A;  2ZJU A;  2Y54 A;  2Y56 A;  3UU5 A;  2XQ6 A;  5IUX A;  2BYR A;  4QAC A;  2PH9 A;  3ZKR A;  3PEO A;  5HEJ A;  3JAE A;  2BG9 B;  2YN6 A;  2Y7Y A;  4ZR6 A;  2WNJ A;  2WNC A;  3C79 A;  4QH5 A;  5LG3 A;  2XNV A;  2UZ6 A;  2YOE A;  4HFI A;  4ILC A;  3WTM A;  2BR7 A;  3T4M A;  1UX2 A;  5LXB A;  5AFM B;  5J5H A;  4NPP A;  3P50 A;  2XYT A;  2BYN A;  2XQ4 A;  4TWF A;  2Y58 A;  4NZB A;  2XQ5 A;  3RIF A;  4ILA A;  4BQT A;  5KZU A;  4PIR A;  2XZ6 A;  3GUA A;  5JME A;  3ZDG A;  4QH4 A;  3SIO A;  4AFH A;  4HFE A;  5BP0 A;  4UM3 P;  5AFL A;  2C9T A;  3TLV A;  5CO5 A;  1UW6 A;  2BR8 A;  2WN9 A;  1UV6 A;  2XQ7 A;  3LSV A;  5TVC A;  4AFT A;  3RHW A;  3RIA A;  4IL4 A;  3EAM A;  3SH1 A;  4HFC A;  4TNW A;  5L4E A;  2XQ9 A;  5KE4 A;  4ILB A;  1I9B A;  4UM3 A;  3U8N A;  2BYQ A;  4HQP A;  5HCJ A;  3WTI A;  2BYP A;  5AFK A;  3UUB A;  4IL9 A;  5J5G A;  2PGZ A;  4ZJS A;  4ZZC A;  5L47 A;  2BG9 A;  3UU4 A;  5J0Z A;  3P4W A;  5J5F A;  3IGQ A;  2XNU A;  5AIN A;  2WZY A;  4LMK A;  3U8J A;  2W8F A;  4EZ1 A;  2YME A;  4TWH A;  3WTH A;  2X00 D;  5BRX A;  2YMD A;  4ZJT A;  4QAB A;  5AFM A;  3UQ4 A;  4HFB A;  3TLS A;  5BW2 A;  4COF A;  5CFB A;  3TLT A;  3WIP A;  2Y57 A;  3JAD A;  4Z90 A;  2WNL A;  3EI0 A;  4B5D A;  4ZK4 A;  5AFJ A;  3WTN A;  5AFN A;  5FJV A;  4UM3 S;  4AFG A;  4D01 A;  5AFH A;  2XQ3 A;  3SQ6 A;  4UM1 A; 
#chains in the Genus database with same CATH homology
 3WTJ A;  2VL0 A;  5HEO A;  3SQ9 A;  4QAA A;  5HEU A;  4LML A;  3EHZ A;  3PMZ A;  3WTL A;  4Z91 A;  4ALX A;  5HEG A;  2ZJV A;  4F8H A;  2XQA A;  4HFD A;  4ZK1 A;  4DBM A;  5HCM A;  3U8L A;  3U8M A;  3UU6 A;  4HFH A;  5L4H A;  5HEH A;  4ZRU A;  4UY2 A;  3RI5 A;  3WTK A;  4A98 A;  4ZZB A;  2XZ5 A;  4XHE A;  2W8G A;  5SYO A;  3U8K A;  2BG9 E;  3RQW A;  2YKS A;  2X00 A;  4QH1 A;  4XK9 A;  2XYS A;  3TLW A;  2BG9 C;  4IRE A;  3UQ7 A;  2QC1 B;  3UU3 A;  2XNT A;  5J5I A;  2BYS A;  3C84 A;  3JAF A;  4WV9 A;  3RQU A;  3TLU A;  3WTO A;  3ZDH A;  4TNV A;  4TWD A;  4FRR A;  4UXU A;  4X5T A;  4A97 A;  2BJ0 A;  2XQ8 A;  4BFQ A;  4LMJ A;  3UU8 A;  2ZJU A;  2Y54 A;  2Y56 A;  3UU5 A;  2XQ6 A;  5IUX A;  2BYR A;  4QAC A;  2PH9 A;  3ZKR A;  3PEO A;  5HEJ A;  3JAE A;  2BG9 B;  2YN6 A;  2Y7Y A;  4ZR6 A;  2WNJ A;  2WNC A;  3C79 A;  4QH5 A;  5LG3 A;  2XNV A;  2UZ6 A;  2YOE A;  4HFI A;  4ILC A;  3WTM A;  2BR7 A;  3T4M A;  1UX2 A;  5LXB A;  5AFM B;  5J5H A;  4NPP A;  3P50 A;  2XYT A;  2BYN A;  2XQ4 A;  4TWF A;  2Y58 A;  4NZB A;  2XQ5 A;  3RIF A;  4ILA A;  4BQT A;  5KZU A;  4PIR A;  2XZ6 A;  3GUA A;  5JME A;  3ZDG A;  4QH4 A;  3SIO A;  4AFH A;  4HFE A;  5BP0 A;  4UM3 P;  5AFL A;  2C9T A;  3TLV A;  5CO5 A;  1UW6 A;  2BR8 A;  2WN9 A;  1UV6 A;  2XQ7 A;  3LSV A;  5TVC A;  4AFT A;  3RHW A;  3RIA A;  4IL4 A;  3EAM A;  3SH1 A;  4HFC A;  4TNW A;  5L4E A;  2XQ9 A;  5KE4 A;  4ILB A;  1I9B A;  4UM3 A;  3U8N A;  2BYQ A;  4HQP A;  5HCJ A;  3WTI A;  2BYP A;  5AFK A;  3UUB A;  4IL9 A;  5J5G A;  2PGZ A;  4ZJS A;  4ZZC A;  5L47 A;  2BG9 A;  3UU4 A;  5J0Z A;  3P4W A;  5J5F A;  3IGQ A;  2XNU A;  5AIN A;  2WZY A;  4LMK A;  3U8J A;  2W8F A;  4EZ1 A;  2YME A;  4TWH A;  3WTH A;  2X00 D;  5BRX A;  2YMD A;  4ZJT A;  4QAB A;  5AFM A;  3UQ4 A;  4HFB A;  3TLS A;  5BW2 A;  4COF A;  5CFB A;  3TLT A;  3WIP A;  2Y57 A;  3JAD A;  4Z90 A;  2WNL A;  3EI0 A;  4B5D A;  4ZK4 A;  5AFJ A;  3WTN A;  5AFN A;  5FJV A;  4UM3 S;  4AFG A;  4D01 A;  5AFH A;  2XQ3 A;  3SQ6 A;  4UM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...