4FRRA

X-ray structure of acetylcholine binding protein from aplysia californica in presence of 3-((s)-azetidin-2-ylmethoxy)-5-((1s,2r)-2-(2-methoxyethyl)cyclopropyl)pyridine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
209
structure length
208
Chain Sequence
LHSQANLMRLKSDLFNRSPYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine binding protein
molecule keywords Soluble acetylcholine receptor
publication title X-ray structure of Acetylcholine binding protein from Aplysia californica in presence of 3-((S)-azetidin-2-ylmethoxy)-5-((1S,2R)-2-(2-methoxyethyl)cyclopropyl)pyridine
rcsb
source organism Aplysia californica
total genus 50
structure length 208
sequence length 209
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4frrA00
2XYTA 2BG9A 3C79A 5SYOA 2WNJA 5HCMA 3SH1A 3UQ7A 2Y58A 5HEHA 5J5FA 4QH1A 3IGQA 3U8NA 3U8KA 3RIFA 5HEGA 1UX2A 4ZK1A 2YN6A 2QC1B 2X00A 4ALXA 2XNUA 4Z90A 3WIPA 2YKSA 3UU8A 2XQ6A 5JMEA 4COFA 2XYSA 5AFJA 2BR8A 3C84A 2BYSA 5AFLA 2ZJVA 3P50A 4TNWA 4HFDA 3RQWA 3WTOA 5LG3A 1UW6A 4TNVA 4AFTA 2C9TA 3RQUA 2BR7A 5AFHA 3SQ9A 1I9BA 4UM3P 3U8JA 5J5GA 2BG9E 4D01A 5AINA 2BYRA 2XQ8A 2XQ5A 3JAFA 3WTHA 4BFQA 3ZDGA 4AFHA 4AFGA 5BP0A 2PGZA 4ZZCA 2W8FA 4QH5A 3SQ6A 4QABA 3WTLA 4HQPA 4HFEA 2BG9B 4ILBA 3UU5A 3TLSA 4NZBA 3PEOA 3EI0A 5FJVA 4DBMA 1UV6A 2W8GA 2WNLA 5J5IA 4ZK4A 3WTJA 4ZJTA 4TWHA 4HFBA 3UU3A 2XNVA 4Z91A 4XK9A 4TWDA 3ZKRA 2XZ6A 4HFCA 3TLWA 2UZ6A 4UM1A 3JADA 4LMLA 5BRXA 5KZUA 2YMEA 5HEJA 3JAEA 2BYQA 4FRRA 5TVCA 2PH9A 4X5TA 4ZJSA 5L4EA 3PMZA 5J0ZA 5CFBA 3WTNA 3RHWA 2YOEA 4NPPA 4ZZBA 2XQ3A 2VL0A 2XQAA 4HFIA 4QAAA 5CO5A 5AFMB 5AFKA 4ZR6A 5HEUA 4LMKA 5HCJA 2XNTA 4QH4A 3U8LA 4PIRA 5AFNA 5IUXA 3TLUA 4QACA 2WNCA 3UU4A 4ILCA 2XZ5A 3RI5A 4B5DA 4EZ1A 4BQTA 5J5HA 2BJ0A 5LXBA 3UU6A 2YMDA 4XHEA 5KE4A 4UXUA 4LMJA 2X00D 4F8HA 4IREA 3U8MA 2Y54A 3SIOA 4IL4A 2XQ7A 4IL9A 4WV9A 3UQ4A 4UY2A 4ZRUA 3EAMA 2WZYA 3TLTA 2XQ9A 3GUAA 4A97A 3T4MA 3WTKA 2ZJUA 2Y7YA 3TLVA 3RIAA 4TWFA 2BYPA 4A98A 5BW2A 4HFHA 5L47A 2Y56A 3WTMA 4UM3S 2Y57A 2BG9C 4UM3A 3EHZA 5L4HA 2BYNA 5HEOA 4ILAA 3LSVA 3WTIA 2WN9A 3UUBA 3ZDHA 2XQ4A 3P4WA 5AFMA
chains in the Genus database with same CATH superfamily
2XYTA 2BG9A 3C79A 5SYOA 2WNJA 5HCMA 3SH1A 3UQ7A 2Y58A 5HEHA 5J5FA 4QH1A 3IGQA 3U8NA 3U8KA 3RIFA 5HEGA 1UX2A 4ZK1A 2YN6A 2QC1B 2X00A 4ALXA 2XNUA 4Z90A 3WIPA 2YKSA 3UU8A 2XQ6A 5JMEA 4COFA 2XYSA 5AFJA 2BR8A 3C84A 2BYSA 5AFLA 2ZJVA 3P50A 4TNWA 4HFDA 3RQWA 3WTOA 5LG3A 1UW6A 4TNVA 4AFTA 2C9TA 3RQUA 2BR7A 5AFHA 3SQ9A 1I9BA 4UM3P 3U8JA 5J5GA 2BG9E 4D01A 5AINA 2BYRA 2XQ8A 2XQ5A 3JAFA 3WTHA 4BFQA 3ZDGA 4AFHA 4AFGA 5BP0A 2PGZA 4ZZCA 2W8FA 4QH5A 3SQ6A 4QABA 3WTLA 4HQPA 4HFEA 2BG9B 4ILBA 3UU5A 3TLSA 4NZBA 3PEOA 3EI0A 5FJVA 4DBMA 1UV6A 2W8GA 2WNLA 5J5IA 4ZK4A 3WTJA 4ZJTA 4TWHA 4HFBA 3UU3A 2XNVA 4Z91A 4XK9A 4TWDA 3ZKRA 2XZ6A 4HFCA 3TLWA 2UZ6A 4UM1A 3JADA 4LMLA 5BRXA 5KZUA 2YMEA 5HEJA 3JAEA 2BYQA 4FRRA 5TVCA 2PH9A 4X5TA 4ZJSA 5L4EA 3PMZA 5J0ZA 5CFBA 3WTNA 3RHWA 2YOEA 4NPPA 4ZZBA 2XQ3A 2VL0A 2XQAA 4HFIA 4QAAA 5CO5A 5AFMB 5AFKA 4ZR6A 5HEUA 4LMKA 5HCJA 2XNTA 4QH4A 3U8LA 4PIRA 5AFNA 5IUXA 3TLUA 4QACA 2WNCA 3UU4A 4ILCA 2XZ5A 3RI5A 4B5DA 4EZ1A 4BQTA 5J5HA 2BJ0A 5LXBA 3UU6A 2YMDA 4XHEA 5KE4A 4UXUA 4LMJA 2X00D 4F8HA 4IREA 3U8MA 2Y54A 3SIOA 4IL4A 2XQ7A 4IL9A 4WV9A 3UQ4A 4UY2A 4ZRUA 3EAMA 2WZYA 3TLTA 2XQ9A 3GUAA 4A97A 3T4MA 3WTKA 2ZJUA 2Y7YA 3TLVA 3RIAA 4TWFA 2BYPA 4A98A 5BW2A 4HFHA 5L47A 2Y56A 3WTMA 4UM3S 2Y57A 2BG9C 4UM3A 3EHZA 5L4HA 2BYNA 5HEOA 4ILAA 3LSVA 3WTIA 2WN9A 3UUBA 3ZDHA 2XQ4A 3P4WA 5AFMA
chains in the Genus database with same CATH topology
2XYTA 2BG9A 3C79A 5SYOA 2WNJA 5HCMA 3SH1A 3UQ7A 2Y58A 5HEHA 5J5FA 4QH1A 3IGQA 3U8NA 3U8KA 3RIFA 5HEGA 1UX2A 4ZK1A 2YN6A 2QC1B 2X00A 4ALXA 2XNUA 4Z90A 3WIPA 2YKSA 3UU8A 2XQ6A 5JMEA 4COFA 2XYSA 5AFJA 2BR8A 3C84A 2BYSA 5AFLA 2ZJVA 3P50A 4TNWA 4HFDA 3RQWA 3WTOA 5LG3A 1UW6A 4TNVA 4AFTA 2C9TA 3RQUA 2BR7A 5AFHA 3SQ9A 1I9BA 4UM3P 3U8JA 5J5GA 2BG9E 4D01A 5AINA 2BYRA 2XQ8A 2XQ5A 3JAFA 3WTHA 4BFQA 3ZDGA 4AFHA 4AFGA 5BP0A 2PGZA 4ZZCA 2W8FA 4QH5A 3SQ6A 4QABA 3WTLA 4HQPA 4HFEA 2BG9B 4ILBA 3UU5A 3TLSA 4NZBA 3PEOA 3EI0A 5FJVA 4DBMA 1UV6A 2W8GA 2WNLA 5J5IA 4ZK4A 3WTJA 4ZJTA 4TWHA 4HFBA 3UU3A 2XNVA 4Z91A 4XK9A 4TWDA 3ZKRA 2XZ6A 4HFCA 3TLWA 2UZ6A 4UM1A 3JADA 4LMLA 5BRXA 5KZUA 2YMEA 5HEJA 3JAEA 2BYQA 4FRRA 5TVCA 2PH9A 4X5TA 4ZJSA 5L4EA 3PMZA 5J0ZA 5CFBA 3WTNA 3RHWA 2YOEA 4NPPA 4ZZBA 2XQ3A 2VL0A 2XQAA 4HFIA 4QAAA 5CO5A 5AFMB 5AFKA 4ZR6A 5HEUA 4LMKA 5HCJA 2XNTA 4QH4A 3U8LA 4PIRA 5AFNA 5IUXA 3TLUA 4QACA 2WNCA 3UU4A 4ILCA 2XZ5A 3RI5A 4B5DA 4EZ1A 4BQTA 5J5HA 2BJ0A 5LXBA 3UU6A 2YMDA 4XHEA 5KE4A 4UXUA 4LMJA 2X00D 4F8HA 4IREA 3U8MA 2Y54A 3SIOA 4IL4A 2XQ7A 4IL9A 4WV9A 3UQ4A 4UY2A 4ZRUA 3EAMA 2WZYA 3TLTA 2XQ9A 3GUAA 4A97A 3T4MA 3WTKA 2ZJUA 2Y7YA 3TLVA 3RIAA 4TWFA 2BYPA 4A98A 5BW2A 4HFHA 5L47A 2Y56A 3WTMA 4UM3S 2Y57A 2BG9C 4UM3A 3EHZA 5L4HA 2BYNA 5HEOA 4ILAA 3LSVA 3WTIA 2WN9A 3UUBA 3ZDHA 2XQ4A 3P4WA 5AFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XYT A;  2BG9 A;  3C79 A;  5SYO A;  2WNJ A;  5HCM A;  3SH1 A;  3UQ7 A;  2Y58 A;  5HEH A;  5J5F A;  4QH1 A;  3IGQ A;  3U8N A;  3U8K A;  3RIF A;  5HEG A;  1UX2 A;  4ZK1 A;  2YN6 A;  2QC1 B;  2X00 A;  4ALX A;  2XNU A;  4Z90 A;  3WIP A;  2YKS A;  3UU8 A;  2XQ6 A;  5JME A;  4COF A;  2XYS A;  5AFJ A;  2BR8 A;  3C84 A;  2BYS A;  5AFL A;  2ZJV A;  3P50 A;  4TNW A;  4HFD A;  3RQW A;  3WTO A;  5LG3 A;  1UW6 A;  4TNV A;  4AFT A;  2C9T A;  3RQU A;  2BR7 A;  5AFH A;  3SQ9 A;  1I9B A;  4UM3 P;  3U8J A;  5J5G A;  2BG9 E;  4D01 A;  5AIN A;  2BYR A;  2XQ8 A;  2XQ5 A;  3JAF A;  3WTH A;  4BFQ A;  3ZDG A;  4AFH A;  4AFG A;  5BP0 A;  2PGZ A;  4ZZC A;  2W8F A;  4QH5 A;  3SQ6 A;  4QAB A;  3WTL A;  4HQP A;  4HFE A;  2BG9 B;  4ILB A;  3UU5 A;  3TLS A;  4NZB A;  3PEO A;  3EI0 A;  5FJV A;  4DBM A;  1UV6 A;  2W8G A;  2WNL A;  5J5I A;  4ZK4 A;  3WTJ A;  4ZJT A;  4TWH A;  4HFB A;  3UU3 A;  2XNV A;  4Z91 A;  4XK9 A;  4TWD A;  3ZKR A;  2XZ6 A;  4HFC A;  3TLW A;  2UZ6 A;  4UM1 A;  3JAD A;  4LML A;  5BRX A;  5KZU A;  2YME A;  5HEJ A;  3JAE A;  2BYQ A;  4FRR A;  5TVC A;  2PH9 A;  4X5T A;  4ZJS A;  5L4E A;  3PMZ A;  5J0Z A;  5CFB A;  3WTN A;  3RHW A;  2YOE A;  4NPP A;  4ZZB A;  2XQ3 A;  2VL0 A;  2XQA A;  4HFI A;  4QAA A;  5CO5 A;  5AFM B;  5AFK A;  4ZR6 A;  5HEU A;  4LMK A;  5HCJ A;  2XNT A;  4QH4 A;  3U8L A;  4PIR A;  5AFN A;  5IUX A;  3TLU A;  4QAC A;  2WNC A;  3UU4 A;  4ILC A;  2XZ5 A;  3RI5 A;  4B5D A;  4EZ1 A;  4BQT A;  5J5H A;  2BJ0 A;  5LXB A;  3UU6 A;  2YMD A;  4XHE A;  5KE4 A;  4UXU A;  4LMJ A;  2X00 D;  4F8H A;  4IRE A;  3U8M A;  2Y54 A;  3SIO A;  4IL4 A;  2XQ7 A;  4IL9 A;  4WV9 A;  3UQ4 A;  4UY2 A;  4ZRU A;  3EAM A;  2WZY A;  3TLT A;  2XQ9 A;  3GUA A;  4A97 A;  3T4M A;  3WTK A;  2ZJU A;  2Y7Y A;  3TLV A;  3RIA A;  4TWF A;  2BYP A;  4A98 A;  5BW2 A;  4HFH A;  5L47 A;  2Y56 A;  3WTM A;  4UM3 S;  2Y57 A;  2BG9 C;  4UM3 A;  3EHZ A;  5L4H A;  2BYN A;  5HEO A;  4ILA A;  3LSV A;  3WTI A;  2WN9 A;  3UUB A;  3ZDH A;  2XQ4 A;  3P4W A;  5AFM A; 
#chains in the Genus database with same CATH topology
 2XYT A;  2BG9 A;  3C79 A;  5SYO A;  2WNJ A;  5HCM A;  3SH1 A;  3UQ7 A;  2Y58 A;  5HEH A;  5J5F A;  4QH1 A;  3IGQ A;  3U8N A;  3U8K A;  3RIF A;  5HEG A;  1UX2 A;  4ZK1 A;  2YN6 A;  2QC1 B;  2X00 A;  4ALX A;  2XNU A;  4Z90 A;  3WIP A;  2YKS A;  3UU8 A;  2XQ6 A;  5JME A;  4COF A;  2XYS A;  5AFJ A;  2BR8 A;  3C84 A;  2BYS A;  5AFL A;  2ZJV A;  3P50 A;  4TNW A;  4HFD A;  3RQW A;  3WTO A;  5LG3 A;  1UW6 A;  4TNV A;  4AFT A;  2C9T A;  3RQU A;  2BR7 A;  5AFH A;  3SQ9 A;  1I9B A;  4UM3 P;  3U8J A;  5J5G A;  2BG9 E;  4D01 A;  5AIN A;  2BYR A;  2XQ8 A;  2XQ5 A;  3JAF A;  3WTH A;  4BFQ A;  3ZDG A;  4AFH A;  4AFG A;  5BP0 A;  2PGZ A;  4ZZC A;  2W8F A;  4QH5 A;  3SQ6 A;  4QAB A;  3WTL A;  4HQP A;  4HFE A;  2BG9 B;  4ILB A;  3UU5 A;  3TLS A;  4NZB A;  3PEO A;  3EI0 A;  5FJV A;  4DBM A;  1UV6 A;  2W8G A;  2WNL A;  5J5I A;  4ZK4 A;  3WTJ A;  4ZJT A;  4TWH A;  4HFB A;  3UU3 A;  2XNV A;  4Z91 A;  4XK9 A;  4TWD A;  3ZKR A;  2XZ6 A;  4HFC A;  3TLW A;  2UZ6 A;  4UM1 A;  3JAD A;  4LML A;  5BRX A;  5KZU A;  2YME A;  5HEJ A;  3JAE A;  2BYQ A;  4FRR A;  5TVC A;  2PH9 A;  4X5T A;  4ZJS A;  5L4E A;  3PMZ A;  5J0Z A;  5CFB A;  3WTN A;  3RHW A;  2YOE A;  4NPP A;  4ZZB A;  2XQ3 A;  2VL0 A;  2XQA A;  4HFI A;  4QAA A;  5CO5 A;  5AFM B;  5AFK A;  4ZR6 A;  5HEU A;  4LMK A;  5HCJ A;  2XNT A;  4QH4 A;  3U8L A;  4PIR A;  5AFN A;  5IUX A;  3TLU A;  4QAC A;  2WNC A;  3UU4 A;  4ILC A;  2XZ5 A;  3RI5 A;  4B5D A;  4EZ1 A;  4BQT A;  5J5H A;  2BJ0 A;  5LXB A;  3UU6 A;  2YMD A;  4XHE A;  5KE4 A;  4UXU A;  4LMJ A;  2X00 D;  4F8H A;  4IRE A;  3U8M A;  2Y54 A;  3SIO A;  4IL4 A;  2XQ7 A;  4IL9 A;  4WV9 A;  3UQ4 A;  4UY2 A;  4ZRU A;  3EAM A;  2WZY A;  3TLT A;  2XQ9 A;  3GUA A;  4A97 A;  3T4M A;  3WTK A;  2ZJU A;  2Y7Y A;  3TLV A;  3RIA A;  4TWF A;  2BYP A;  4A98 A;  5BW2 A;  4HFH A;  5L47 A;  2Y56 A;  3WTM A;  4UM3 S;  2Y57 A;  2BG9 C;  4UM3 A;  3EHZ A;  5L4H A;  2BYN A;  5HEO A;  4ILA A;  3LSV A;  3WTI A;  2WN9 A;  3UUB A;  3ZDH A;  2XQ4 A;  3P4W A;  5AFM A; 
#chains in the Genus database with same CATH homology
 2XYT A;  2BG9 A;  3C79 A;  5SYO A;  2WNJ A;  5HCM A;  3SH1 A;  3UQ7 A;  2Y58 A;  5HEH A;  5J5F A;  4QH1 A;  3IGQ A;  3U8N A;  3U8K A;  3RIF A;  5HEG A;  1UX2 A;  4ZK1 A;  2YN6 A;  2QC1 B;  2X00 A;  4ALX A;  2XNU A;  4Z90 A;  3WIP A;  2YKS A;  3UU8 A;  2XQ6 A;  5JME A;  4COF A;  2XYS A;  5AFJ A;  2BR8 A;  3C84 A;  2BYS A;  5AFL A;  2ZJV A;  3P50 A;  4TNW A;  4HFD A;  3RQW A;  3WTO A;  5LG3 A;  1UW6 A;  4TNV A;  4AFT A;  2C9T A;  3RQU A;  2BR7 A;  5AFH A;  3SQ9 A;  1I9B A;  4UM3 P;  3U8J A;  5J5G A;  2BG9 E;  4D01 A;  5AIN A;  2BYR A;  2XQ8 A;  2XQ5 A;  3JAF A;  3WTH A;  4BFQ A;  3ZDG A;  4AFH A;  4AFG A;  5BP0 A;  2PGZ A;  4ZZC A;  2W8F A;  4QH5 A;  3SQ6 A;  4QAB A;  3WTL A;  4HQP A;  4HFE A;  2BG9 B;  4ILB A;  3UU5 A;  3TLS A;  4NZB A;  3PEO A;  3EI0 A;  5FJV A;  4DBM A;  1UV6 A;  2W8G A;  2WNL A;  5J5I A;  4ZK4 A;  3WTJ A;  4ZJT A;  4TWH A;  4HFB A;  3UU3 A;  2XNV A;  4Z91 A;  4XK9 A;  4TWD A;  3ZKR A;  2XZ6 A;  4HFC A;  3TLW A;  2UZ6 A;  4UM1 A;  3JAD A;  4LML A;  5BRX A;  5KZU A;  2YME A;  5HEJ A;  3JAE A;  2BYQ A;  4FRR A;  5TVC A;  2PH9 A;  4X5T A;  4ZJS A;  5L4E A;  3PMZ A;  5J0Z A;  5CFB A;  3WTN A;  3RHW A;  2YOE A;  4NPP A;  4ZZB A;  2XQ3 A;  2VL0 A;  2XQA A;  4HFI A;  4QAA A;  5CO5 A;  5AFM B;  5AFK A;  4ZR6 A;  5HEU A;  4LMK A;  5HCJ A;  2XNT A;  4QH4 A;  3U8L A;  4PIR A;  5AFN A;  5IUX A;  3TLU A;  4QAC A;  2WNC A;  3UU4 A;  4ILC A;  2XZ5 A;  3RI5 A;  4B5D A;  4EZ1 A;  4BQT A;  5J5H A;  2BJ0 A;  5LXB A;  3UU6 A;  2YMD A;  4XHE A;  5KE4 A;  4UXU A;  4LMJ A;  2X00 D;  4F8H A;  4IRE A;  3U8M A;  2Y54 A;  3SIO A;  4IL4 A;  2XQ7 A;  4IL9 A;  4WV9 A;  3UQ4 A;  4UY2 A;  4ZRU A;  3EAM A;  2WZY A;  3TLT A;  2XQ9 A;  3GUA A;  4A97 A;  3T4M A;  3WTK A;  2ZJU A;  2Y7Y A;  3TLV A;  3RIA A;  4TWF A;  2BYP A;  4A98 A;  5BW2 A;  4HFH A;  5L47 A;  2Y56 A;  3WTM A;  4UM3 S;  2Y57 A;  2BG9 C;  4UM3 A;  3EHZ A;  5L4H A;  2BYN A;  5HEO A;  4ILA A;  3LSV A;  3WTI A;  2WN9 A;  3UUB A;  3ZDH A;  2XQ4 A;  3P4W A;  5AFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...