3EHZA

X-ray structure of the pentameric ligand gated ion channel of gloebacter violaceus (glic) in a presumptive open conformation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a potentially open state of a proton-activated pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein
molecule keywords Glr4197 protein
total genus 81
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3ehzA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3ehzA01
2Y57A 4ZZBA 4QH5A 2WZYA 3UUBA 2XQ7A 3P4WA 5HEHA 5CO5A 2XYSA 3UU8A 3WTNA 5AFMA 4LMLA 3EI0A 3JADA 2XZ5A 4D01A 2XQ4A 5TVCA 4F8HA 1OEDC 3TLWA 5AFNA 2XNUA 4UM3A 2PGZA 3C79A 2BG9B 3JAEA 3RQWA 3UU5A 4Z91A 5HEOA 4X5TA 1UX2A 2WNLA 4QACA 4TWHA 2XNTA 4NZBA 4HFBA 4Z90A 3U8MA 4BFQA 2Y54A 4TWFA 5L4HA 2LLYA 3UU3A 2XZ6A 4UY2A 4FRRA 5CFBA 1OEDB 4TNWA 3RIFA 5IUXA 4TWDA 4UM1A 3GUAA 2BYRA 2W8GA 4ILBA 2LKGA 2YMEA 4XHEA 4UM3S 2XQAA 5J5GA 2BYNA 5L47A 2QC1B 2Y56A 3WTOA 4AFHA 4HFCA 3U8JA 3RQUA 2ZJVA 2XQ5A 2C9TA 3WTLA 1I9BA 4BQTA 4ZK1A 5KZUA 2KSRA 2XYTA 5SYOA 3WTJA 5HEJA 2WNCA 4UM3P 3UU4A 4AFGA 1OEDE 3TLTA 2X00A 2Y7YA 4ALXA 4ZK4A 2X00D 4AFTA 3SQ9A 4IREA 2BR7A 3WTKA 3SIOA 5HEGA 3PEOA 3WIPA 5J5FA 3U8KA 4TNVA 5JMEA 3UQ7A 3T4MA 4ILCA 3TLUA 2BYPA 1OEDA 4ZJSA 4A98A 3U8LA 4PIRA 4HFIA 2ZJUA 4ILAA 3WTHA 3ZKRA 5AFKA 2VL0A 2XQ6A 5L4EA 5AFMB 3RHWA 2BG9A 5HCMA 2YMDA 2Y58A 3SH1A 3WTIA 5J5HA 1UV6A 4ZR6A 2YOEA 5FJVA 2XQ9A 4HFEA 3RI5A 4A97A 4ZZCA 5BW2A 3WTMA 5HEUA 2BG9E 4WV9A 3IGQA 2BYSA 3EHZA 4IL4A 2M6IA 3RIAA 3JAFA 4XK9A 4QH4A 2PH9A 2W8FA 5AFHA 4DBMA 4UXUA 5BP0A 2UZ6A 2MAWA 3TLSA 4COFA 2YN6A 2BG9C 3EAMA 4LMKA 2WNJA 3U8NA 2WN9A 2XQ8A 4HQPA 2BR8A 5AINA 3TLVA 3C84A 3UQ4A 2BYQA 3ZDHA 3P50A 3ZDGA 2BJ0A 5HCJA 1UW6A 5KE4A 2M6BA 4IL9A 5J5IA 2YKSA 5LG3A 2LKHA 3PMZA 5J0ZA 4QABA 3SQ6A 4ZJTA 5BRXA 5LXBA 5AFJA 4QH1A 4NPPA 4HFDA 4LMJA 2XNVA 4ZRUA 4B5DA 5AFLA 4HFHA 4QAAA 4EZ1A 3UU6A 3LSVA 2XQ3A 2LM2A
chains in the Genus database with same CATH superfamily
1KNPA 3EUHA 3AA7B 4EAHA 3CX8B 3C50A 1S94A 2XQ4A 4AKLA 2JQQA 4DMWA 5HWXA 3FZHB 3TLWA 4ZI7E 4O2AE 3AE6A 4QHOA 4UY2A 3K3QC 2WSSV 5LP6E 5BR8T 3EABA 3CK6A 3R6NA 2CRBA 3U8JA 2NTXA 3RYCE 2I0MA 3O9XA 2W62A 4O2BE 1HNZT 5KZUA 4ERRA 5AQQB 2X66A 1N33T 2Y7YA 3SFDA 2IIUA 2YINA 3IBPA 5BMVE 3WAKA 5ETWA 4IDQA 4TNVA 4GOUA 3L3PA 3FZKB 4A98A 5KX5E 2HPJA 5HXRA 5L3BB 2V7MA 2J62A 4OFZA 2XQYA 5LXTE 5CJ5A 1XDOA 4HFEA 3UT5E 1M7KA 3I9YA 5HEUA 4PFPA 4I55E 3ZJ1A 4XK9A 2XAHB 4EZHA 3SRZA 5FXXA 4UF0B 5A1LA 2WN9A 4ANJA 4XAXB 4EV6A 1T98A 4X1KE 3ZYLA 2X68A 2I59A 5DQVA 3P4SA 4QX8B 2EHOD 4AQFC 3SOLA 1KNZA 2BDEA 1WYCA 2NTYA 3AE5A 5JR9C 2XYSA 5KMGP 3I0OA 2I6HA 1ZKEA 1Y01A 5AFNA 3FZFB 3IEEA 3MXZA 4UVAB 2Y54A 2KWHA 2JMHA 1XNRT 3AA0B 3RIFA 2W4XA 3ONJA 1SA0E 4CQIA 3IHRA 3L39A 4A56A 3WAJA 3FZMB 4AFHA 3N9OA 5CGMA 3TLTA 1HX1B 4KMCA 3AA1B 4OX9T 1US7B 4IREA 5HEGA 2WCAA 3P7IA 4LFAT 3QK6A 3PUVF 3NZQA 4YTPA 4QXBB 2ZJUA 4AQYT 2BG9A 4YSYA 2YMDA 4IT4A 2X9WA 3ZCIA 3L09A 3PURA 4MALA 5BW2A 2X0LB 2M6IA 4DNDA 5AQSB 4DR3T 1I6ZA 2DWGA 4DBMA 4P0AA 1X9BA 4EEDA 5JDNA 4GYSA 1KF6A 3PE0A 3Q2MA 1IBMT 2WB5A 3EDVA 5AQKB 2YKSA 4IGUA 2CPTA 3JC6D 4QAAA 2DI4A 4JI5T 1MIVA 3ONLC 3P4WA 3ZC1A 2PG8A 3EI0A 3D0TA 3N2KE 5TVCA 2CEAA 5JTGA 5HAXA 2IW5B 5JR9B 4OHFA 4TWHA 5ABFB 3UUMA 2LLYA 3MJXA 1VCSA 3L8RA 4K0UA 2QYWA 4LF8T 3HL6A 1MMAA 1SUMB 4WBNE 2ZJVA 2XQ5A 4AKHA 5KXJA 3A5XA 4KX6A 5AQFB 3RKGA 3ANWA 4NUVA 3WTKA 4CN1A 3ZEFB 2FJAA 4DR7T 3LK3B 3T1HT 4ZHQE 5LHHB 3C4ZA 3F31A 1T8BA 3CQGB 5AQNB 5AQMB 3ZKRA 5L4EA 2EHOC 3BQLA 2QGSA 4IIJE 2XQ9A 4A97A 3PUZF 5HWYA 3EHZA 4X66T 2PJQA 3RC8A 3CX7B 4BJMA 3K3NA 2N2NA 3CVRA 4JBWF 2X9HA 3ZN1B 5AINA 2IHR1 2KXPB 4UF0A 3CIRA 4DV2T 1LKXA 5DABA 5J0ZA 3SQ6A 4NPPA 4GIWA 4JUYA 2QRXA 1HTJF 3N2OA 2FJEA 2V7JA 4UV8B 2GK9A 2KT9A 3AEDA 2ACZA 1OEDC 3ZT5A 1S35A 4Z91A 1D0YA 1E7PA 2XSBA 5L4HA 3AE4A 5AQGB 4NXNT 3ABVA 1CHUA 3P4PA 3VKHA 2AXDS 4DUZT 4XHEA 3WTOA 1WFDA 2HHHT 3ZMVB 3RQUA 3UUXB 2ODVA 3NWIA 4BQTA 5AQTB 2OLTA 3WTJA 1OEDE 1IJ6A 1ZHCA 5FMNA 4ALXA 2WWUA 3B57A 3N2GE 2X67A 4GK0E 4O8SA 5M4YA 2VKDA 3CWZB 1W0BA 3CPZA 3RLFF 4UVCB 5HXCA 3JCFA 4ZEYA 5FVLA 2YDRA 4HFIA 2E9XB 2NOXA 4Q25A 2XPKA 4DV5T 4BAYB 4ZZCA 2CBIA 2SPCA 4O4JE 4TUYE 3VHLA 5L3GB 1YKHB 3AVSA 1YKEB 3HR0A 1HFAA 2MPKA 2BG9C 2KLQA 4LMKA 4N78D 3CX6B 2Y6XA 4HQPA 1Z8UA 2VVNA 4TV9E 1UW6A 3E08A 3O4XE 4IE0A 3AECA 4I50E 5AFLA 2XZ5A 2UU9T 2D2SA 5ABGA 2CBJA 4CZZB 4PJLA 1FJGT 2YEVC 2BS3A 4UM3A 4B6XA 3C79A 1NEKA 1ZV4X 1LVKA 4Z90A 2F4VT 1OEDB 2FJBA 3NRXA 5AQIB 2ES0A 2XQAA 2E5VA 2BYNA 4F6RC 2R6GF 2ZLYA 4NUUA 4LFCT 4YLHA 4ILUA 4HE8A 3LFMA 2WM9A 5HEJA 3AAIA 2PTFA 3GWHA 5J5FA 4EYYR 2BKPA 4A5XA 1H7CA 4ZJSA 2VWAA 3M3ZB 2LOPA 1UX4A 2H89A 3HKDE 2W61A 4DO0A 5AFMB 2X9YA 2X9XA 2P9BA 1W9RA 4OYJA 1XWMA 1UV6A 3AE3A 4PNIA 3RKOA 4IDPA 4PK6A 1Z0PA 2CWOA 2YU1A 3AE2A 2HN1A 5EK4A 1WYBA 4COFA 2BR8A 4H9QC 4H63H 5LB7B 2BJ0A 5KE4A 2M6BA 3AA6B 4TX5A 3N9PA 3HKBE 4BJNA 5LGUB 4EB6E 3M65A 4ZOLE 5HXHA 4QH5A 1FMVA 3UU8A 2D0TA 3KBTA 1MMNA 5LJNA 5J2TE 5CA1E 2UUAT 5DJQC 4HTEA 3RQWA 3U8MA 5HXSA 3PUXF 3UU3A 2WDVA 3FHNA 4YSZA 4ILBA 2YMEA 4DBRA 2XAFB 2C5JA 3PU8A 5LCYA 4O4LE 2IUBA 2C9TA 4P09A 4ZK1A 4U7YA 5JDHA 2V6YA 3UU4A 2XM1A 2IC6A 3OYXA 3H37A 3SQ9A 3RC3A 3PUQA 3PUWF 4EXTA 2VQET 4OK0A 3H3MA 3FXDB 5AQLB 2PFVA 1XMQT 2AE9A 3P8CD 2WS3A 4JI0T 1J1JA 2K3WA 2A2FX 4WV9A 4MLKA 5EK3A 5BP0A 3HKEE 1YXRA 2X0YA 1EZ3A 3JC6C 4IDZA 3ZSTA 4DR6T 4HEAA 5LG3A 2LKHA 5BRXA 2VKJA 1UGOA 3KFWX 3NKZA 4JYAT 3KDSE 4DBQA 1W09A 4ZI2C 2W63A 2BVLA 2WZYA 3C4XA 5HEHA 4CI1B 2MTQA 5JQGE 4UXNB 1U5PA 4ZI2D 4FRRA 2V5CA 4UM1A 3KINB 2D0UA 1UURA 3F57A 2BYRA 2YDSA 2V6YB 3WI3A 1ZOYA 2JIWA 5AQOB 4PAGA 3PDYA 2ZM8A 5SYOA 1XZYA 2MBGA 3AEBA 3AB3B 3J7Yq 1D1AA 4U3CA 4AFTA 4LF4T 2Y48B 2ZM6T 5AQUB 5JDGA 5LNKA 3U3IA 2LSGA 2BS2A 3TLUA 4UV9B 4AIUA 3OJAA 4ZS3A 2VURA 3NVOA 3RI5A 3RH3A 1M62A 4YTNA 5JRCB 4QXCB 4DV1T 2BYSA 5LJMA 5C3JA 3BK9A 4TZ4C 3CKDA 2K48A 1XMOT 2XJ7A 2H7OA 3NZPA 2CXFA 2CMRA 1L0VA 4CI3B 2IAKA 3N5LA 1SHZC 1NAFA 1IBLT 2HPLA 4HFDA 5F5WA 4LMJA 3VRAA 4JI6T 5GONE 4EZ1A 4H9NC 1D1BA 1KNRA 3VR8A 4P1NA 1HF8A 4ZZBA 5FL1A 2C0SA 3RIUC 5AFMA 2B76A 3T8OA 3FZLB 3RRWA 2LM9A 5LGTB 3RPUA 1D1CA 4QACA 4L5GA 4HFBA 4L0RA 2N9DA 1LRZA 3AEFA 4CXXA 4WW0A 1YW0A 2WY2A 3N9LA 1N34T 4UM3S 2Y56A 4HFCA 4V1Av 2H88A 1XNQT 2UXCT 5C2TA 1WR6A 4UM3P 2Y8DA 2X00A 1IBKT 3SIOA 4O4IE 2W67A 2BVMA 2C5KT 3PUSA 3NRYA 3UQ7A 3U8LA 5ABFA 2CLYB 5LBQB 4ISSA 5H6QB 5DQWA 2OA5A 2YOEA 2UXDT 1HG5A 1HX8A 1BR0A 4JI8T 4HKAA 3FB2A 1MNDA 4JI3T 2H3RA 3AAAB 3W15B 4EZ4A 4LF6T 2MYSA 3KVBA 1J5ET 3RX6A 4LF5T 4IL9A 4QABA 4LF7T 2IDOB 3RRCA 4ZRUA 4B5DA 3GN5A 3UU6A 1HNWT 5AFUL 3LSVA 3GA8A 5FVKA 3T1YT 4DR1T 2WAUA 5FY7A 5CO5A 2LSIA 3ZPOA 4U2ZA 2BKNA 3EVYA 3RGLA 2H7VC 2CHOA 4EGWA 2BG9B 4YHJA 4NIQA 2B1EA 2V1DB 5IHYA 3P4RA 2QA7A 4U7IA 4TNWA 4TWDA 3SS1A 3TKLB 2RP4A 4EIWA 3LBXB 4X20E 2WDQA 5JDQA 4IE7A 3LK42 1HNXT 2CXDA 2ZM0A 1IZNB 2XYTA 2L8KA 2XSAA 3VR9A 4YTMA 1G8XA 3RYFE 2VKHA 1B7TA 2Y58A 5J5HA 2J1DG 1HR0T 2V7KA 4WBOA 3ZMZB 3QUJA 2LRLA 4UXUA 1IJ5A 2LRKA 2LE8A 4PK4A 3EAMA 5F3JA 4H9SE 4GKJT 2BYQA 2W00A 1KEYA 2DLRA 2C5IT 2KZ7B 2ODUA 3QC9A 2W2UA 2WDRA 1YQ4A 2YK0A 3PUAA 4D01A 4AKRB 2ZMAA 4B3ST 4QXHB 2A9UA 3OBVE 4NZBA 4TWFA 2J4GA 3BQIA 3PJAJ 4LF9T 3ZLIA 5AQRB 4YXDA 5JH7E 2LEHA 4XBFB 2NP9A 3AEAA 2XY8B 2X00D 4XZCA 4KHPT 4X65T 3Q5WA 3IF8B 4JEHB 2V5DA 4X1YE 4ILCA 3MZKB 5CA0E 1E1HB 1WLXA 4AKIA 2XQ6A 2A3DA 2XASB 1D0ZA 1AJ3A 2V7IA 3JAFA 4WNKA 5AFHA 3MKDA 3AEEA 4KBMB 2MAWA 2J47A 4IE6A 4DV4T 3KVAA 3LG7A 1FMWA 3O1HA 3ZMTB 2V7LA 2VASA 4Z8XA 5LGNB 2XNVA 2LOSA 4FI5A 4MBQA 3FXEB 2Y57A 2D5UA 2EHOA 2VKOA 2CCQA 4UELA 4ZI3C 3VKGA 3SWHA 3V5SA 4DR5T 3UU5A 2WNLA 1MIYA 4EYUA 2NW7A 3C4WA 4AXPA 2KNDA 5L2LA 3CQXC 2KWIB 4IE5A 3ZSSA 2XZEA 4AFGA 3HA4A 4NXMT 2BS4A 3WIPA 3PUYF 3PUGA 5LOVE 2WQYA 4TN7B 3FBZA 3I9WA 2E9XA 3G06A 4CN4A 4P0BA 5HCMA 4JEUB 2RA1A 4MFRA 2CWYA 1D0XA 3OPCA 1DU2A 2WU5A 5J2UE 1UUSA 3Q5XA 4YSXA 5ADXL 3CMLA 4U2YA 4U33A 1KK7A 2UZ6A 2ACXA 1VRBA 4H63V 4YJ2E 2JRKA 3GMIA 3C98B 3TLVA 4I4TE 1JNRA 3HI2A 4JI2T 5JDLA 4I0UA 2V8SV 2E9XD 5CB4E 4CXYA 4DR2T 3K1SA 4UEMA 3UUBA 2Q9QD 1FIOA 3O1IA 3AE7A 2XM2A 4OYKA 5ABHA 4G63A 2L3LA 3AE9A 5LHIB 2VL8A 3NBXX 1UX2A 3WTHA 5FKYA 1E2AA 2NW8A 2XNTA 4X64T 4B3MT 2NW9A 2D9DA 4JI4T 3ZT7A 1QSDA 2E9XC 4O4HE 3Q9DA 2W66A 4EEBA 5FL0A 5J5GA 1UCUA 1Y64B 3AXJB 2LJLA 4H9PC 1HS7A 1I9BA 3H3AA 3ESLA 2WNCA 3QB5A 1U4QA 3UUNA 2X0HA 3MACA 1O3XA 1R8IA 3T4MA 3VRBA 1W0AA 3R84B 3J9X1 4PK5A 3ZYMA 3KV6A 3C51A 3E0ZA 2YDQA 4AQFA 3GN5B 3N9NA 2FJDA 2UXNB 1MNEA 4FJOA 4PW8A 2LSKA 4QH4A 2W8FA 4H9OC 4CXWA 3TLSA 5F8PA 2WMNA 3ETVA 2KINB 4C91A 3ZDGA 4I43B 5FXVA 4ZJTA 4ZI3D 2CXLA 5AFJA 2Q9QA 2XTLA 4DV0T 5ABEA 3ZC0A 3B5MA 2WZIA 1FEWA 2DHRA 4HN9A 3CQCB 2WBLA 4LMLA 4F8HA 5EZYE 1VCTA 2XNUA 3MA9A 2KMFA 3KV5A 3JAEA 5E0OA 2X51A 4X5TA 4DV3T 4K0KT 2XZ6A 3ZMSB 4CI2B 5JDMA 1JNZA 2LKGA 3IA3A 4GKKT 5L47A 2XHEB 2IC9A 3ONXA 1GQEA 3PU3A 4MHCA 4DV7T 4WYVA 2E8IA 4DV6T 1NWMX 3ZCJA 4ADZA 5FYMA 4BA9A 2UXBT 4AQGA 2FBWA 4YHHT 3LDQB 5LMNT 4IDOA 2UUBT 3QOFA 2VL0A 3RHWA 4J2CA 5FP3A 2OV9A 3C64A 4U72A 4HWFA 5FJVA 4ZR6A 4QX7B 4C90A 3QNUA 4E7SA 2CM0A 5TAOA 2BG9E 1SE7A 4IL4A 1ZP0A 2DCFA 4UVBB 3N9QA 1N32T 2PH9A 4B3RT 5FY1A 2K9AA 4DIDB 5L3EB 3U8NA 2Q9QC 2K24A 2LSYA 3AAEB 3UFEA 1OWAA 4UR9A 3C84A 3PJAA 2BKOA 1QLBA 3FBLA 3P50A 3I0QA 4H9RC 5FNVE 1CUNA 5LXBA 1WCRA 3LJCA 4HFHA 5JRCA 3KV9A 2XQ3A 2LM2A 4UIGA 2XQ7A 2M67A 2DWKA 3WTNA 1NENA 2FUPA 4G2AA 3S4UA 2N1GA 2LHRA 3DTOA 2PGZA 5HEOA 1KFYA 4HWDA 2A72A 4ISTA 3AEGA 5CFBA 5IUXA 3GUAA 3U78A 2JJ9A 4KUMB 2QC1B 3RF1A 4X1IE 5FXWA 2ZM2A 5AQHB 2JPFA 4PFOA 1T7SA 5LBMA 2KSRA 4GK5E 3VU7H 3DJBA 4ZK4A 3ZT6A 4U31A 4YJ3E 2LHNA 2BR7A 1VOMA 2WWVA 3K3OA 4WZXA 2BYPA 1OEDA 2Z6EA 2JQKA 2LSJA 2MOZA 5AFKA 2WMOA 1YD8G 3WTIA 3UTKA 4IDNA 3E22E 3OKQA 4AI6A 2CLYC 4LFBT 3DP7A 3WTMA 2G0UA 2JQ9A 3RIAA 4JI1T 3KV4A 1BR1A 3AE8A 2YN6A 2DL1A 3Q5DA 5AQPB 2K5BB 1LVFA 2XQ8A 2V26A 1MIWA 3UQ4A 4GYRA 4IHJE 3BQKA 2VK9A 4KI0F 5J5IA 3RYHE 4QH1A 4YT0A 4HFVA 4JLEA 4ZXLA 3ZMUB 4U74A 3ZN0B 4ZS2A 2V6XA 4IE4A 2NWBA 4DVDA 3JADA 2CHNA 1N36T 2VB6A 5L3FB 4L9IA 4M1PA 1I94T 4B3TT 2CE7A 3B13A 4PJNA 4EOZB 2PBIA 5LA6E 2WP9A 2W8GA 1UX5A 1OXZA 2LT3A 2RPAA 5H6RB 3OVUA 1QUUA 2VQFT 2NR4A 4AKGA 3MK7C 2CA5A 1HG2A 4PJJA 5FY0A 3OYZA 3AXJA 3A7MA 2JQHA 1HCIA 5JREA 4KP3C 2VVSA 2YU2A 3P4QA 4X62T 4PIRA 2DNXA 2E5LT 3AVRA 4CN6A 4E7ZA 1MMDA 4QWNB 3O1JA 1MMGA 5KDMC 3AE1A 1XDPA 4TV8E 3I1AA 2HN2A 3PV0F 4HWCA 2L9QA 3RIUA 4DR4T 5L3CB 2HH7A 3ZJ2A 1BR2A 4DMVA 1IAPA 2JMKA 3K8PC 2WNJA 2XAQB 2XAJB 5FXZA 5J1GA 2WU2A 4YY3T 2XUEA 5L3DB 4AISA 1BR4A 4HWIB 2E2AA 3PTRB 4HWHA 3N9MA 5LG4A 5HXEA 1YQ3A 2XAGB 2BZBA 3LBXA 4DUYT 1WRDA 3QB5K 1T72A 5JDFA 4JI7T 4BFQA 5LHGB 4HGAA 2WZHA 1WR0A 1V9DA 3V5UA 3RYIE 1G73A 2QVAA 2BBJA 3ANWB 3EDUA 3WTLA 5AQVB 4JV5T 5C8YE 3X1DA 3PEOA 3U8KA 5JMEA 3A8YC 2UXXB 4ILAA 5JR9A 3SH1A 4KHZF 3KBUA 5IWAT 4YFSA 1UK5A 2EHOB 2UUCT 3IGQA 2Q9QB 2IMLA 3Q5EA 4QKNA 1ZEEA 3OTOT 4ASKA 5JVDE 3SFEA 5IYZE 3UFGA 3UULA 3ETUA 3HKCE 3ZYKA 3ZDHA 5HCJA 5LMUT 2BBHA 3PMZA 5AQJB 3LK2B 1X79A 2W0GA 5EK2A 5LYJE 3F2EA 5HYAA 1J5WA 4PJMA
chains in the Genus database with same CATH topology
2Y57A 4ZZBA 4QH5A 2WZYA 3UUBA 2XQ7A 3P4WA 5HEHA 5CO5A 2XYSA 3UU8A 3WTNA 5AFMA 4LMLA 3EI0A 3JADA 2XZ5A 4D01A 2XQ4A 5TVCA 4F8HA 1OEDC 3TLWA 5AFNA 2XNUA 4UM3A 2PGZA 3C79A 2BG9B 3JAEA 3RQWA 3UU5A 4Z91A 5HEOA 4X5TA 1UX2A 2WNLA 4QACA 4TWHA 2XNTA 4NZBA 4HFBA 4Z90A 3U8MA 4BFQA 2Y54A 4TWFA 5L4HA 2LLYA 3UU3A 2XZ6A 4UY2A 4FRRA 5CFBA 1OEDB 4TNWA 3RIFA 5IUXA 4TWDA 4UM1A 3GUAA 2BYRA 2W8GA 4ILBA 2LKGA 2YMEA 4XHEA 4UM3S 2XQAA 5J5GA 2BYNA 5L47A 2QC1B 2Y56A 3WTOA 4AFHA 4HFCA 3U8JA 3RQUA 2ZJVA 2XQ5A 2C9TA 3WTLA 1I9BA 4BQTA 4ZK1A 5KZUA 2KSRA 2XYTA 5SYOA 3WTJA 5HEJA 2WNCA 4UM3P 3UU4A 4AFGA 1OEDE 3TLTA 2X00A 2Y7YA 4ALXA 4ZK4A 2X00D 4AFTA 3SQ9A 4IREA 2BR7A 3WTKA 3SIOA 5HEGA 3PEOA 3WIPA 5J5FA 3U8KA 4TNVA 5JMEA 3UQ7A 3T4MA 4ILCA 3TLUA 2BYPA 1OEDA 4ZJSA 4A98A 3U8LA 4PIRA 4HFIA 2ZJUA 4ILAA 3WTHA 3ZKRA 5AFKA 2VL0A 2XQ6A 5L4EA 5AFMB 3RHWA 2BG9A 5HCMA 2YMDA 2Y58A 3SH1A 3WTIA 5J5HA 1UV6A 4ZR6A 2YOEA 5FJVA 2XQ9A 4HFEA 3RI5A 4A97A 4ZZCA 5BW2A 3WTMA 5HEUA 2BG9E 4WV9A 3IGQA 2BYSA 3EHZA 4IL4A 2M6IA 3RIAA 3JAFA 4XK9A 4QH4A 2PH9A 2W8FA 5AFHA 4DBMA 4UXUA 5BP0A 2UZ6A 2MAWA 3TLSA 4COFA 2YN6A 2BG9C 3EAMA 4LMKA 2WNJA 3U8NA 2WN9A 2XQ8A 4HQPA 2BR8A 5AINA 3TLVA 3C84A 3UQ4A 2BYQA 3ZDHA 3P50A 3ZDGA 2BJ0A 5HCJA 1UW6A 5KE4A 2M6BA 4IL9A 5J5IA 2YKSA 5LG3A 2LKHA 3PMZA 5J0ZA 4QABA 3SQ6A 4ZJTA 5BRXA 5LXBA 5AFJA 4QH1A 4NPPA 4HFDA 4LMJA 2XNVA 4ZRUA 4B5DA 5AFLA 4HFHA 4QAAA 4EZ1A 3UU6A 3LSVA 2XQ3A 2LM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y57 A;  4ZZB A;  4QH5 A;  2WZY A;  3UUB A;  2XQ7 A;  3P4W A;  5HEH A;  5CO5 A;  2XYS A;  3UU8 A;  3WTN A;  5AFM A;  4LML A;  3EI0 A;  3JAD A;  2XZ5 A;  4D01 A;  2XQ4 A;  5TVC A;  4F8H A;  1OED C;  3TLW A;  5AFN A;  2XNU A;  4UM3 A;  2PGZ A;  3C79 A;  2BG9 B;  3JAE A;  3RQW A;  3UU5 A;  4Z91 A;  5HEO A;  4X5T A;  1UX2 A;  2WNL A;  4QAC A;  4TWH A;  2XNT A;  4NZB A;  4HFB A;  4Z90 A;  3U8M A;  4BFQ A;  2Y54 A;  4TWF A;  5L4H A;  2LLY A;  3UU3 A;  2XZ6 A;  4UY2 A;  4FRR A;  5CFB A;  1OED B;  4TNW A;  3RIF A;  5IUX A;  4TWD A;  4UM1 A;  3GUA A;  2BYR A;  2W8G A;  4ILB A;  2LKG A;  2YME A;  4XHE A;  4UM3 S;  2XQA A;  5J5G A;  2BYN A;  5L47 A;  2QC1 B;  2Y56 A;  3WTO A;  4AFH A;  4HFC A;  3U8J A;  3RQU A;  2ZJV A;  2XQ5 A;  2C9T A;  3WTL A;  1I9B A;  4BQT A;  4ZK1 A;  5KZU A;  2KSR A;  2XYT A;  5SYO A;  3WTJ A;  5HEJ A;  2WNC A;  4UM3 P;  3UU4 A;  4AFG A;  1OED E;  3TLT A;  2X00 A;  2Y7Y A;  4ALX A;  4ZK4 A;  2X00 D;  4AFT A;  3SQ9 A;  4IRE A;  2BR7 A;  3WTK A;  3SIO A;  5HEG A;  3PEO A;  3WIP A;  5J5F A;  3U8K A;  4TNV A;  5JME A;  3UQ7 A;  3T4M A;  4ILC A;  3TLU A;  2BYP A;  1OED A;  4ZJS A;  4A98 A;  3U8L A;  4PIR A;  4HFI A;  2ZJU A;  4ILA A;  3WTH A;  3ZKR A;  5AFK A;  2VL0 A;  2XQ6 A;  5L4E A;  5AFM B;  3RHW A;  2BG9 A;  5HCM A;  2YMD A;  2Y58 A;  3SH1 A;  3WTI A;  5J5H A;  1UV6 A;  4ZR6 A;  2YOE A;  5FJV A;  2XQ9 A;  4HFE A;  3RI5 A;  4A97 A;  4ZZC A;  5BW2 A;  3WTM A;  5HEU A;  2BG9 E;  4WV9 A;  3IGQ A;  2BYS A;  3EHZ A;  4IL4 A;  2M6I A;  3RIA A;  3JAF A;  4XK9 A;  4QH4 A;  2PH9 A;  2W8F A;  5AFH A;  4DBM A;  4UXU A;  5BP0 A;  2UZ6 A;  2MAW A;  3TLS A;  4COF A;  2YN6 A;  2BG9 C;  3EAM A;  4LMK A;  2WNJ A;  3U8N A;  2WN9 A;  2XQ8 A;  4HQP A;  2BR8 A;  5AIN A;  3TLV A;  3C84 A;  3UQ4 A;  2BYQ A;  3ZDH A;  3P50 A;  3ZDG A;  2BJ0 A;  5HCJ A;  1UW6 A;  5KE4 A;  2M6B A;  4IL9 A;  5J5I A;  2YKS A;  5LG3 A;  2LKH A;  3PMZ A;  5J0Z A;  4QAB A;  3SQ6 A;  4ZJT A;  5BRX A;  5LXB A;  5AFJ A;  4QH1 A;  4NPP A;  4HFD A;  4LMJ A;  2XNV A;  4ZRU A;  4B5D A;  5AFL A;  4HFH A;  4QAA A;  4EZ1 A;  3UU6 A;  3LSV A;  2XQ3 A;  2LM2 A; 
#chains in the Genus database with same CATH topology
 1KNP A;  3EUH A;  3AA7 B;  4EAH A;  3CX8 B;  3C50 A;  1S94 A;  2XQ4 A;  4AKL A;  2JQQ A;  4DMW A;  5HWX A;  3FZH B;  3TLW A;  4ZI7 E;  4O2A E;  3AE6 A;  4QHO A;  4UY2 A;  3K3Q C;  2WSS V;  5LP6 E;  5BR8 T;  3EAB A;  3CK6 A;  3R6N A;  2CRB A;  3U8J A;  2NTX A;  3RYC E;  2I0M A;  3O9X A;  2W62 A;  4O2B E;  1HNZ T;  5KZU A;  4ERR A;  5AQQ B;  2X66 A;  1N33 T;  2Y7Y A;  3SFD A;  2IIU A;  2YIN A;  3IBP A;  5BMV E;  3WAK A;  5ETW A;  4IDQ A;  4TNV A;  4GOU A;  3L3P A;  3FZK B;  4A98 A;  5KX5 E;  2HPJ A;  5HXR A;  5L3B B;  2V7M A;  2J62 A;  4OFZ A;  2XQY A;  5LXT E;  5CJ5 A;  1XDO A;  4HFE A;  3UT5 E;  1M7K A;  3I9Y A;  5HEU A;  4PFP A;  4I55 E;  3ZJ1 A;  4XK9 A;  2XAH B;  4EZH A;  3SRZ A;  5FXX A;  4UF0 B;  5A1L A;  2WN9 A;  4ANJ A;  4XAX B;  4EV6 A;  1T98 A;  4X1K E;  3ZYL A;  2X68 A;  2I59 A;  5DQV A;  3P4S A;  4QX8 B;  2EHO D;  4AQF C;  3SOL A;  1KNZ A;  2BDE A;  1WYC A;  2NTY A;  3AE5 A;  5JR9 C;  2XYS A;  5KMG P;  3I0O A;  2I6H A;  1ZKE A;  1Y01 A;  5AFN A;  3FZF B;  3IEE A;  3MXZ A;  4UVA B;  2Y54 A;  2KWH A;  2JMH A;  1XNR T;  3AA0 B;  3RIF A;  2W4X A;  3ONJ A;  1SA0 E;  4CQI A;  3IHR A;  3L39 A;  4A56 A;  3WAJ A;  3FZM B;  4AFH A;  3N9O A;  5CGM A;  3TLT A;  1HX1 B;  4KMC A;  3AA1 B;  4OX9 T;  1US7 B;  4IRE A;  5HEG A;  2WCA A;  3P7I A;  4LFA T;  3QK6 A;  3PUV F;  3NZQ A;  4YTP A;  4QXB B;  2ZJU A;  4AQY T;  2BG9 A;  4YSY A;  2YMD A;  4IT4 A;  2X9W A;  3ZCI A;  3L09 A;  3PUR A;  4MAL A;  5BW2 A;  2X0L B;  2M6I A;  4DND A;  5AQS B;  4DR3 T;  1I6Z A;  2DWG A;  4DBM A;  4P0A A;  1X9B A;  4EED A;  5JDN A;  4GYS A;  1KF6 A;  3PE0 A;  3Q2M A;  1IBM T;  2WB5 A;  3EDV A;  5AQK B;  2YKS A;  4IGU A;  2CPT A;  3JC6 D;  4QAA A;  2DI4 A;  4JI5 T;  1MIV A;  3ONL C;  3P4W A;  3ZC1 A;  2PG8 A;  3EI0 A;  3D0T A;  3N2K E;  5TVC A;  2CEA A;  5JTG A;  5HAX A;  2IW5 B;  5JR9 B;  4OHF A;  4TWH A;  5ABF B;  3UUM A;  2LLY A;  3MJX A;  1VCS A;  3L8R A;  4K0U A;  2QYW A;  4LF8 T;  3HL6 A;  1MMA A;  1SUM B;  4WBN E;  2ZJV A;  2XQ5 A;  4AKH A;  5KXJ A;  3A5X A;  4KX6 A;  5AQF B;  3RKG A;  3ANW A;  4NUV A;  3WTK A;  4CN1 A;  3ZEF B;  2FJA A;  4DR7 T;  3LK3 B;  3T1H T;  4ZHQ E;  5LHH B;  3C4Z A;  3F31 A;  1T8B A;  3CQG B;  5AQN B;  5AQM B;  3ZKR A;  5L4E A;  2EHO C;  3BQL A;  2QGS A;  4IIJ E;  2XQ9 A;  4A97 A;  3PUZ F;  5HWY A;  3EHZ A;  4X66 T;  2PJQ A;  3RC8 A;  3CX7 B;  4BJM A;  3K3N A;  2N2N A;  3CVR A;  4JBW F;  2X9H A;  3ZN1 B;  5AIN A;  2IHR 1;  2KXP B;  4UF0 A;  3CIR A;  4DV2 T;  1LKX A;  5DAB A;  5J0Z A;  3SQ6 A;  4NPP A;  4GIW A;  4JUY A;  2QRX A;  1HTJ F;  3N2O A;  2FJE A;  2V7J A;  4UV8 B;  2GK9 A;  2KT9 A;  3AED A;  2ACZ A;  1OED C;  3ZT5 A;  1S35 A;  4Z91 A;  1D0Y A;  1E7P A;  2XSB A;  5L4H A;  3AE4 A;  5AQG B;  4NXN T;  3ABV A;  1CHU A;  3P4P A;  3VKH A;  2AXD S;  4DUZ T;  4XHE A;  3WTO A;  1WFD A;  2HHH T;  3ZMV B;  3RQU A;  3UUX B;  2ODV A;  3NWI A;  4BQT A;  5AQT B;  2OLT A;  3WTJ A;  1OED E;  1IJ6 A;  1ZHC A;  5FMN A;  4ALX A;  2WWU A;  3B57 A;  3N2G E;  2X67 A;  4GK0 E;  4O8S A;  5M4Y A;  2VKD A;  3CWZ B;  1W0B A;  3CPZ A;  3RLF F;  4UVC B;  5HXC A;  3JCF A;  4ZEY A;  5FVL A;  2YDR A;  4HFI A;  2E9X B;  2NOX A;  4Q25 A;  2XPK A;  4DV5 T;  4BAY B;  4ZZC A;  2CBI A;  2SPC A;  4O4J E;  4TUY E;  3VHL A;  5L3G B;  1YKH B;  3AVS A;  1YKE B;  3HR0 A;  1HFA A;  2MPK A;  2BG9 C;  2KLQ A;  4LMK A;  4N78 D;  3CX6 B;  2Y6X A;  4HQP A;  1Z8U A;  2VVN A;  4TV9 E;  1UW6 A;  3E08 A;  3O4X E;  4IE0 A;  3AEC A;  4I50 E;  5AFL A;  2XZ5 A;  2UU9 T;  2D2S A;  5ABG A;  2CBJ A;  4CZZ B;  4PJL A;  1FJG T;  2YEV C;  2BS3 A;  4UM3 A;  4B6X A;  3C79 A;  1NEK A;  1ZV4 X;  1LVK A;  4Z90 A;  2F4V T;  1OED B;  2FJB A;  3NRX A;  5AQI B;  2ES0 A;  2XQA A;  2E5V A;  2BYN A;  4F6R C;  2R6G F;  2ZLY A;  4NUU A;  4LFC T;  4YLH A;  4ILU A;  4HE8 A;  3LFM A;  2WM9 A;  5HEJ A;  3AAI A;  2PTF A;  3GWH A;  5J5F A;  4EYY R;  2BKP A;  4A5X A;  1H7C A;  4ZJS A;  2VWA A;  3M3Z B;  2LOP A;  1UX4 A;  2H89 A;  3HKD E;  2W61 A;  4DO0 A;  5AFM B;  2X9Y A;  2X9X A;  2P9B A;  1W9R A;  4OYJ A;  1XWM A;  1UV6 A;  3AE3 A;  4PNI A;  3RKO A;  4IDP A;  4PK6 A;  1Z0P A;  2CWO A;  2YU1 A;  3AE2 A;  2HN1 A;  5EK4 A;  1WYB A;  4COF A;  2BR8 A;  4H9Q C;  4H63 H;  5LB7 B;  2BJ0 A;  5KE4 A;  2M6B A;  3AA6 B;  4TX5 A;  3N9P A;  3HKB E;  4BJN A;  5LGU B;  4EB6 E;  3M65 A;  4ZOL E;  5HXH A;  4QH5 A;  1FMV A;  3UU8 A;  2D0T A;  3KBT A;  1MMN A;  5LJN A;  5J2T E;  5CA1 E;  2UUA T;  5DJQ C;  4HTE A;  3RQW A;  3U8M A;  5HXS A;  3PUX F;  3UU3 A;  2WDV A;  3FHN A;  4YSZ A;  4ILB A;  2YME A;  4DBR A;  2XAF B;  2C5J A;  3PU8 A;  5LCY A;  4O4L E;  2IUB A;  2C9T A;  4P09 A;  4ZK1 A;  4U7Y A;  5JDH A;  2V6Y A;  3UU4 A;  2XM1 A;  2IC6 A;  3OYX A;  3H37 A;  3SQ9 A;  3RC3 A;  3PUQ A;  3PUW F;  4EXT A;  2VQE T;  4OK0 A;  3H3M A;  3FXD B;  5AQL B;  2PFV A;  1XMQ T;  2AE9 A;  3P8C D;  2WS3 A;  4JI0 T;  1J1J A;  2K3W A;  2A2F X;  4WV9 A;  4MLK A;  5EK3 A;  5BP0 A;  3HKE E;  1YXR A;  2X0Y A;  1EZ3 A;  3JC6 C;  4IDZ A;  3ZST A;  4DR6 T;  4HEA A;  5LG3 A;  2LKH A;  5BRX A;  2VKJ A;  1UGO A;  3KFW X;  3NKZ A;  4JYA T;  3KDS E;  4DBQ A;  1W09 A;  4ZI2 C;  2W63 A;  2BVL A;  2WZY A;  3C4X A;  5HEH A;  4CI1 B;  2MTQ A;  5JQG E;  4UXN B;  1U5P A;  4ZI2 D;  4FRR A;  2V5C A;  4UM1 A;  3KIN B;  2D0U A;  1UUR A;  3F57 A;  2BYR A;  2YDS A;  2V6Y B;  3WI3 A;  1ZOY A;  2JIW A;  5AQO B;  4PAG A;  3PDY A;  2ZM8 A;  5SYO A;  1XZY A;  2MBG A;  3AEB A;  3AB3 B;  3J7Y q;  1D1A A;  4U3C A;  4AFT A;  4LF4 T;  2Y48 B;  2ZM6 T;  5AQU B;  5JDG A;  5LNK A;  3U3I A;  2LSG A;  2BS2 A;  3TLU A;  4UV9 B;  4AIU A;  3OJA A;  4ZS3 A;  2VUR A;  3NVO A;  3RI5 A;  3RH3 A;  1M62 A;  4YTN A;  5JRC B;  4QXC B;  4DV1 T;  2BYS A;  5LJM A;  5C3J A;  3BK9 A;  4TZ4 C;  3CKD A;  2K48 A;  1XMO T;  2XJ7 A;  2H7O A;  3NZP A;  2CXF A;  2CMR A;  1L0V A;  4CI3 B;  2IAK A;  3N5L A;  1SHZ C;  1NAF A;  1IBL T;  2HPL A;  4HFD A;  5F5W A;  4LMJ A;  3VRA A;  4JI6 T;  5GON E;  4EZ1 A;  4H9N C;  1D1B A;  1KNR A;  3VR8 A;  4P1N A;  1HF8 A;  4ZZB A;  5FL1 A;  2C0S A;  3RIU C;  5AFM A;  2B76 A;  3T8O A;  3FZL B;  3RRW A;  2LM9 A;  5LGT B;  3RPU A;  1D1C A;  4QAC A;  4L5G A;  4HFB A;  4L0R A;  2N9D A;  1LRZ A;  3AEF A;  4CXX A;  4WW0 A;  1YW0 A;  2WY2 A;  3N9L A;  1N34 T;  4UM3 S;  2Y56 A;  4HFC A;  4V1A v;  2H88 A;  1XNQ T;  2UXC T;  5C2T A;  1WR6 A;  4UM3 P;  2Y8D A;  2X00 A;  1IBK T;  3SIO A;  4O4I E;  2W67 A;  2BVM A;  2C5K T;  3PUS A;  3NRY A;  3UQ7 A;  3U8L A;  5ABF A;  2CLY B;  5LBQ B;  4ISS A;  5H6Q B;  5DQW A;  2OA5 A;  2YOE A;  2UXD T;  1HG5 A;  1HX8 A;  1BR0 A;  4JI8 T;  4HKA A;  3FB2 A;  1MND A;  4JI3 T;  2H3R A;  3AAA B;  3W15 B;  4EZ4 A;  4LF6 T;  2MYS A;  3KVB A;  1J5E T;  3RX6 A;  4LF5 T;  4IL9 A;  4QAB A;  4LF7 T;  2IDO B;  3RRC A;  4ZRU A;  4B5D A;  3GN5 A;  3UU6 A;  1HNW T;  5AFU L;  3LSV A;  3GA8 A;  5FVK A;  3T1Y T;  4DR1 T;  2WAU A;  5FY7 A;  5CO5 A;  2LSI A;  3ZPO A;  4U2Z A;  2BKN A;  3EVY A;  3RGL A;  2H7V C;  2CHO A;  4EGW A;  2BG9 B;  4YHJ A;  4NIQ A;  2B1E A;  2V1D B;  5IHY A;  3P4R A;  2QA7 A;  4U7I A;  4TNW A;  4TWD A;  3SS1 A;  3TKL B;  2RP4 A;  4EIW A;  3LBX B;  4X20 E;  2WDQ A;  5JDQ A;  4IE7 A;  3LK4 2;  1HNX T;  2CXD A;  2ZM0 A;  1IZN B;  2XYT A;  2L8K A;  2XSA A;  3VR9 A;  4YTM A;  1G8X A;  3RYF E;  2VKH A;  1B7T A;  2Y58 A;  5J5H A;  2J1D G;  1HR0 T;  2V7K A;  4WBO A;  3ZMZ B;  3QUJ A;  2LRL A;  4UXU A;  1IJ5 A;  2LRK A;  2LE8 A;  4PK4 A;  3EAM A;  5F3J A;  4H9S E;  4GKJ T;  2BYQ A;  2W00 A;  1KEY A;  2DLR A;  2C5I T;  2KZ7 B;  2ODU A;  3QC9 A;  2W2U A;  2WDR A;  1YQ4 A;  2YK0 A;  3PUA A;  4D01 A;  4AKR B;  2ZMA A;  4B3S T;  4QXH B;  2A9U A;  3OBV E;  4NZB A;  4TWF A;  2J4G A;  3BQI A;  3PJA J;  4LF9 T;  3ZLI A;  5AQR B;  4YXD A;  5JH7 E;  2LEH A;  4XBF B;  2NP9 A;  3AEA A;  2XY8 B;  2X00 D;  4XZC A;  4KHP T;  4X65 T;  3Q5W A;  3IF8 B;  4JEH B;  2V5D A;  4X1Y E;  4ILC A;  3MZK B;  5CA0 E;  1E1H B;  1WLX A;  4AKI A;  2XQ6 A;  2A3D A;  2XAS B;  1D0Z A;  1AJ3 A;  2V7I A;  3JAF A;  4WNK A;  5AFH A;  3MKD A;  3AEE A;  4KBM B;  2MAW A;  2J47 A;  4IE6 A;  4DV4 T;  3KVA A;  3LG7 A;  1FMW A;  3O1H A;  3ZMT B;  2V7L A;  2VAS A;  4Z8X A;  5LGN B;  2XNV A;  2LOS A;  4FI5 A;  4MBQ A;  3FXE B;  2Y57 A;  2D5U A;  2EHO A;  2VKO A;  2CCQ A;  4UEL A;  4ZI3 C;  3VKG A;  3SWH A;  3V5S A;  4DR5 T;  3UU5 A;  2WNL A;  1MIY A;  4EYU A;  2NW7 A;  3C4W A;  4AXP A;  2KND A;  5L2L A;  3CQX C;  2KWI B;  4IE5 A;  3ZSS A;  2XZE A;  4AFG A;  3HA4 A;  4NXM T;  2BS4 A;  3WIP A;  3PUY F;  3PUG A;  5LOV E;  2WQY A;  4TN7 B;  3FBZ A;  3I9W A;  2E9X A;  3G06 A;  4CN4 A;  4P0B A;  5HCM A;  4JEU B;  2RA1 A;  4MFR A;  2CWY A;  1D0X A;  3OPC A;  1DU2 A;  2WU5 A;  5J2U E;  1UUS A;  3Q5X A;  4YSX A;  5ADX L;  3CML A;  4U2Y A;  4U33 A;  1KK7 A;  2UZ6 A;  2ACX A;  1VRB A;  4H63 V;  4YJ2 E;  2JRK A;  3GMI A;  3C98 B;  3TLV A;  4I4T E;  1JNR A;  3HI2 A;  4JI2 T;  5JDL A;  4I0U A;  2V8S V;  2E9X D;  5CB4 E;  4CXY A;  4DR2 T;  3K1S A;  4UEM A;  3UUB A;  2Q9Q D;  1FIO A;  3O1I A;  3AE7 A;  2XM2 A;  4OYK A;  5ABH A;  4G63 A;  2L3L A;  3AE9 A;  5LHI B;  2VL8 A;  3NBX X;  1UX2 A;  3WTH A;  5FKY A;  1E2A A;  2NW8 A;  2XNT A;  4X64 T;  4B3M T;  2NW9 A;  2D9D A;  4JI4 T;  3ZT7 A;  1QSD A;  2E9X C;  4O4H E;  3Q9D A;  2W66 A;  4EEB A;  5FL0 A;  5J5G A;  1UCU A;  1Y64 B;  3AXJ B;  2LJL A;  4H9P C;  1HS7 A;  1I9B A;  3H3A A;  3ESL A;  2WNC A;  3QB5 A;  1U4Q A;  3UUN A;  2X0H A;  3MAC A;  1O3X A;  1R8I A;  3T4M A;  3VRB A;  1W0A A;  3R84 B;  3J9X 1;  4PK5 A;  3ZYM A;  3KV6 A;  3C51 A;  3E0Z A;  2YDQ A;  4AQF A;  3GN5 B;  3N9N A;  2FJD A;  2UXN B;  1MNE A;  4FJO A;  4PW8 A;  2LSK A;  4QH4 A;  2W8F A;  4H9O C;  4CXW A;  3TLS A;  5F8P A;  2WMN A;  3ETV A;  2KIN B;  4C91 A;  3ZDG A;  4I43 B;  5FXV A;  4ZJT A;  4ZI3 D;  2CXL A;  5AFJ A;  2Q9Q A;  2XTL A;  4DV0 T;  5ABE A;  3ZC0 A;  3B5M A;  2WZI A;  1FEW A;  2DHR A;  4HN9 A;  3CQC B;  2WBL A;  4LML A;  4F8H A;  5EZY E;  1VCT A;  2XNU A;  3MA9 A;  2KMF A;  3KV5 A;  3JAE A;  5E0O A;  2X51 A;  4X5T A;  4DV3 T;  4K0K T;  2XZ6 A;  3ZMS B;  4CI2 B;  5JDM A;  1JNZ A;  2LKG A;  3IA3 A;  4GKK T;  5L47 A;  2XHE B;  2IC9 A;  3ONX A;  1GQE A;  3PU3 A;  4MHC A;  4DV7 T;  4WYV A;  2E8I A;  4DV6 T;  1NWM X;  3ZCJ A;  4ADZ A;  5FYM A;  4BA9 A;  2UXB T;  4AQG A;  2FBW A;  4YHH T;  3LDQ B;  5LMN T;  4IDO A;  2UUB T;  3QOF A;  2VL0 A;  3RHW A;  4J2C A;  5FP3 A;  2OV9 A;  3C64 A;  4U72 A;  4HWF A;  5FJV A;  4ZR6 A;  4QX7 B;  4C90 A;  3QNU A;  4E7S A;  2CM0 A;  5TAO A;  2BG9 E;  1SE7 A;  4IL4 A;  1ZP0 A;  2DCF A;  4UVB B;  3N9Q A;  1N32 T;  2PH9 A;  4B3R T;  5FY1 A;  2K9A A;  4DID B;  5L3E B;  3U8N A;  2Q9Q C;  2K24 A;  2LSY A;  3AAE B;  3UFE A;  1OWA A;  4UR9 A;  3C84 A;  3PJA A;  2BKO A;  1QLB A;  3FBL A;  3P50 A;  3I0Q A;  4H9R C;  5FNV E;  1CUN A;  5LXB A;  1WCR A;  3LJC A;  4HFH A;  5JRC A;  3KV9 A;  2XQ3 A;  2LM2 A;  4UIG A;  2XQ7 A;  2M67 A;  2DWK A;  3WTN A;  1NEN A;  2FUP A;  4G2A A;  3S4U A;  2N1G A;  2LHR A;  3DTO A;  2PGZ A;  5HEO A;  1KFY A;  4HWD A;  2A72 A;  4IST A;  3AEG A;  5CFB A;  5IUX A;  3GUA A;  3U78 A;  2JJ9 A;  4KUM B;  2QC1 B;  3RF1 A;  4X1I E;  5FXW A;  2ZM2 A;  5AQH B;  2JPF A;  4PFO A;  1T7S A;  5LBM A;  2KSR A;  4GK5 E;  3VU7 H;  3DJB A;  4ZK4 A;  3ZT6 A;  4U31 A;  4YJ3 E;  2LHN A;  2BR7 A;  1VOM A;  2WWV A;  3K3O A;  4WZX A;  2BYP A;  1OED A;  2Z6E A;  2JQK A;  2LSJ A;  2MOZ A;  5AFK A;  2WMO A;  1YD8 G;  3WTI A;  3UTK A;  4IDN A;  3E22 E;  3OKQ A;  4AI6 A;  2CLY C;  4LFB T;  3DP7 A;  3WTM A;  2G0U A;  2JQ9 A;  3RIA A;  4JI1 T;  3KV4 A;  1BR1 A;  3AE8 A;  2YN6 A;  2DL1 A;  3Q5D A;  5AQP B;  2K5B B;  1LVF A;  2XQ8 A;  2V26 A;  1MIW A;  3UQ4 A;  4GYR A;  4IHJ E;  3BQK A;  2VK9 A;  4KI0 F;  5J5I A;  3RYH E;  4QH1 A;  4YT0 A;  4HFV A;  4JLE A;  4ZXL A;  3ZMU B;  4U74 A;  3ZN0 B;  4ZS2 A;  2V6X A;  4IE4 A;  2NWB A;  4DVD A;  3JAD A;  2CHN A;  1N36 T;  2VB6 A;  5L3F B;  4L9I A;  4M1P A;  1I94 T;  4B3T T;  2CE7 A;  3B13 A;  4PJN A;  4EOZ B;  2PBI A;  5LA6 E;  2WP9 A;  2W8G A;  1UX5 A;  1OXZ A;  2LT3 A;  2RPA A;  5H6R B;  3OVU A;  1QUU A;  2VQF T;  2NR4 A;  4AKG A;  3MK7 C;  2CA5 A;  1HG2 A;  4PJJ A;  5FY0 A;  3OYZ A;  3AXJ A;  3A7M A;  2JQH A;  1HCI A;  5JRE A;  4KP3 C;  2VVS A;  2YU2 A;  3P4Q A;  4X62 T;  4PIR A;  2DNX A;  2E5L T;  3AVR A;  4CN6 A;  4E7Z A;  1MMD A;  4QWN B;  3O1J A;  1MMG A;  5KDM C;  3AE1 A;  1XDP A;  4TV8 E;  3I1A A;  2HN2 A;  3PV0 F;  4HWC A;  2L9Q A;  3RIU A;  4DR4 T;  5L3C B;  2HH7 A;  3ZJ2 A;  1BR2 A;  4DMV A;  1IAP A;  2JMK A;  3K8P C;  2WNJ A;  2XAQ B;  2XAJ B;  5FXZ A;  5J1G A;  2WU2 A;  4YY3 T;  2XUE A;  5L3D B;  4AIS A;  1BR4 A;  4HWI B;  2E2A A;  3PTR B;  4HWH A;  3N9M A;  5LG4 A;  5HXE A;  1YQ3 A;  2XAG B;  2BZB A;  3LBX A;  4DUY T;  1WRD A;  3QB5 K;  1T72 A;  5JDF A;  4JI7 T;  4BFQ A;  5LHG B;  4HGA A;  2WZH A;  1WR0 A;  1V9D A;  3V5U A;  3RYI E;  1G73 A;  2QVA A;  2BBJ A;  3ANW B;  3EDU A;  3WTL A;  5AQV B;  4JV5 T;  5C8Y E;  3X1D A;  3PEO A;  3U8K A;  5JME A;  3A8Y C;  2UXX B;  4ILA A;  5JR9 A;  3SH1 A;  4KHZ F;  3KBU A;  5IWA T;  4YFS A;  1UK5 A;  2EHO B;  2UUC T;  3IGQ A;  2Q9Q B;  2IML A;  3Q5E A;  4QKN A;  1ZEE A;  3OTO T;  4ASK A;  5JVD E;  3SFE A;  5IYZ E;  3UFG A;  3UUL A;  3ETU A;  3HKC E;  3ZYK A;  3ZDH A;  5HCJ A;  5LMU T;  2BBH A;  3PMZ A;  5AQJ B;  3LK2 B;  1X79 A;  2W0G A;  5EK2 A;  5LYJ E;  3F2E A;  5HYA A;  1J5W A;  4PJM A; 
#chains in the Genus database with same CATH homology
 2Y57 A;  4ZZB A;  4QH5 A;  2WZY A;  3UUB A;  2XQ7 A;  3P4W A;  5HEH A;  5CO5 A;  2XYS A;  3UU8 A;  3WTN A;  5AFM A;  4LML A;  3EI0 A;  3JAD A;  2XZ5 A;  4D01 A;  2XQ4 A;  5TVC A;  4F8H A;  1OED C;  3TLW A;  5AFN A;  2XNU A;  4UM3 A;  2PGZ A;  3C79 A;  2BG9 B;  3JAE A;  3RQW A;  3UU5 A;  4Z91 A;  5HEO A;  4X5T A;  1UX2 A;  2WNL A;  4QAC A;  4TWH A;  2XNT A;  4NZB A;  4HFB A;  4Z90 A;  3U8M A;  4BFQ A;  2Y54 A;  4TWF A;  5L4H A;  2LLY A;  3UU3 A;  2XZ6 A;  4UY2 A;  4FRR A;  5CFB A;  1OED B;  4TNW A;  3RIF A;  5IUX A;  4TWD A;  4UM1 A;  3GUA A;  2BYR A;  2W8G A;  4ILB A;  2LKG A;  2YME A;  4XHE A;  4UM3 S;  2XQA A;  5J5G A;  2BYN A;  5L47 A;  2QC1 B;  2Y56 A;  3WTO A;  4AFH A;  4HFC A;  3U8J A;  3RQU A;  2ZJV A;  2XQ5 A;  2C9T A;  3WTL A;  1I9B A;  4BQT A;  4ZK1 A;  5KZU A;  2KSR A;  2XYT A;  5SYO A;  3WTJ A;  5HEJ A;  2WNC A;  4UM3 P;  3UU4 A;  4AFG A;  1OED E;  3TLT A;  2X00 A;  2Y7Y A;  4ALX A;  4ZK4 A;  2X00 D;  4AFT A;  3SQ9 A;  4IRE A;  2BR7 A;  3WTK A;  3SIO A;  5HEG A;  3PEO A;  3WIP A;  5J5F A;  3U8K A;  4TNV A;  5JME A;  3UQ7 A;  3T4M A;  4ILC A;  3TLU A;  2BYP A;  1OED A;  4ZJS A;  4A98 A;  3U8L A;  4PIR A;  4HFI A;  2ZJU A;  4ILA A;  3WTH A;  3ZKR A;  5AFK A;  2VL0 A;  2XQ6 A;  5L4E A;  5AFM B;  3RHW A;  2BG9 A;  5HCM A;  2YMD A;  2Y58 A;  3SH1 A;  3WTI A;  5J5H A;  1UV6 A;  4ZR6 A;  2YOE A;  5FJV A;  2XQ9 A;  4HFE A;  3RI5 A;  4A97 A;  4ZZC A;  5BW2 A;  3WTM A;  5HEU A;  2BG9 E;  4WV9 A;  3IGQ A;  2BYS A;  3EHZ A;  4IL4 A;  2M6I A;  3RIA A;  3JAF A;  4XK9 A;  4QH4 A;  2PH9 A;  2W8F A;  5AFH A;  4DBM A;  4UXU A;  5BP0 A;  2UZ6 A;  2MAW A;  3TLS A;  4COF A;  2YN6 A;  2BG9 C;  3EAM A;  4LMK A;  2WNJ A;  3U8N A;  2WN9 A;  2XQ8 A;  4HQP A;  2BR8 A;  5AIN A;  3TLV A;  3C84 A;  3UQ4 A;  2BYQ A;  3ZDH A;  3P50 A;  3ZDG A;  2BJ0 A;  5HCJ A;  1UW6 A;  5KE4 A;  2M6B A;  4IL9 A;  5J5I A;  2YKS A;  5LG3 A;  2LKH A;  3PMZ A;  5J0Z A;  4QAB A;  3SQ6 A;  4ZJT A;  5BRX A;  5LXB A;  5AFJ A;  4QH1 A;  4NPP A;  4HFD A;  4LMJ A;  2XNV A;  4ZRU A;  4B5D A;  5AFL A;  4HFH A;  4QAA A;  4EZ1 A;  3UU6 A;  3LSV A;  2XQ3 A;  2LM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...