3EHZA

X-ray structure of the pentameric ligand gated ion channel of gloebacter violaceus (glic) in a presumptive open conformation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glr4197 protein
publication title Structure of a potentially open state of a proton-activated pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 81
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3ehzA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3ehzA01
4X5TA 3WTIA 3JADA 4NPPA 4HFIA 2WN9A 3EI0A 4ZRUA 2W8FA 2ZJVA 4ZJTA 4ZK4A 4TWHA 3T4MA 3WTMA 4TNVA 4XHEA 3RQWA 3WTKA 5J5GA 3U8JA 4QH1A 2Y7YA 5AFLA 2MAWA 4QH4A 3TLVA 2YMDA 1OEDE 4WV9A 4F8HA 2LKHA 2BR7A 3WTNA 5AFKA 4HFDA 4QH5A 4LMJA 4ZJSA 3ZDGA 1OEDB 3TLTA 5L47A 4UM1A 3LSVA 4FRRA 4ZZBA 2QC1B 2XNUA 3TLWA 4AFHA 3RHWA 4HFEA 5AINA 3ZDHA 2C9TA 4UM3A 2XQ8A 4ZK1A 3RQUA 3TLUA 2BYSA 1OEDC 5IUXA 5J5FA 4UM3P 2LM2A 2XQ7A 5FJVA 3WTLA 3SQ9A 5L4HA 1UV6A 2BR8A 2BYNA 4TNWA 4DBMA 3EHZA 4LMKA 3U8LA 3UU6A 3JAFA 2YN6A 4LMLA 2XQ6A 3SQ6A 3GUAA 4HFHA 3ZKRA 2WNCA 5AFMA 5HEGA 2VL0A 3UUBA 2W8GA 3C79A 4EZ1A 4XK9A 2M6IA 1OEDA 2XZ6A 3SH1A 5BP0A 3WTJA 3UU5A 4HFCA 2XNVA 3RIFA 5HEOA 2YMEA 2ZJUA 4D01A 2BYQA 5JMEA 4COFA 2WNJA 4Z91A 5KE4A 2BJ0A 5J5IA 3UQ7A 1I9BA 4ZR6A 4AFTA 3U8NA 4HQPA 5BW2A 1UW6A 4IL9A 4QAAA 5KZUA 2WZYA 5TVCA 4ALXA 3WIPA 3WTOA 4ZZCA 2Y56A 2YOEA 2XQ4A 5HEUA 2XZ5A 3IGQA 5LXBA 2XQ3A 3TLSA 3P50A 2BG9E 4PIRA 2XQ5A 2M6BA 4QABA 2BG9B 2KSRA 2Y58A 4B5DA 5HCMA 2XYTA 3PMZA 5HEHA 2LKGA 5CFBA 5HEJA 2BYRA 3JAEA 2X00D 3UU4A 2BG9C 2XQ9A 3PEOA 4AFGA 5AFNA 4BQTA 2BYPA 3EAMA 4HFBA 5HCJA 4IREA 3UU8A 2PGZA 2UZ6A 5AFHA 3SIOA 4A97A 3UQ4A 4Z90A 3U8MA 5J5HA 4BFQA 2XNTA 5AFMB 4TWFA 4IL4A 4ILCA 1UX2A 4UY2A 5BRXA 2BG9A 5LG3A 3RI5A 4ILBA 3UU3A 2WNLA 5J0ZA 4TWDA 2YKSA 2PH9A 2X00A 3WTHA 3P4WA 4ILAA 4A98A 5L4EA 3C84A 4NZBA 4QACA 5CO5A 2XYSA 4UXUA 5SYOA 3U8KA 4UM3S 2LLYA 2Y57A 2XQAA 3RIAA 2Y54A 5AFJA
chains in the Genus database with same CATH superfamily
2KZ7B 2Y48B 1SE7A 3CVRA 2UXCT 4JI0T 3RQWA 3U8JA 2MAWA 3AXJA 2CXDA 4UEMA 3RRCA 4WV9A 3UFGA 5A1LA 3BK9A 2XPKA 1UK5A 2NTXA 4YSXA 4UM3A 4U3CA 2J4GA 3FXDB 3X1DA 2WBLA 2CEAA 3AE6A 3GN5B 3BQIA 1YKEB 3O1HA 4JYAT 3SH1A 4HWHA 3RIFA 3LK42 1YQ3A 2I6HA 1U5PA 3OVUA 5KE4A 2BJ0A 2LHRA 1HR0T 4HQPA 3K8PC 3RYCE 4B3TT 2HHHT 5FMNA 1XMQT 3GN5A 3KV6A 2BKPA 3ZMZB 1Y01A 2QGSA 4YT0A 3VKHA 3AVRA 2E5VA 3C50A 1HX1B 3F31A 5L3GB 4AI6A 5AQNB 2LRLA 2WCAA 3AEAA 2OA5A 3HKEE 3PJAA 2WMOA 4A56A 4DIDB 3CPZA 4E7SA 3UQ4A 2WY2A 2LEHA 2VWAA 2K24A 2PG8A 2X00A 2CA5A 3RF1A 2M67A 3I0QA 2N2NA 1E7PA 3T1YT 5HXCA 3RIUC 3WI3A 4KUMB 4YHJA 3R84B 2CHNA 2XAQB 4B3MT 3A5XA 1QSDA 2LKHA 3WTNA 4AKHA 4QH5A 4JBWF 1NAFA 4P0BA 2MOZA 2WU5A 3KV4A 1LVKA 5IUXA 1XMOT 3AB3B 3SFDA 3OPCA 3F2EA 2YDRA 4IHJE 3GUAA 5FKYA 1ZP0A 5AQUB 4IE0A 3ZT5A 4D01A 1XDPA 2V6XA 2VKOA 3CIRA 4LFCT 2CWOA 3KBUA 4TN7B 4JUYA 2FJDA 2YK0A 5C3JA 2CLYB 2YDQA 2Y56A 3Q9DA 1M7KA 5HEUA 4MALA 5CA0E 3EDVA 5DJQC 1H7CA 2XQ5A 3K3OA 4UF0A 2NTYA 2Y58A 3AA7B 2UUBT 3MACA 1HG2A 5FL0A 5JQGE 3CQXC 5AFNA 3R6NA 3NVOA 2PGZA 3SWHA 3C4WA 4IE4A 4KMCA 5BRXA 5J0ZA 2NOXA 3NRYA 4ERRA 4UXUA 4JI1T 5AQSB 3IA3A 4PJJA 2WN9A 2CE7A 5C2TA 3WTKA 4YLHA 2HH7A 1D0ZA 1VCTA 2UUCT 5J1GA 1FMVA 2WDRA 3RQUA 2D2SA 2BYSA 4HN9A 5FY0A 3VR9A 4TV8E 1HX8A 3QUJA 2W0GA 3FZLB 1T72A 3LJCA 3RH3A 5AFMA 2KWHA 4EGWA 2M6IA 3FZFB 3WTJA 3ZYKA 2ZJUA 3ZEFB 2JQKA 4AIUA 5AQFB 2IHR1 4EYUA 3ZN0B 3LK2B 3ONJA 3ZJ1A 2XAFB 3AE7A 3AE4A 2QRXA 2X0LB 3MKDA 4H9QC 1R8IA 3V5UA 4MBQA 4U72A 4WW0A 5LBMA 4HWDA 2BYRA 3JAEA 4DR3T 3PEOA 5AQIB 4P0AA 4L9IA 1UX5A 5LGUB 2I59A 4ZS3A 4CQIA 4ZI2D 4E7ZA 5J5HA 1J5ET 2Y6XA 4A5XA 4ILBA 3WAKA 2WZIA 2XZEA 2IAKA 4A98A 5AQOB 2XYSA 3SOLA 5FXXA 4ZOLE 5CJ5A 2D0UA 3RX6A 2D9DA 4EXTA 1D1CA 4X1IE 4U74A 4JI3T 4EAHA 2L9QA 4ZJSA 3ZDGA 2LSYA 1W09A 1MMGA 3PUGA 3J9X1 3TLUA 3HKBE 1D1AA 3NBXX 5L4HA 4ZI3D 4YHHT 4LMKA 2MYSA 2F4VT 1MNDA 2WNCA 3HR0A 5HEGA 2IUBA 3FZMB 4PJNA 3DJBA 5CGMA 2EHOD 1FMWA 5JMEA 4LF4T 5KXJA 2W4XA 4GYSA 4Z91A 5J5IA 4ZR6A 3RC3A 2MPKA 2XAHB 3RYFE 4DV2T 2XQ4A 3OBVE 4LFBT 2LOSA 2Z6EA 5L3DB 2UU9T 3AAAB 1MMAA 4KI0F 4QXCB 3OTOT 5JR9A 1WR6A 3T1HT 2A2FX 3CX8B 3PV0F 2WS3A 2W2UA 3UU4A 4CI3B 3RC8A 3ETUA 4ZI2C 2JJ9A 5ABEA 4U31A 2HPJA 5AQKB 4JV5T 2K3WA 4GYRA 3OKQA 2QA7A 5F8PA 5JDLA 2WZHA 3PE0A 4ZJTA 5H6RB 2ACXA 2EHOB 2LSIA 2LSGA 1W9RA 1IBKT 4ZZBA 4CXWA 2C9TA 4QX8B 1BR4A 4ZK1A 3TKLB 3PUAA 4I55E 2JPFA 2XQYA 4DBMA 2E9XC 4AQGA 4ZI3C 3PU3A 2EHOA 1UUSA 4H63H 2ZM0A 2CWYA 4COFA 2FJBA 4IDNA 2WNJA 2OLTA 2V7KA 3E0ZA 3Q5WA 1U4QA 5BMVE 5HYAA 5LHGB 5KDMC 3CQCB 4G2AA 1MNEA 3L8RA 4ILUA 3I1AA 2IIUA 3QOFA 2ZMAA 5FY1A 3KVAA 5AQTB 4EYYR 4AKLA 2VVNA 2XSBA 3O4XE 2BG9C 1Z0PA 2E2AA 2BZBA 5L2LA 3Q5DA 4IIJE 2YINA 2V7IA 4B6XA 5CA1E 4B3ST 2K5BB 5LG3A 1IJ6A 4EZ4A 1JNZA 1HTJF 4WYVA 2J47A 2W67A 4AQFC 3OYXA 3ANWA 1I94T 4TWHA 2DLRA 3C98B 1WYCA 4GKJT 4HTEA 2J1DG 3VR8A 2XQ8A 3O1JA 3CX6B 4IGUA 2XUEA 4O2BE 5FYMA 3WTLA 2XTLA 2L8KA 3E22E 1L0VA 2W62A 1YKHB 3JAFA 4IE7A 3SQ6A 3ZKRA 4CI1B 4DMWA 4HFCA 1X9BA 4QHOA 4CN1A 4GKKT 3CX7B 1MIWA 5KX5E 5LA6E 4KHZF 3DP7A 4DV6T 3WIPA 4AXPA 4ZZCA 1WFDA 1T7SA 5LHHB 4UVBB 3P7IA 3ZSTA 3PUXF 3G06A 4DR6T 3AA1B 3AA6B 4JEHB 5HEHA 2LKGA 4C90A 2DNXA 5H6QB 3JC6C 4CZZB 3ZMSB 4Z90A 1MMDA 2WDVA 5LYJE 4TWFA 2Q9QC 1KFYA 3RI5A 3RKOA 3C51A 5LJNA 2LOPA 2Y57A 2WWVA 3GA8A 3A8YC 3FBZA 3T4MA 3WTMA 1D0YA 3LBXB 4IDPA 1WYBA 1HCIA 3E08A 1VCSA 3RIUA 1HFAA 4KHPT 3ZYMA 2X0HA 3ZDHA 3C4XA 1OEDC 4NXNT 1UGOA 4PAGA 2LSJA 2XAGB 5FVLA 2C0SA 5L3EB 3LBXA 4DR7T 2BS3A 2BBJA 2H88A 2BBHA 2D0TA 2BYQA 2ES0A 2UXXB 3RLFF 2KMFA 1I9BA 2BS2A 4IE6A 2HN1A 5LMUT 3CMLA 4HFVA 3ZMVB 5LB7B 3Q5XA 2JIWA 1YW0A 4MFRA 2V8SV 4X66T 2PJQA 4YFSA 2IC6A 5FVKA 5LGNB 1HS7A 4YSYA 2NWBA 3PMZA 2WQYA 4X1KE 2XQ9A 4NXMT 3LG7A 3VRAA 1D0XA 5AQMB 4DV0T 4J2CA 2X51A 2XNTA 1UX2A 1HNXT 2A72A 5SYOA 3DTOA 2SPCA 3M65A 4ISTA 3P8CD 4UR9A 3W15B 3JADA 3MA9A 4NUVA 4TNVA 4DNDA 1DU2A 4XHEA 1LKXA 4F8HA 4TV9E 3U78A 1MMNA 3MJXA 5ABFB 2Y8DA 2PTFA 1XDOA 5AQPB 1FEWA 2UXBT 1US7B 5EZYE 4DUZT 4WZXA 1N32T 4CN6A 1N36T 3C79A 1SUMB 5ABFA 1BR2A 3SFEA 3EDUA 4JI5T 5LGTB 5FXZA 4AKRB 5DQVA 3JCFA 1FIOA 5J2TE 3H3AA 2E5LT 4U33A 2NW9A 2QVAA 2WB5A 2AE9A 3L39A 2ACZA 5FP3A 2VQFT 3ZCIA 4X62T 2DI4A 1N34T 4QABA 5LHIB 1HG5A 1LVFA 5HXSA 2IDOB 2KSRA 2BVMA 2XYTA 5EK2A 2CMRA 2JQQA 2N9DA 4AFGA 1KF6A 4HWFA 4OYJA 3AEDA 5IWAT 4LF8T 4ZEYA 2XSAA 1Y64B 3HI2A 1VRBA 3PUVF 3Q5EA 3KBTA 3K1SA 3ZC1A 4UXNB 5ABGA 4TX5A 3UT5E 2UUAT 2UXDT 4B3RT 1SA0E 4EEBA 3RIAA 3KFWX 5CB4E 1G8XA 4MHCA 5AQRB 4H9RC 4ZRUA 3K3QC 3KV9A 5LG4A 5E0OA 5ABHA 4N78D 4WBOA 2K48A 3L3PA 1CHUA 3AA0B 2BR7A 5TAOA 1ZHCA 3LSVA 3TLWA 4HWCA 4NIQA 3P4SA 5FL1A 5HWXA 3N2KE 4JLEA 1AJ3A 4UIGA 4PK4A 2BR8A 3N9PA 2C5IT 3AE9A 2K9AA 2BKNA 3EHZA 4O4HE 3UU6A 4H9SE 4M1PA 4DR4T 2X9XA 2HN2A 4EZ1A 5L3CB 4QX7B 2XNVA 3B5MA 2CM0A 4O4LE 3U8NA 1WLXA 2E9XD 5F3JA 5TVCA 3N2GE 3SS1A 3CKDA 1FJGT 5LBQB 4X20E 2KWIB 3J7Yq 2V26A 2M6BA 5LJMA 1MIYA 3F57A 5HCMA 4DUYT 4O2AE 3VRBA 5GONE 4HFBA 5LNKA 2X68A 3IBPA 1KEYA 4XAXB 2KLQA 2X9WA 5JDGA 1WRDA 4ZI7E 2P9BA 1N33T 4XZCA 2NW8A 1HNWT 5AQHB 4AFTA 4I43B 1G73A 3HKDE 5ETWA 4BA9A 2KXPB 4MLKA 2ZJVA 4AKGA 3TLVA 5IHYA 4U2YA 3FB2A 2XAJB 4U2ZA 2MBGA 2BKOA 2KINB 2XNUA 3LFMA 4AFHA 4L0RA 2E9XB 4V1Av 2PBIA 3PUYF 3ZT6A 4YTNA 4P09A 4DR5T 4PJLA 5AFUL 3O1IA 2YN6A 4Z8XA 4UVAB 3BQKA 2W8GA 5BP0A 4H63V 1YQ4A 2HPLA 2E9XA 2WDQA 3UQ7A 2H7OA 2V7JA 1YD8G 3EUHA 3B57A 3GMIA 3HL6A 2YOEA 5JRCB 1IBLT 2VQET 2BVLA 4PFPA 5LOVE 4UV8B 5AQLB 3O9XA 2BG9B 2V5DA 3LDQB 3PJAJ 5DQWA 4UVCB 2WSSV 4BJNA 1UURA 2ZLYA 2W63A 3MXZA 4BQTA 2WWUA 3HKCE 5JRCA 5AFHA 4LF6T 1E2AA 4A97A 3U8MA 2LSKA 3I9WA 4PJMA 2BG9A 1ZOYA 2VKHA 4DO0A 4ILAA 3AAIA 2DHRA 3JC6D 2Y54A 4X64T 4NPPA 3PTRB 3EI0A 1KNZA 4BJMA 2W00A 2Y7YA 5LMNT 1YXRA 2XASB 2Q9QD 4AQFA 3NKZA 4LFAT 5L47A 2XY8B 3QC9A 2V1DB 4O8SA 5FNVE 4LF9T 1I6ZA 2XQ7A 3RGLA 5LCYA 3H3MA 5M4YA 1CUNA 2VK9A 3UUBA 4ASKA 2XZ6A 4OHFA 3UU5A 3P4PA 4DV7T 4U7YA 4KP3C 5J2UE 1XZYA 4JEUB 4AISA 4DV1T 3FHNA 5BW2A 4YTPA 3AEBA 3WTOA 2JMHA 4Q25A 4GK0E 4DBRA 4X1YE 5JH7E 5C8YE 1LRZA 4ZXLA 3N9OA 3N9LA 2YEVC 2X00D 4JI8T 2Q9QB 2UZ6A 2FBWA 5EK4A 2AXDS 3AE3A 2LT3A 2WM9A 4I50E 1BR0A 4G63A 3SRZA 2VVSA 3ZMUB 3WTHA 3C84A 2LLYA 3IHRA 3A7MA 4XBFB 2B76A 3KINB 1ZV4X 2VKDA 2Q9QA 5IYZE 2A9UA 5JVDE 3OJAA 4ZHQE 5J5GA 3N9MA 3AEFA 3CQGB 2YMDA 1OEDB 2N1GA 4FRRA 3CK6A 1WCRA 3RHWA 5AINA 1J1JA 3QK6A 3UUNA 4TZ4C 4EZHA 3RYHE 1XWMA 5JTGA 4LF5T 1J5WA 2C5JA 3QB5A 5AQQB 4OK0A 4XK9A 1OEDA 2KT9A 5FY7A 2IMLA 2YMEA 4PFOA 5ADXL 1S94A 2WP9A 2NR4A 4JI6T 1SHZC 4QAAA 4ALXA 3I9YA 5HXEA 5FXWA 3MK7C 4GOUA 1NWMX 2XZ5A 2V6YB 1JNRA 2JRKA 2VL8A 2X67A 3PDYA 1T98A 2W61A 4L5GA 3FXEB 1IBMT 1BR1A 2XHEB 2WMNA 4JI2T 2V6YA 4OYKA 4EEDA 3SIOA 2XM2A 1NENA 2H89A 2PH9A 3P4WA 5L4EA 4X65T 4K0KT 2E8IA 3FZHB 5HXHA 5AFJA 2CCQA 3AECA 5LXTE 1VOMA 4DBQA 4ZK4A 4CXYA 4DV3T 5AFLA 4QH1A 4I0UA 4AQYT 3UULA 4LF7T 3UTKA 4UF0B 4YTMA 4QXHB 2QC1B 2CRBA 3NZPA 4ADZA 4HEAA 3ESLA 5AQJB 3SQ9A 4TNWA 4HGAA 2FJAA 3VHLA 2FJEA 1OWAA 2ZM2A 2X9HA 2DCFA 3AAEB 3S4UA 3T8OA 4CN4A 3ZT7A 1EZ3A 2YU2A 4IL9A 2V7MA 3FZKB 4PW8A 4U7IA 3AEEA 3TLSA 3PU8A 2CLYC 2XM1A 3PURA 3KVBA 5AQGB 2IW5B 4TUYE 5HWYA 1KNRA 3I0OA 2WAUA 2PFVA 5HCJA 3UU8A 2NW7A 1ZKEA 5AFMB 4FJOA 4ILCA 2DWGA 3N5LA 2IC9A 3MZKB 2I0MA 4TWDA 2RP4A 4HWIB 4FI5A 5EK3A 3U8KA 4K0UA 3RPUA 1XNQT 2VL0A 4CXXA 2V7LA 2QYWA 3L09A 1NEKA 2RPAA 3U3IA 4ANJA 4HE8A 5JDNA 4CI2B 3ZCJA 5L3FB 4KBMB 3CWZB 5AFKA 4DR2T 4IDQA 2DL1A 4HFEA 3ZN1B 1S35A 2D5UA 5HXRA 3UFEA 3H37A 2LM9A 5J5FA 2LM2A 5JREA 1IJ5A 4YXDA 3N9NA 3WAJA 1W0BA 4YY3T 2X0YA 3AE2A 1OXZA 2JQHA 2VASA 4HFHA 4ISSA 5HAXA 1WR0A 3Q2MA 1O3XA 2CXLA 3EABA 2DWKA 3PUWF 3KV5A 5BR8T 2LE8A 4WNKA 1D1BA 5KZUA 2WZYA 3QB5K 4EOZB 3IGQA 2KNDA 2XQ3A 4ZS2A 3ZMTB 2BG9E 4O4JE 4PIRA 2W66A 3AVSA 2H7VC 2ZM6T 3P4QA 3EAMA 3AEGA 4IREA 1B7TA 4IDZA 1QLBA 1V9DA 3ZJ2A 3N9QA 4JI7T 5JDQA 5CO5A 2C5KT 3V5SA 1KNPA 4GIWA 4X5TA 3WTIA 4HFIA 2W8FA 3ONXA 4QH4A 2B1EA 4LMJA 3RYIE 2GK9A 1MIVA 2ODUA 4O4IE 4BAYB 3HA4A 2XJ7A 3NWIA 5JR9B 4DR1T 2YU1A 5FJVA 1UV6A 2BYNA 4H9NC 1ZEEA 3U8LA 1Z8UA 4LMLA 4EB6E 3GWHA 5JDFA 2V5CA 2XQ6A 4YSZA 3PUQA 4DVDA 3B13A 1X79A 2CPTA 3OYZA 4F6RC 4DMVA 3P4RA 5HEOA 2ODVA 3IF8B 3AE8A 4QKNA 3QNUA 2OV9A 3IEEA 5FXVA 2L3LA 2LJLA 2H3RA 2UXNB 2X66A 4P1NA 4AKIA 3FBLA 5JR9C 3ZYLA 4WBNE 3RKGA 3ZPOA 5LXBA 4QWNB 2VURA 3RRWA 1UCUA 3LK3B 4IT4A 1GQEA 4B5DA 2CHOA 4YJ2E 5L3BB 5CFBA 4H9PC 4YJ3E 3PUSA 4QXBB 5AQVB 2BYPA 2A3DA 3ZSSA 3C4ZA 4OFZA 4UY2A 4PK5A 1KK7A 2WNLA 5DABA 2YKSA 2YDSA 2G0UA 4KX6A 3ETVA 2WU2A 2XQAA 3NZQA 4EIWA 3UUXB 3ZLIA 4EV6A 4NUUA 3ZC0A 5F5WA 5KMGP 1XNRT 1OEDE 2JMKA 1E1HB 4HFDA 4JI4T 3TLTA 4UM1A 2R6GF 2EHOC 3M3ZB 4PK6A 2FUPA 1HNZT 4UM3P 3K3NA 3UUMA 1W0AA 2X9YA 4PNIA 1QUUA 1IAPA 3ONLC 3ABVA 3N2OA 2MTQA 2CXFA 4GK5E 4UELA 3KDSE 2JQ9A 2NP9A 4OX9T 1UW6A 2LRKA 3ANWB 3EVYA 3AE5A 3NRXA 2LHNA 4IE5A 1T8BA 2J62A 5JDMA 1M62A 1HF8A 3P50A 1UX4A 4H9OC 4DV5T 2ZM8A 4HKAA 3C64A 2CBJA 2BS4A 5LP6E 3VKGA 4UV9B 3VU7H 5HEJA 1IZNB 4I4TE 2BDEA 3PUZF 5JDHA 2VB6A 2CBIA 3D0TA 4BFQA 3AXJB 4IL4A 4IDOA 2VKJA 3UU3A 4QACA 4NZBA 4UM3S 2RA1A 4C91A 4DV4T 3BQLA 3AE1A
chains in the Genus database with same CATH topology
4X5TA 3WTIA 3JADA 4NPPA 4HFIA 2WN9A 3EI0A 4ZRUA 2W8FA 2ZJVA 4ZJTA 4ZK4A 4TWHA 3T4MA 3WTMA 4TNVA 4XHEA 3RQWA 3WTKA 5J5GA 3U8JA 4QH1A 2Y7YA 5AFLA 2MAWA 4QH4A 3TLVA 2YMDA 1OEDE 4WV9A 4F8HA 2LKHA 2BR7A 3WTNA 5AFKA 4HFDA 4QH5A 4LMJA 4ZJSA 3ZDGA 1OEDB 3TLTA 5L47A 4UM1A 3LSVA 4FRRA 4ZZBA 2QC1B 2XNUA 3TLWA 4AFHA 3RHWA 4HFEA 5AINA 3ZDHA 2C9TA 4UM3A 2XQ8A 4ZK1A 3RQUA 3TLUA 2BYSA 1OEDC 5IUXA 5J5FA 4UM3P 2LM2A 2XQ7A 5FJVA 3WTLA 3SQ9A 5L4HA 1UV6A 2BR8A 2BYNA 4TNWA 4DBMA 3EHZA 4LMKA 3U8LA 3UU6A 3JAFA 2YN6A 4LMLA 2XQ6A 3SQ6A 3GUAA 4HFHA 3ZKRA 2WNCA 5AFMA 5HEGA 2VL0A 3UUBA 2W8GA 3C79A 4EZ1A 4XK9A 2M6IA 1OEDA 2XZ6A 3SH1A 5BP0A 3WTJA 3UU5A 4HFCA 2XNVA 3RIFA 5HEOA 2YMEA 2ZJUA 4D01A 2BYQA 5JMEA 4COFA 2WNJA 4Z91A 5KE4A 2BJ0A 5J5IA 3UQ7A 1I9BA 4ZR6A 4AFTA 3U8NA 4HQPA 5BW2A 1UW6A 4IL9A 4QAAA 5KZUA 2WZYA 5TVCA 4ALXA 3WIPA 3WTOA 4ZZCA 2Y56A 2YOEA 2XQ4A 5HEUA 2XZ5A 3IGQA 5LXBA 2XQ3A 3TLSA 3P50A 2BG9E 4PIRA 2XQ5A 2M6BA 4QABA 2BG9B 2KSRA 2Y58A 4B5DA 5HCMA 2XYTA 3PMZA 5HEHA 2LKGA 5CFBA 5HEJA 2BYRA 3JAEA 2X00D 3UU4A 2BG9C 2XQ9A 3PEOA 4AFGA 5AFNA 4BQTA 2BYPA 3EAMA 4HFBA 5HCJA 4IREA 3UU8A 2PGZA 2UZ6A 5AFHA 3SIOA 4A97A 3UQ4A 4Z90A 3U8MA 5J5HA 4BFQA 2XNTA 5AFMB 4TWFA 4IL4A 4ILCA 1UX2A 4UY2A 5BRXA 2BG9A 5LG3A 3RI5A 4ILBA 3UU3A 2WNLA 5J0ZA 4TWDA 2YKSA 2PH9A 2X00A 3WTHA 3P4WA 4ILAA 4A98A 5L4EA 3C84A 4NZBA 4QACA 5CO5A 2XYSA 4UXUA 5SYOA 3U8KA 4UM3S 2LLYA 2Y57A 2XQAA 3RIAA 2Y54A 5AFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X5T A;  3WTI A;  3JAD A;  4NPP A;  4HFI A;  2WN9 A;  3EI0 A;  4ZRU A;  2W8F A;  2ZJV A;  4ZJT A;  4ZK4 A;  4TWH A;  3T4M A;  3WTM A;  4TNV A;  4XHE A;  3RQW A;  3WTK A;  5J5G A;  3U8J A;  4QH1 A;  2Y7Y A;  5AFL A;  2MAW A;  4QH4 A;  3TLV A;  2YMD A;  1OED E;  4WV9 A;  4F8H A;  2LKH A;  2BR7 A;  3WTN A;  5AFK A;  4HFD A;  4QH5 A;  4LMJ A;  4ZJS A;  3ZDG A;  1OED B;  3TLT A;  5L47 A;  4UM1 A;  3LSV A;  4FRR A;  4ZZB A;  2QC1 B;  2XNU A;  3TLW A;  4AFH A;  3RHW A;  4HFE A;  5AIN A;  3ZDH A;  2C9T A;  4UM3 A;  2XQ8 A;  4ZK1 A;  3RQU A;  3TLU A;  2BYS A;  1OED C;  5IUX A;  5J5F A;  4UM3 P;  2LM2 A;  2XQ7 A;  5FJV A;  3WTL A;  3SQ9 A;  5L4H A;  1UV6 A;  2BR8 A;  2BYN A;  4TNW A;  4DBM A;  3EHZ A;  4LMK A;  3U8L A;  3UU6 A;  3JAF A;  2YN6 A;  4LML A;  2XQ6 A;  3SQ6 A;  3GUA A;  4HFH A;  3ZKR A;  2WNC A;  5AFM A;  5HEG A;  2VL0 A;  3UUB A;  2W8G A;  3C79 A;  4EZ1 A;  4XK9 A;  2M6I A;  1OED A;  2XZ6 A;  3SH1 A;  5BP0 A;  3WTJ A;  3UU5 A;  4HFC A;  2XNV A;  3RIF A;  5HEO A;  2YME A;  2ZJU A;  4D01 A;  2BYQ A;  5JME A;  4COF A;  2WNJ A;  4Z91 A;  5KE4 A;  2BJ0 A;  5J5I A;  3UQ7 A;  1I9B A;  4ZR6 A;  4AFT A;  3U8N A;  4HQP A;  5BW2 A;  1UW6 A;  4IL9 A;  4QAA A;  5KZU A;  2WZY A;  5TVC A;  4ALX A;  3WIP A;  3WTO A;  4ZZC A;  2Y56 A;  2YOE A;  2XQ4 A;  5HEU A;  2XZ5 A;  3IGQ A;  5LXB A;  2XQ3 A;  3TLS A;  3P50 A;  2BG9 E;  4PIR A;  2XQ5 A;  2M6B A;  4QAB A;  2BG9 B;  2KSR A;  2Y58 A;  4B5D A;  5HCM A;  2XYT A;  3PMZ A;  5HEH A;  2LKG A;  5CFB A;  5HEJ A;  2BYR A;  3JAE A;  2X00 D;  3UU4 A;  2BG9 C;  2XQ9 A;  3PEO A;  4AFG A;  5AFN A;  4BQT A;  2BYP A;  3EAM A;  4HFB A;  5HCJ A;  4IRE A;  3UU8 A;  2PGZ A;  2UZ6 A;  5AFH A;  3SIO A;  4A97 A;  3UQ4 A;  4Z90 A;  3U8M A;  5J5H A;  4BFQ A;  2XNT A;  5AFM B;  4TWF A;  4IL4 A;  4ILC A;  1UX2 A;  4UY2 A;  5BRX A;  2BG9 A;  5LG3 A;  3RI5 A;  4ILB A;  3UU3 A;  2WNL A;  5J0Z A;  4TWD A;  2YKS A;  2PH9 A;  2X00 A;  3WTH A;  3P4W A;  4ILA A;  4A98 A;  5L4E A;  3C84 A;  4NZB A;  4QAC A;  5CO5 A;  2XYS A;  4UXU A;  5SYO A;  3U8K A;  4UM3 S;  2LLY A;  2Y57 A;  2XQA A;  3RIA A;  2Y54 A;  5AFJ A; 
#chains in the Genus database with same CATH topology
 2KZ7 B;  2Y48 B;  1SE7 A;  3CVR A;  2UXC T;  4JI0 T;  3RQW A;  3U8J A;  2MAW A;  3AXJ A;  2CXD A;  4UEM A;  3RRC A;  4WV9 A;  3UFG A;  5A1L A;  3BK9 A;  2XPK A;  1UK5 A;  2NTX A;  4YSX A;  4UM3 A;  4U3C A;  2J4G A;  3FXD B;  3X1D A;  2WBL A;  2CEA A;  3AE6 A;  3GN5 B;  3BQI A;  1YKE B;  3O1H A;  4JYA T;  3SH1 A;  4HWH A;  3RIF A;  3LK4 2;  1YQ3 A;  2I6H A;  1U5P A;  3OVU A;  5KE4 A;  2BJ0 A;  2LHR A;  1HR0 T;  4HQP A;  3K8P C;  3RYC E;  4B3T T;  2HHH T;  5FMN A;  1XMQ T;  3GN5 A;  3KV6 A;  2BKP A;  3ZMZ B;  1Y01 A;  2QGS A;  4YT0 A;  3VKH A;  3AVR A;  2E5V A;  3C50 A;  1HX1 B;  3F31 A;  5L3G B;  4AI6 A;  5AQN B;  2LRL A;  2WCA A;  3AEA A;  2OA5 A;  3HKE E;  3PJA A;  2WMO A;  4A56 A;  4DID B;  3CPZ A;  4E7S A;  3UQ4 A;  2WY2 A;  2LEH A;  2VWA A;  2K24 A;  2PG8 A;  2X00 A;  2CA5 A;  3RF1 A;  2M67 A;  3I0Q A;  2N2N A;  1E7P A;  3T1Y T;  5HXC A;  3RIU C;  3WI3 A;  4KUM B;  4YHJ A;  3R84 B;  2CHN A;  2XAQ B;  4B3M T;  3A5X A;  1QSD A;  2LKH A;  3WTN A;  4AKH A;  4QH5 A;  4JBW F;  1NAF A;  4P0B A;  2MOZ A;  2WU5 A;  3KV4 A;  1LVK A;  5IUX A;  1XMO T;  3AB3 B;  3SFD A;  3OPC A;  3F2E A;  2YDR A;  4IHJ E;  3GUA A;  5FKY A;  1ZP0 A;  5AQU B;  4IE0 A;  3ZT5 A;  4D01 A;  1XDP A;  2V6X A;  2VKO A;  3CIR A;  4LFC T;  2CWO A;  3KBU A;  4TN7 B;  4JUY A;  2FJD A;  2YK0 A;  5C3J A;  2CLY B;  2YDQ A;  2Y56 A;  3Q9D A;  1M7K A;  5HEU A;  4MAL A;  5CA0 E;  3EDV A;  5DJQ C;  1H7C A;  2XQ5 A;  3K3O A;  4UF0 A;  2NTY A;  2Y58 A;  3AA7 B;  2UUB T;  3MAC A;  1HG2 A;  5FL0 A;  5JQG E;  3CQX C;  5AFN A;  3R6N A;  3NVO A;  2PGZ A;  3SWH A;  3C4W A;  4IE4 A;  4KMC A;  5BRX A;  5J0Z A;  2NOX A;  3NRY A;  4ERR A;  4UXU A;  4JI1 T;  5AQS B;  3IA3 A;  4PJJ A;  2WN9 A;  2CE7 A;  5C2T A;  3WTK A;  4YLH A;  2HH7 A;  1D0Z A;  1VCT A;  2UUC T;  5J1G A;  1FMV A;  2WDR A;  3RQU A;  2D2S A;  2BYS A;  4HN9 A;  5FY0 A;  3VR9 A;  4TV8 E;  1HX8 A;  3QUJ A;  2W0G A;  3FZL B;  1T72 A;  3LJC A;  3RH3 A;  5AFM A;  2KWH A;  4EGW A;  2M6I A;  3FZF B;  3WTJ A;  3ZYK A;  2ZJU A;  3ZEF B;  2JQK A;  4AIU A;  5AQF B;  2IHR 1;  4EYU A;  3ZN0 B;  3LK2 B;  3ONJ A;  3ZJ1 A;  2XAF B;  3AE7 A;  3AE4 A;  2QRX A;  2X0L B;  3MKD A;  4H9Q C;  1R8I A;  3V5U A;  4MBQ A;  4U72 A;  4WW0 A;  5LBM A;  4HWD A;  2BYR A;  3JAE A;  4DR3 T;  3PEO A;  5AQI B;  4P0A A;  4L9I A;  1UX5 A;  5LGU B;  2I59 A;  4ZS3 A;  4CQI A;  4ZI2 D;  4E7Z A;  5J5H A;  1J5E T;  2Y6X A;  4A5X A;  4ILB A;  3WAK A;  2WZI A;  2XZE A;  2IAK A;  4A98 A;  5AQO B;  2XYS A;  3SOL A;  5FXX A;  4ZOL E;  5CJ5 A;  2D0U A;  3RX6 A;  2D9D A;  4EXT A;  1D1C A;  4X1I E;  4U74 A;  4JI3 T;  4EAH A;  2L9Q A;  4ZJS A;  3ZDG A;  2LSY A;  1W09 A;  1MMG A;  3PUG A;  3J9X 1;  3TLU A;  3HKB E;  1D1A A;  3NBX X;  5L4H A;  4ZI3 D;  4YHH T;  4LMK A;  2MYS A;  2F4V T;  1MND A;  2WNC A;  3HR0 A;  5HEG A;  2IUB A;  3FZM B;  4PJN A;  3DJB A;  5CGM A;  2EHO D;  1FMW A;  5JME A;  4LF4 T;  5KXJ A;  2W4X A;  4GYS A;  4Z91 A;  5J5I A;  4ZR6 A;  3RC3 A;  2MPK A;  2XAH B;  3RYF E;  4DV2 T;  2XQ4 A;  3OBV E;  4LFB T;  2LOS A;  2Z6E A;  5L3D B;  2UU9 T;  3AAA B;  1MMA A;  4KI0 F;  4QXC B;  3OTO T;  5JR9 A;  1WR6 A;  3T1H T;  2A2F X;  3CX8 B;  3PV0 F;  2WS3 A;  2W2U A;  3UU4 A;  4CI3 B;  3RC8 A;  3ETU A;  4ZI2 C;  2JJ9 A;  5ABE A;  4U31 A;  2HPJ A;  5AQK B;  4JV5 T;  2K3W A;  4GYR A;  3OKQ A;  2QA7 A;  5F8P A;  5JDL A;  2WZH A;  3PE0 A;  4ZJT A;  5H6R B;  2ACX A;  2EHO B;  2LSI A;  2LSG A;  1W9R A;  1IBK T;  4ZZB A;  4CXW A;  2C9T A;  4QX8 B;  1BR4 A;  4ZK1 A;  3TKL B;  3PUA A;  4I55 E;  2JPF A;  2XQY A;  4DBM A;  2E9X C;  4AQG A;  4ZI3 C;  3PU3 A;  2EHO A;  1UUS A;  4H63 H;  2ZM0 A;  2CWY A;  4COF A;  2FJB A;  4IDN A;  2WNJ A;  2OLT A;  2V7K A;  3E0Z A;  3Q5W A;  1U4Q A;  5BMV E;  5HYA A;  5LHG B;  5KDM C;  3CQC B;  4G2A A;  1MNE A;  3L8R A;  4ILU A;  3I1A A;  2IIU A;  3QOF A;  2ZMA A;  5FY1 A;  3KVA A;  5AQT B;  4EYY R;  4AKL A;  2VVN A;  2XSB A;  3O4X E;  2BG9 C;  1Z0P A;  2E2A A;  2BZB A;  5L2L A;  3Q5D A;  4IIJ E;  2YIN A;  2V7I A;  4B6X A;  5CA1 E;  4B3S T;  2K5B B;  5LG3 A;  1IJ6 A;  4EZ4 A;  1JNZ A;  1HTJ F;  4WYV A;  2J47 A;  2W67 A;  4AQF C;  3OYX A;  3ANW A;  1I94 T;  4TWH A;  2DLR A;  3C98 B;  1WYC A;  4GKJ T;  4HTE A;  2J1D G;  3VR8 A;  2XQ8 A;  3O1J A;  3CX6 B;  4IGU A;  2XUE A;  4O2B E;  5FYM A;  3WTL A;  2XTL A;  2L8K A;  3E22 E;  1L0V A;  2W62 A;  1YKH B;  3JAF A;  4IE7 A;  3SQ6 A;  3ZKR A;  4CI1 B;  4DMW A;  4HFC A;  1X9B A;  4QHO A;  4CN1 A;  4GKK T;  3CX7 B;  1MIW A;  5KX5 E;  5LA6 E;  4KHZ F;  3DP7 A;  4DV6 T;  3WIP A;  4AXP A;  4ZZC A;  1WFD A;  1T7S A;  5LHH B;  4UVB B;  3P7I A;  3ZST A;  3PUX F;  3G06 A;  4DR6 T;  3AA1 B;  3AA6 B;  4JEH B;  5HEH A;  2LKG A;  4C90 A;  2DNX A;  5H6Q B;  3JC6 C;  4CZZ B;  3ZMS B;  4Z90 A;  1MMD A;  2WDV A;  5LYJ E;  4TWF A;  2Q9Q C;  1KFY A;  3RI5 A;  3RKO A;  3C51 A;  5LJN A;  2LOP A;  2Y57 A;  2WWV A;  3GA8 A;  3A8Y C;  3FBZ A;  3T4M A;  3WTM A;  1D0Y A;  3LBX B;  4IDP A;  1WYB A;  1HCI A;  3E08 A;  1VCS A;  3RIU A;  1HFA A;  4KHP T;  3ZYM A;  2X0H A;  3ZDH A;  3C4X A;  1OED C;  4NXN T;  1UGO A;  4PAG A;  2LSJ A;  2XAG B;  5FVL A;  2C0S A;  5L3E B;  3LBX A;  4DR7 T;  2BS3 A;  2BBJ A;  2H88 A;  2BBH A;  2D0T A;  2BYQ A;  2ES0 A;  2UXX B;  3RLF F;  2KMF A;  1I9B A;  2BS2 A;  4IE6 A;  2HN1 A;  5LMU T;  3CML A;  4HFV A;  3ZMV B;  5LB7 B;  3Q5X A;  2JIW A;  1YW0 A;  4MFR A;  2V8S V;  4X66 T;  2PJQ A;  4YFS A;  2IC6 A;  5FVK A;  5LGN B;  1HS7 A;  4YSY A;  2NWB A;  3PMZ A;  2WQY A;  4X1K E;  2XQ9 A;  4NXM T;  3LG7 A;  3VRA A;  1D0X A;  5AQM B;  4DV0 T;  4J2C A;  2X51 A;  2XNT A;  1UX2 A;  1HNX T;  2A72 A;  5SYO A;  3DTO A;  2SPC A;  3M65 A;  4IST A;  3P8C D;  4UR9 A;  3W15 B;  3JAD A;  3MA9 A;  4NUV A;  4TNV A;  4DND A;  1DU2 A;  4XHE A;  1LKX A;  4F8H A;  4TV9 E;  3U78 A;  1MMN A;  3MJX A;  5ABF B;  2Y8D A;  2PTF A;  1XDO A;  5AQP B;  1FEW A;  2UXB T;  1US7 B;  5EZY E;  4DUZ T;  4WZX A;  1N32 T;  4CN6 A;  1N36 T;  3C79 A;  1SUM B;  5ABF A;  1BR2 A;  3SFE A;  3EDU A;  4JI5 T;  5LGT B;  5FXZ A;  4AKR B;  5DQV A;  3JCF A;  1FIO A;  5J2T E;  3H3A A;  2E5L T;  4U33 A;  2NW9 A;  2QVA A;  2WB5 A;  2AE9 A;  3L39 A;  2ACZ A;  5FP3 A;  2VQF T;  3ZCI A;  4X62 T;  2DI4 A;  1N34 T;  4QAB A;  5LHI B;  1HG5 A;  1LVF A;  5HXS A;  2IDO B;  2KSR A;  2BVM A;  2XYT A;  5EK2 A;  2CMR A;  2JQQ A;  2N9D A;  4AFG A;  1KF6 A;  4HWF A;  4OYJ A;  3AED A;  5IWA T;  4LF8 T;  4ZEY A;  2XSA A;  1Y64 B;  3HI2 A;  1VRB A;  3PUV F;  3Q5E A;  3KBT A;  3K1S A;  3ZC1 A;  4UXN B;  5ABG A;  4TX5 A;  3UT5 E;  2UUA T;  2UXD T;  4B3R T;  1SA0 E;  4EEB A;  3RIA A;  3KFW X;  5CB4 E;  1G8X A;  4MHC A;  5AQR B;  4H9R C;  4ZRU A;  3K3Q C;  3KV9 A;  5LG4 A;  5E0O A;  5ABH A;  4N78 D;  4WBO A;  2K48 A;  3L3P A;  1CHU A;  3AA0 B;  2BR7 A;  5TAO A;  1ZHC A;  3LSV A;  3TLW A;  4HWC A;  4NIQ A;  3P4S A;  5FL1 A;  5HWX A;  3N2K E;  4JLE A;  1AJ3 A;  4UIG A;  4PK4 A;  2BR8 A;  3N9P A;  2C5I T;  3AE9 A;  2K9A A;  2BKN A;  3EHZ A;  4O4H E;  3UU6 A;  4H9S E;  4M1P A;  4DR4 T;  2X9X A;  2HN2 A;  4EZ1 A;  5L3C B;  4QX7 B;  2XNV A;  3B5M A;  2CM0 A;  4O4L E;  3U8N A;  1WLX A;  2E9X D;  5F3J A;  5TVC A;  3N2G E;  3SS1 A;  3CKD A;  1FJG T;  5LBQ B;  4X20 E;  2KWI B;  3J7Y q;  2V26 A;  2M6B A;  5LJM A;  1MIY A;  3F57 A;  5HCM A;  4DUY T;  4O2A E;  3VRB A;  5GON E;  4HFB A;  5LNK A;  2X68 A;  3IBP A;  1KEY A;  4XAX B;  2KLQ A;  2X9W A;  5JDG A;  1WRD A;  4ZI7 E;  2P9B A;  1N33 T;  4XZC A;  2NW8 A;  1HNW T;  5AQH B;  4AFT A;  4I43 B;  1G73 A;  3HKD E;  5ETW A;  4BA9 A;  2KXP B;  4MLK A;  2ZJV A;  4AKG A;  3TLV A;  5IHY A;  4U2Y A;  3FB2 A;  2XAJ B;  4U2Z A;  2MBG A;  2BKO A;  2KIN B;  2XNU A;  3LFM A;  4AFH A;  4L0R A;  2E9X B;  4V1A v;  2PBI A;  3PUY F;  3ZT6 A;  4YTN A;  4P09 A;  4DR5 T;  4PJL A;  5AFU L;  3O1I A;  2YN6 A;  4Z8X A;  4UVA B;  3BQK A;  2W8G A;  5BP0 A;  4H63 V;  1YQ4 A;  2HPL A;  2E9X A;  2WDQ A;  3UQ7 A;  2H7O A;  2V7J A;  1YD8 G;  3EUH A;  3B57 A;  3GMI A;  3HL6 A;  2YOE A;  5JRC B;  1IBL T;  2VQE T;  2BVL A;  4PFP A;  5LOV E;  4UV8 B;  5AQL B;  3O9X A;  2BG9 B;  2V5D A;  3LDQ B;  3PJA J;  5DQW A;  4UVC B;  2WSS V;  4BJN A;  1UUR A;  2ZLY A;  2W63 A;  3MXZ A;  4BQT A;  2WWU A;  3HKC E;  5JRC A;  5AFH A;  4LF6 T;  1E2A A;  4A97 A;  3U8M A;  2LSK A;  3I9W A;  4PJM A;  2BG9 A;  1ZOY A;  2VKH A;  4DO0 A;  4ILA A;  3AAI A;  2DHR A;  3JC6 D;  2Y54 A;  4X64 T;  4NPP A;  3PTR B;  3EI0 A;  1KNZ A;  4BJM A;  2W00 A;  2Y7Y A;  5LMN T;  1YXR A;  2XAS B;  2Q9Q D;  4AQF A;  3NKZ A;  4LFA T;  5L47 A;  2XY8 B;  3QC9 A;  2V1D B;  4O8S A;  5FNV E;  4LF9 T;  1I6Z A;  2XQ7 A;  3RGL A;  5LCY A;  3H3M A;  5M4Y A;  1CUN A;  2VK9 A;  3UUB A;  4ASK A;  2XZ6 A;  4OHF A;  3UU5 A;  3P4P A;  4DV7 T;  4U7Y A;  4KP3 C;  5J2U E;  1XZY A;  4JEU B;  4AIS A;  4DV1 T;  3FHN A;  5BW2 A;  4YTP A;  3AEB A;  3WTO A;  2JMH A;  4Q25 A;  4GK0 E;  4DBR A;  4X1Y E;  5JH7 E;  5C8Y E;  1LRZ A;  4ZXL A;  3N9O A;  3N9L A;  2YEV C;  2X00 D;  4JI8 T;  2Q9Q B;  2UZ6 A;  2FBW A;  5EK4 A;  2AXD S;  3AE3 A;  2LT3 A;  2WM9 A;  4I50 E;  1BR0 A;  4G63 A;  3SRZ A;  2VVS A;  3ZMU B;  3WTH A;  3C84 A;  2LLY A;  3IHR A;  3A7M A;  4XBF B;  2B76 A;  3KIN B;  1ZV4 X;  2VKD A;  2Q9Q A;  5IYZ E;  2A9U A;  5JVD E;  3OJA A;  4ZHQ E;  5J5G A;  3N9M A;  3AEF A;  3CQG B;  2YMD A;  1OED B;  2N1G A;  4FRR A;  3CK6 A;  1WCR A;  3RHW A;  5AIN A;  1J1J A;  3QK6 A;  3UUN A;  4TZ4 C;  4EZH A;  3RYH E;  1XWM A;  5JTG A;  4LF5 T;  1J5W A;  2C5J A;  3QB5 A;  5AQQ B;  4OK0 A;  4XK9 A;  1OED A;  2KT9 A;  5FY7 A;  2IML A;  2YME A;  4PFO A;  5ADX L;  1S94 A;  2WP9 A;  2NR4 A;  4JI6 T;  1SHZ C;  4QAA A;  4ALX A;  3I9Y A;  5HXE A;  5FXW A;  3MK7 C;  4GOU A;  1NWM X;  2XZ5 A;  2V6Y B;  1JNR A;  2JRK A;  2VL8 A;  2X67 A;  3PDY A;  1T98 A;  2W61 A;  4L5G A;  3FXE B;  1IBM T;  1BR1 A;  2XHE B;  2WMN A;  4JI2 T;  2V6Y A;  4OYK A;  4EED A;  3SIO A;  2XM2 A;  1NEN A;  2H89 A;  2PH9 A;  3P4W A;  5L4E A;  4X65 T;  4K0K T;  2E8I A;  3FZH B;  5HXH A;  5AFJ A;  2CCQ A;  3AEC A;  5LXT E;  1VOM A;  4DBQ A;  4ZK4 A;  4CXY A;  4DV3 T;  5AFL A;  4QH1 A;  4I0U A;  4AQY T;  3UUL A;  4LF7 T;  3UTK A;  4UF0 B;  4YTM A;  4QXH B;  2QC1 B;  2CRB A;  3NZP A;  4ADZ A;  4HEA A;  3ESL A;  5AQJ B;  3SQ9 A;  4TNW A;  4HGA A;  2FJA A;  3VHL A;  2FJE A;  1OWA A;  2ZM2 A;  2X9H A;  2DCF A;  3AAE B;  3S4U A;  3T8O A;  4CN4 A;  3ZT7 A;  1EZ3 A;  2YU2 A;  4IL9 A;  2V7M A;  3FZK B;  4PW8 A;  4U7I A;  3AEE A;  3TLS A;  3PU8 A;  2CLY C;  2XM1 A;  3PUR A;  3KVB A;  5AQG B;  2IW5 B;  4TUY E;  5HWY A;  1KNR A;  3I0O A;  2WAU A;  2PFV A;  5HCJ A;  3UU8 A;  2NW7 A;  1ZKE A;  5AFM B;  4FJO A;  4ILC A;  2DWG A;  3N5L A;  2IC9 A;  3MZK B;  2I0M A;  4TWD A;  2RP4 A;  4HWI B;  4FI5 A;  5EK3 A;  3U8K A;  4K0U A;  3RPU A;  1XNQ T;  2VL0 A;  4CXX A;  2V7L A;  2QYW A;  3L09 A;  1NEK A;  2RPA A;  3U3I A;  4ANJ A;  4HE8 A;  5JDN A;  4CI2 B;  3ZCJ A;  5L3F B;  4KBM B;  3CWZ B;  5AFK A;  4DR2 T;  4IDQ A;  2DL1 A;  4HFE A;  3ZN1 B;  1S35 A;  2D5U A;  5HXR A;  3UFE A;  3H37 A;  2LM9 A;  5J5F A;  2LM2 A;  5JRE A;  1IJ5 A;  4YXD A;  3N9N A;  3WAJ A;  1W0B A;  4YY3 T;  2X0Y A;  3AE2 A;  1OXZ A;  2JQH A;  2VAS A;  4HFH A;  4ISS A;  5HAX A;  1WR0 A;  3Q2M A;  1O3X A;  2CXL A;  3EAB A;  2DWK A;  3PUW F;  3KV5 A;  5BR8 T;  2LE8 A;  4WNK A;  1D1B A;  5KZU A;  2WZY A;  3QB5 K;  4EOZ B;  3IGQ A;  2KND A;  2XQ3 A;  4ZS2 A;  3ZMT B;  2BG9 E;  4O4J E;  4PIR A;  2W66 A;  3AVS A;  2H7V C;  2ZM6 T;  3P4Q A;  3EAM A;  3AEG A;  4IRE A;  1B7T A;  4IDZ A;  1QLB A;  1V9D A;  3ZJ2 A;  3N9Q A;  4JI7 T;  5JDQ A;  5CO5 A;  2C5K T;  3V5S A;  1KNP A;  4GIW A;  4X5T A;  3WTI A;  4HFI A;  2W8F A;  3ONX A;  4QH4 A;  2B1E A;  4LMJ A;  3RYI E;  2GK9 A;  1MIV A;  2ODU A;  4O4I E;  4BAY B;  3HA4 A;  2XJ7 A;  3NWI A;  5JR9 B;  4DR1 T;  2YU1 A;  5FJV A;  1UV6 A;  2BYN A;  4H9N C;  1ZEE A;  3U8L A;  1Z8U A;  4LML A;  4EB6 E;  3GWH A;  5JDF A;  2V5C A;  2XQ6 A;  4YSZ A;  3PUQ A;  4DVD A;  3B13 A;  1X79 A;  2CPT A;  3OYZ A;  4F6R C;  4DMV A;  3P4R A;  5HEO A;  2ODV A;  3IF8 B;  3AE8 A;  4QKN A;  3QNU A;  2OV9 A;  3IEE A;  5FXV A;  2L3L A;  2LJL A;  2H3R A;  2UXN B;  2X66 A;  4P1N A;  4AKI A;  3FBL A;  5JR9 C;  3ZYL A;  4WBN E;  3RKG A;  3ZPO A;  5LXB A;  4QWN B;  2VUR A;  3RRW A;  1UCU A;  3LK3 B;  4IT4 A;  1GQE A;  4B5D A;  2CHO A;  4YJ2 E;  5L3B B;  5CFB A;  4H9P C;  4YJ3 E;  3PUS A;  4QXB B;  5AQV B;  2BYP A;  2A3D A;  3ZSS A;  3C4Z A;  4OFZ A;  4UY2 A;  4PK5 A;  1KK7 A;  2WNL A;  5DAB A;  2YKS A;  2YDS A;  2G0U A;  4KX6 A;  3ETV A;  2WU2 A;  2XQA A;  3NZQ A;  4EIW A;  3UUX B;  3ZLI A;  4EV6 A;  4NUU A;  3ZC0 A;  5F5W A;  5KMG P;  1XNR T;  1OED E;  2JMK A;  1E1H B;  4HFD A;  4JI4 T;  3TLT A;  4UM1 A;  2R6G F;  2EHO C;  3M3Z B;  4PK6 A;  2FUP A;  1HNZ T;  4UM3 P;  3K3N A;  3UUM A;  1W0A A;  2X9Y A;  4PNI A;  1QUU A;  1IAP A;  3ONL C;  3ABV A;  3N2O A;  2MTQ A;  2CXF A;  4GK5 E;  4UEL A;  3KDS E;  2JQ9 A;  2NP9 A;  4OX9 T;  1UW6 A;  2LRK A;  3ANW B;  3EVY A;  3AE5 A;  3NRX A;  2LHN A;  4IE5 A;  1T8B A;  2J62 A;  5JDM A;  1M62 A;  1HF8 A;  3P50 A;  1UX4 A;  4H9O C;  4DV5 T;  2ZM8 A;  4HKA A;  3C64 A;  2CBJ A;  2BS4 A;  5LP6 E;  3VKG A;  4UV9 B;  3VU7 H;  5HEJ A;  1IZN B;  4I4T E;  2BDE A;  3PUZ F;  5JDH A;  2VB6 A;  2CBI A;  3D0T A;  4BFQ A;  3AXJ B;  4IL4 A;  4IDO A;  2VKJ A;  3UU3 A;  4QAC A;  4NZB A;  4UM3 S;  2RA1 A;  4C91 A;  4DV4 T;  3BQL A;  3AE1 A; 
#chains in the Genus database with same CATH homology
 4X5T A;  3WTI A;  3JAD A;  4NPP A;  4HFI A;  2WN9 A;  3EI0 A;  4ZRU A;  2W8F A;  2ZJV A;  4ZJT A;  4ZK4 A;  4TWH A;  3T4M A;  3WTM A;  4TNV A;  4XHE A;  3RQW A;  3WTK A;  5J5G A;  3U8J A;  4QH1 A;  2Y7Y A;  5AFL A;  2MAW A;  4QH4 A;  3TLV A;  2YMD A;  1OED E;  4WV9 A;  4F8H A;  2LKH A;  2BR7 A;  3WTN A;  5AFK A;  4HFD A;  4QH5 A;  4LMJ A;  4ZJS A;  3ZDG A;  1OED B;  3TLT A;  5L47 A;  4UM1 A;  3LSV A;  4FRR A;  4ZZB A;  2QC1 B;  2XNU A;  3TLW A;  4AFH A;  3RHW A;  4HFE A;  5AIN A;  3ZDH A;  2C9T A;  4UM3 A;  2XQ8 A;  4ZK1 A;  3RQU A;  3TLU A;  2BYS A;  1OED C;  5IUX A;  5J5F A;  4UM3 P;  2LM2 A;  2XQ7 A;  5FJV A;  3WTL A;  3SQ9 A;  5L4H A;  1UV6 A;  2BR8 A;  2BYN A;  4TNW A;  4DBM A;  3EHZ A;  4LMK A;  3U8L A;  3UU6 A;  3JAF A;  2YN6 A;  4LML A;  2XQ6 A;  3SQ6 A;  3GUA A;  4HFH A;  3ZKR A;  2WNC A;  5AFM A;  5HEG A;  2VL0 A;  3UUB A;  2W8G A;  3C79 A;  4EZ1 A;  4XK9 A;  2M6I A;  1OED A;  2XZ6 A;  3SH1 A;  5BP0 A;  3WTJ A;  3UU5 A;  4HFC A;  2XNV A;  3RIF A;  5HEO A;  2YME A;  2ZJU A;  4D01 A;  2BYQ A;  5JME A;  4COF A;  2WNJ A;  4Z91 A;  5KE4 A;  2BJ0 A;  5J5I A;  3UQ7 A;  1I9B A;  4ZR6 A;  4AFT A;  3U8N A;  4HQP A;  5BW2 A;  1UW6 A;  4IL9 A;  4QAA A;  5KZU A;  2WZY A;  5TVC A;  4ALX A;  3WIP A;  3WTO A;  4ZZC A;  2Y56 A;  2YOE A;  2XQ4 A;  5HEU A;  2XZ5 A;  3IGQ A;  5LXB A;  2XQ3 A;  3TLS A;  3P50 A;  2BG9 E;  4PIR A;  2XQ5 A;  2M6B A;  4QAB A;  2BG9 B;  2KSR A;  2Y58 A;  4B5D A;  5HCM A;  2XYT A;  3PMZ A;  5HEH A;  2LKG A;  5CFB A;  5HEJ A;  2BYR A;  3JAE A;  2X00 D;  3UU4 A;  2BG9 C;  2XQ9 A;  3PEO A;  4AFG A;  5AFN A;  4BQT A;  2BYP A;  3EAM A;  4HFB A;  5HCJ A;  4IRE A;  3UU8 A;  2PGZ A;  2UZ6 A;  5AFH A;  3SIO A;  4A97 A;  3UQ4 A;  4Z90 A;  3U8M A;  5J5H A;  4BFQ A;  2XNT A;  5AFM B;  4TWF A;  4IL4 A;  4ILC A;  1UX2 A;  4UY2 A;  5BRX A;  2BG9 A;  5LG3 A;  3RI5 A;  4ILB A;  3UU3 A;  2WNL A;  5J0Z A;  4TWD A;  2YKS A;  2PH9 A;  2X00 A;  3WTH A;  3P4W A;  4ILA A;  4A98 A;  5L4E A;  3C84 A;  4NZB A;  4QAC A;  5CO5 A;  2XYS A;  4UXU A;  5SYO A;  3U8K A;  4UM3 S;  2LLY A;  2Y57 A;  2XQA A;  3RIA A;  2Y54 A;  5AFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...