3EHZA

X-ray structure of the pentameric ligand gated ion channel of gloebacter violaceus (glic) in a presumptive open conformation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title Structure of a potentially open state of a proton-activated pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein
total genus 81
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3ehzA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3ehzA01
5L4HA 2WZYA 2YMEA 4XHEA 3RQUA 3UQ4A 4A98A 3C84A 5AFHA 5JMEA 5J5IA 2W8GA 4IREA 2LKHA 3P4WA 4QAAA 5AFLA 4WV9A 4TWDA 3SH1A 4IL4A 4UM3A 4FRRA 3RIFA 4XK9A 1OEDE 5AFKA 3WTJA 2WNCA 2Y54A 2BJ0A 2YMDA 3LSVA 3PMZA 5AFMA 4Z91A 3WTIA 5HCMA 2UZ6A 3U8NA 2XZ6A 4X5TA 3UU3A 4NZBA 4UXUA 5CFBA 5FJVA 4HFDA 4AFTA 3UQ7A 4UY2A 2LLYA 5HEGA 2QC1B 3EAMA 2BG9A 5CO5A 5SYOA 5J5FA 3JAEA 4ILCA 3U8LA 1OEDC 3WTLA 5BRXA 2YKSA 2ZJUA 4LMJA 4IL9A 1I9BA 2XQ9A 3TLWA 3PEOA 4TWFA 3SQ6A 4COFA 3ZDGA 3GUAA 1UX2A 2BYRA 3U8JA 5BW2A 1UV6A 4QH4A 2BYQA 2XYSA 4ZRUA 3WTHA 2MAWA 4NPPA 4F8HA 3UUBA 4PIRA 2KSRA 3RIAA 3UU5A 2PGZA 4ZJSA 3ZKRA 4DBMA 3WTMA 2Y57A 2M6BA 2WNJA 3SIOA 5LXBA 3TLUA 2XQ7A 3TLVA 5BP0A 5L47A 4ZK4A 2BG9C 4TWHA 2M6IA 4LMLA 5KZUA 2C9TA 2X00A 2W8FA 3C79A 5J5HA 4B5DA 4LMKA 4A97A 2XQ4A 4ZJTA 5HEJA 2Y58A 3WTNA 5HEHA 1OEDB 4UM3S 2BG9E 2LKGA 5AINA 3TLTA 5L4EA 3RQWA 2XZ5A 3UU4A 2XQ3A 2VL0A 5J5GA 4ALXA 4ILAA 5LG3A 3ZDHA 2LM2A 4D01A 2XQAA 2XNUA 4QH1A 4HFEA 2PH9A 3SQ9A 4EZ1A 5KE4A 5AFMB 4HQPA 5HCJA 2BYSA 4Z90A 3UU6A 4UM3P 2YN6A 4ZZBA 4ZR6A 2XYTA 3IGQA 3U8MA 2BYNA 2WNLA 4AFHA 2BR7A 3WIPA 4AFGA 2Y7YA 4HFBA 4QABA 1UW6A 1OEDA 2XQ6A 3JAFA 2BG9B 4HFCA 5AFJA 2WN9A 5J0ZA 4ILBA 4TNVA 5AFNA 3EHZA 2ZJVA 4BQTA 3UU8A 4HFHA 4ZZCA 3TLSA 2BYPA 5HEUA 4BFQA 2XQ8A 2XQ5A 3P50A 2XNTA 4QACA 4TNWA 3T4MA 5TVCA 4UM1A 2YOEA 3RHWA 2BR8A 3RI5A 3WTOA 3WTKA 2XNVA 3JADA 4QH5A 5IUXA 2Y56A 5HEOA 3U8KA 2X00D 3EI0A 4ZK1A 4HFIA
chains in the Genus database with same CATH superfamily
3PU8A 4DR1T 5LBMA 3CQXC 5AFLA 3SH1A 4UM3A 4JYAT 2CA5A 2Y54A 2V7LA 2YMDA 4X20E 1WR0A 5LGUB 3PMZA 5HCMA 4UF0B 1HX1B 5ABFA 2VURA 4ILCA 5HXCA 3V5SA 2BS3A 3P4SA 5KX5E 4TWFA 4COFA 2V26A 2OLTA 3FZLB 4UVBB 2JQQA 3CX8B 4B3TT 2X68A 2BKNA 3AECA 4IHJE 3CX6B 4JI1T 3HKBE 4IDQA 4DUYT 5EK3A 2ACZA 5AQNB 4DR5T 3E08A 4A97A 1IBKT 4EZ4A 5HEHA 3AVRA 2B1EA 4ZOLE 2Q9QD 3QB5A 4DV0T 2Q9QC 2Y6XA 4U31A 4HFEA 3HI2A 3DP7A 3H37A 4JLEA 2BS4A 2HPLA 4AFHA 4H63V 2MYSA 1UW6A 2YDRA 4GYSA 2BYPA 3WAKA 1V9DA 3CWZB 2UXBT 3T4MA 2YOEA 4GIWA 2X00D 4JEHB 2JRKA 4TN7B 4I55E 3C50A 4ILUA 4JI4T 1OEDE 2RA1A 3QNUA 1M7KA 2CMRA 3LSVA 1ZP0A 3WTIA 4X64T 4AFTA 4UXUA 4HFDA 4WW0A 2OV9A 3MJXA 3ANWA 2BG9A 3FXEB 2MBGA 2XJ7A 3P8CD 2X0LB 2CXFA 1MMDA 3AAEB 4DR3T 3U8JA 2CEAA 4AQFC 4K0KT 4DR4T 3RIAA 2YK0A 3X1DA 2DI4A 2WAUA 5J5HA 4LMKA 4UELA 2E5LT 1SUMB 2WDVA 2WS3A 5HEJA 2LEHA 4ASKA 2WY2A 5J2UE 1T72A 4H9PC 2C5JA 2W62A 5E0OA 5LCYA 3QK6A 4QH1A 2IHR1 5AQLB 4CI3B 4AQGA 2V8SV 2IDOB 3U78A 2VKOA 3ZCIA 3PUQA 4HFCA 3B13A 3Q5WA 3RRCA 4YTPA 3AAIA 4HTEA 3LDQB 1N36T 2LSGA 4DR7T 2NTXA 4DMVA 3VHLA 2JMKA 2DWGA 4CXYA 2D0TA 3LG7A 2WZYA 4QX8B 4PK4A 3LK2B 4MALA 4UVCB 5AQRB 2XAQB 4P09A 4X1YE 5AQHB 3HKEE 3OYXA 3AEBA 3ONLC 4U7IA 1D0XA 3QOFA 2ZLYA 1LRZA 2VVSA 4PK6A 3IA3A 4HWCA 1WLXA 4CN1A 4QH4A 1N32T 3P4QA 4LF8T 3PUYF 5CJ5A 3VR9A 3K3NA 4UR9A 5FYMA 3V5UA 4KBMB 4LF4T 4ZK4A 2QVAA 4U7YA 4DNDA 2J62A 4HE8A 2BVMA 1YKHB 5FL1A 2KZ7B 5DQVA 3P4PA 3AXJA 3UU4A 5LG3A 5CGMA 5JDQA 2FUPA 5LMUT 2FBWA 5AQQB 4WBNE 4YY3T 2XYTA 2JQ9A 1WYBA 4AFGA 4QABA 4M1PA 3HR0A 5J0ZA 3J9X1 2N9DA 1J5WA 4BFQA 4JI6T 1FEWA 3H3AA 4EB6E 4WNKA 4TZ4C 4HFIA 3PDYA 3LK3B 3UFEA 5J5IA 2H7OA 2FJBA 3RC3A 1YXRA 5HAXA 5AFKA 4PFPA 3EABA 2E9XD 3PUVF 3Q2MA 3ONJA 1I94T 3CPZA 2E9XC 1NWMX 4X1KE 2LLYA 2XQYA 4ZS3A 2YU2A 2XQ9A 3ZMUB 4DBQA 4DR2T 4CZZB 3GUAA 2RPAA 2X67A 4F6RC 4B3ST 3AXJB 1J1JA 3A8YC 3VKGA 3C51A 1LVFA 5L47A 3NRYA 5KXJA 4TWHA 2M6IA 4U2ZA 3JC6D 2YEVC 2ZM2A 3O1HA 2LRLA 2I0MA 2VKDA 2Y48B 3CVRA 5FY1A 1J5ET 3VRBA 3AE9A 5LXTE 2KLQA 5AQIB 2XTLA 4JEUB 5JR9B 2XQAA 4UXNB 4JI5T 5JDGA 3T1HT 3N9LA 1UGOA 4NXMT 2LSKA 3DTOA 4TNVA 4KUMB 1KFYA 2W2UA 5LA6E 5FKYA 1W09A 2PBIA 2N2NA 2X51A 3M65A 3L39A 5AQOB 3I0QA 2VQET 5HEOA 2LHNA 2V7JA 3RQUA 5LHHB 1KK7A 4LF9T 3ZT7A 3AE3A 4QX7B 1WR6A 1O3XA 5LOVE 4QXCB 5FJVA 4I0UA 4PNIA 4PW8A 3UU3A 1UK5A 2WMNA 5HEGA 2ACXA 5BRXA 2CXDA 2V7IA 4JI0T 4IDNA 4CN6A 2R6GF 4DUZT 2J4GA 2PTFA 4PJMA 3KINB 1UX2A 2H89A 4HFVA 2JMHA 4U33A 1U4QA 3WTMA 4ZEYA 3MXZA 4YSYA 3TLVA 4XBFB 2BG9C 4EYYR 1BR4A 2G0UA 3KVBA 4IGUA 2CLYC 5C8YE 3ETUA 4IE6A 2LKGA 4ILAA 5FVLA 1E1HB 4D01A 3W15B 4NUUA 3J7Yq 2DLRA 5L3DB 1W9RA 3OKQA 2WB5A 2QGSA 3K1SA 3FZHB 4I50E 1Y01A 2D5UA 4YLHA 3WTOA 4QXBB 2PFVA 2X0HA 2ZM8A 5BMVE 4PJLA 1HNXT 2YMEA 3IHRA 1BR2A 2W8GA 2VQFT 4IL4A 1T8BA 3LBXA 3RIUA 3U3IA 3C4WA 2CBIA 4DV7T 4WYVA 3PURA 3FBZA 4IDPA 2F4VT 4IL9A 3SOLA 3FXDB 4MFRA 2XAFB 2UXNB 1FJGT 4NPPA 4F8HA 1E2AA 3R84B 3PE0A 1VOMA 2WNJA 3TLUA 3ZCJA 2V5CA 4H9SE 4AIUA 2W8FA 2N1GA 4E7ZA 1NEKA 4ZJTA 3WTNA 2WU2A 2YU1A 5FXWA 3CMLA 1ZEEA 3FZFB 4YHJA 5J5GA 2W4XA 2LJLA 2QRXA 2IW5B 1KF6A 4LF6T 3N2KE 1UX4A 4E7SA 4EEBA 5L3GB 4IE7A 2BYNA 4JI8T 2HH7A 3WIPA 4YTNA 4H63H 4IT4A 1IJ6A 4KMCA 2LT3A 5L3EB 5HEUA 3C4XA 1XMQT 2K5BB 2WU5A 2BR8A 1MMGA 2WP9A 3LBXB 1KEYA 4DO0A 3HKDE 5JTGA 3WI3A 4H9NC 5IHYA 2UUCT 3RKGA 4P0BA 4QAAA 1SA0E 4BAYB 1JNRA 3GN5A 3AE8A 2WNCA 2V6YA 3NZPA 4UIGA 4A5XA 1IZNB 4DR6T 5FXZA 2BS2A 2XAHB 4LFBT 2UUAT 1N33T 4P0AA 4JV5T 3PEOA 2VVNA 2WSSV 2WDRA 1IJ5A 2C0SA 3NRXA 4DV3T 3I9WA 5ETWA 4ADZA 4X62T 3F31A 5LXBA 2I6HA 3KBUA 4HWHA 2JQKA 5M4YA 4B5DA 3QB5K 3UT5E 4QXHB 2LRKA 2BBHA 4TV9E 5AINA 1W0AA 2CHOA 1YQ4A 2K3WA 4NIQA 5FL0A 4EV6A 3ZDHA 1ZOYA 2XNUA 2CRBA 2W66A 2ZM6T 2BR7A 3UUNA 1OEDA 2XQ6A 3EUHA 2L8KA 3OTOT 2ES0A 3N9MA 4ZI2D 1ZHCA 3MZKB 4PFOA 2BZBA 4ZI2C 3GN5B 3OYZA 3AE4A 5LB7B 3AE6A 2V6YB 2Y56A 2WQYA 4UEMA 4ZK1A 4JI3T 1MIWA 3KV5A 3KDSE 4FJOA 4A98A 5JMEA 2I59A 1XWMA 4JBWF 2SPCA 1AJ3A 5HWYA 4GOUA 1D1BA 4QHOA 4EGWA 5CO5A 5AQFB 4K0UA 1UCUA 3CX7B 4GK5E 1I9BA 3WAJA 2IIUA 4GYRA 5CA1E 1X79A 3PUZF 3WTHA 2Z6EA 3UUBA 2MOZA 1HTJF 4CI1B 2EHOB 4P1NA 4CI2B 3HL6A 5LBQB 4ISSA 1GQEA 1WFDA 2XHEB 1OEDB 4FI5A 5L4EA 3RQWA 3OBVE 5DJQC 3AA0B 2CHNA 4AI6A 4Z8XA 3ABVA 4HQPA 5HCJA 4JI2T 1KNRA 2XY8B 2WNLA 1R8IA 3N5LA 3EHZA 3MK7C 4AKLA 2XQ5A 2X9HA 2CE7A 4IE5A 1HR0T 4YFSA 3HKCE 3SWHA 2FJDA 3PUGA 1U5PA 2YINA 1NENA 3PV0F 4BJNA 2LSJA 3GWHA 3RKOA 3F2EA 5JR9A 4L5GA 1XNQT 2Q9QA 1FIOA 5LGNB 3R6NA 2UZ6A 5JRCA 3U8NA 4YTMA 2NR4A 2IC9A 2KT9A 4UY2A 3I9YA 4I43B 5J5FA 3A5XA 5IYZE 1MMNA 4LMJA 2AXDS 3HA4A 2X9YA 2GK9A 3CKDA 3BK9A 3RIUC 1HCIA 2FJEA 2P9BA 4YXDA 3AAAB 4HKAA 2Y57A 2IC6A 3ZC0A 3PUSA 3RF1A 3RYFE 5KZUA 2X00A 4DV1T 1M62A 2WCAA 1D0YA 1XDPA 1G8XA 2M67A 2NW7A 2B76A 3CIRA 5LP6E 3EDUA 2V5DA 4V1Av 5CA0E 3VKHA 4EZHA 4ILBA 4OHFA 4B3RT 4BQTA 3UU8A 4ZZCA 3BQIA 5CB4E 5JH7E 4TNWA 3ZJ2A 3ZLIA 4AQFA 4HWDA 4MBQA 4O4LE 1HG5A 5GONE 3IEEA 4AKRB 3CQGB 3SS1A 4QH5A 2Q9QB 4LFCT 3EI0A 5KE4A 5JRCB 2XASB 5L4HA 2W0GA 3UQ4A 3ZYLA 4QKNA 4IREA 1XDOA 4EAHA 5EK4A 4WV9A 2V7KA 4UV8B 4FRRA 3WTJA 5FY7A 4IE0A 3O4XE 1I6ZA 2NW9A 3AA6B 3B5MA 4X5TA 3RYIE 3ZSSA 3P7IA 2WDQA 5AQTB 4YSZA 2X66A 2YKSA 2KWHA 4CXXA 2X0YA 1MNEA 3E0ZA 3UFGA 4JUYA 3P4RA 1WYCA 1CHUA 4AKGA 3SIOA 3UUMA 2XQ7A 2DWKA 5AQVB 4J2CA 2C9TA 1VCTA 2CWOA 5J2TE 2Y58A 2VKJA 2VL0A 3ZMSB 4EOZB 5ABHA 4LFAT 1OXZA 2E8IA 5JDNA 4EZ1A 3OJAA 5AFMB 2XM2A 4ZR6A 2LSYA 3U8MA 4IIJE 1YKEB 1IBMT 3ONXA 2NWBA 4YJ2E 4X66T 5AQSB 2ZJVA 5LJMA 4O4IE 2XAJB 5FNVE 2BKPA 2YDQA 1IBLT 3RHWA 2ZMAA 4ANJA 5L2LA 1US7B 4DV2T 3QUJA 2WMOA 4JI7T 4AKIA 2HHHT 1FMWA 1YW0A 4L9IA 5JDFA 4X65T 5LYJE 2LKHA 3P4WA 3NVOA 2J1DG 4TWDA 2XSBA 4I4TE 4U2YA 4NXNT 2RP4A 4OX9T 2LSIA 1LVKA 3N9OA 4UV9B 4NZBA 2BBJA 2WWUA 4PJNA 4U72A 5KMGP 4QWNB 3ZT5A 3SQ6A 1B7TA 3EVYA 1KNZA 2BYRA 2K24A 2BYQA 5AQMB 5LGTB 1BR1A 3UU5A 2M6BA 3N2GE 1D1AA 3K3QC 3MACA 3OPCA 3AE1A 1NAFA 4XZCA 4LMLA 4EIWA 4O4HE 1S94A 3TLTA 4OYKA 3O1IA 2XQ3A 1S35A 1ZV4X 4ZS2A 4WBOA 4H9RC 2E9XA 3SQ9A 3B57A 1HX8A 3IGQA 2Y7YA 5LNKA 4N78D 3AEGA 5AFNA 4YJ3E 1SE7A 2UXXB 5C2TA 1HF8A 3P50A 1HS7A 4DV5T 2ZM0A 2ODUA 3KFWX 3ZPOA 5JDHA 3Q5XA 4EXTA 3FZMB 2DNXA 2QYWA 5LHIB 5J1GA 5KDMC 4PK5A 4MHCA 3SFEA 3AEFA 4O8SA 3ZN1B 3AEAA 1KNPA 3RIFA 3FHNA 4BJMA 5ABEA 3AB3B 4AISA 2BJ0A 1JNZA 4OYJA 2K48A 2NTYA 3KBTA 5EZYE 3TKLB 2MTQA 3UQ7A 2FJAA 5IWAT 2QC1B 2ZJUA 5F8PA 1MIYA 5JR9C 3KV4A 4Q25A 2XYSA 4YSXA 3PUXF 2W00A 4XAXB 4DVDA 2A9UA 3MKDA 3ZKRA 4B6XA 1XNRT 5BP0A 1VCSA 2E9XB 3AA7B 5L3BB 4TX5A 1UUSA 1XZYA 3RX6A 5AFUL 1D1CA 2LHRA 2JQHA 3T1YT 4U74A 4O4JE 2LE8A 2BG9E 2UXCT 4ZHQE 4H9QC 3ZC1A 3ZMTB 3LJCA 3D0TA 2UXDT 5AQJB 2AE9A 3SFDA 3N2OA 4G2AA 4L0RA 4A56A 4ISTA 3AA1B 5AQGB 5FXVA 4B3MT 5ABFB 2WN9A 2VKHA 2WBLA 3FZKB 3UUXB 4U3CA 3TLSA 2L3LA 2XQ8A 3ETVA 4DBRA 5FVKA 5LG4A 1UX5A 2EHOA 2OA5A 4IE4A 3WTKA 5H6QB 2LM9A 1MIVA 5F3JA 5IUXA 5LJNA 3AE7A 5AQPB 1QUUA 5A1LA 2IUBA 3JCFA 2CPTA 3ZN0B 3F57A 2XPKA 4GKJT 4CN4A 3BQLA 1Z8UA 2XZ6A 2X9WA 2WWVA 4KX6A 5HWXA 2BVLA 3GMIA 5HXHA 3FBLA 1QSDA 5FXXA 2BDEA 4KI0F 5BW2A 2V1DB 3Q9DA 3C98B 3OVUA 3L8RA 5JDMA 2PGZA 3EDVA 5H6RB 3S4UA 2CCQA 3O1JA 5HXRA 3C79A 2V6XA 4TUYE 3RPUA 1YQ3A 4NUVA 3K3OA 3PUAA 2E5VA 2VK9A 4HGAA 1HG2A 2IAKA 2LOPA 2V7MA 2XZ5A 4ALXA 4ZI3D 3N9PA 3PU3A 1DU2A 4ZI3C 3UU6A 4ZZBA 2MPKA 4DV4T 4HFBA 2WZHA 3N9NA 3ANWB 2BG9B 2WZIA 3ZMVB 1WRDA 4PJJA 2CLYB 3NBXX 4LF5T 4KHPT 3ZEFB 3KVAA 3RI5A 3SRZA 2HPJA 2CWYA 1SHZC 3JADA 5TAOA 1T98A 5BR8T 4C90A 2XSAA 3I0OA 1CUNA 2XUEA 2KINB 5F5WA 1YD8G 2PG8A 2XZEA 3ZYKA 2CBJA 5EK2A 1MMAA 2E2AA 1W0BA 2KWIB 1HNWT 3ZJ1A 1Y64B 5CFBA 4MLKA 3JAEA 1XMOT 3WTLA 5JREA 3TLWA 1HFAA 4G63A 3VRAA 3QC9A 4ZRUA 3AEEA 2LOSA 5HXSA 4HWIB 4PIRA 1E7PA 3ZMZB 2BKOA 2KNDA 2CXLA 3ZT6A 3AE2A 2UUBT 1WCRA 5AQKB 4AXPA 2Y8DA 3RH3A 1N34T 4BA9A 2LM2A 3ZYMA 4HN9A 1H7CA 3C4ZA 4Z90A 2DCFA 4CQIA 4EYUA 1X9BA 3JAFA 4O2AE 5AFJA 2C5KT 3PTRB 2C5IT 1FMVA 2HN2A 4ZXLA 4IDOA 1MNDA 3ZSTA 3KV6A 4WZXA 5TVCA 3K8PC 2JIWA 3GA8A 5JDLA 2KMFA 4DMWA 1EZ3A 3U8KA 3IBPA 3LFMA 2DL1A 1LKXA 2QA7A 4HEAA 3RLFF 3C84A 5AFHA 3UTKA 2IMLA 4KP3C 4XK9A 2L9QA 1G73A 1OWAA 5AFMA 5JQGE 1IAPA 4O2BE 3U8LA 3DJBA 2H3RA 3JC6C 1ZKEA 2XM1A 1UV6A 2MAWA 3AEDA 2KSRA 2D0UA 3VR8A 4ZJSA 4CXWA 4DBMA 2W61A 1QLBA 5FY0A 2XQ4A 4UM3S 4ERRA 2H7VC 4DV6T 4GKKT 3L09A 2NP9A 3Q5DA 4KHZF 5LHGB 3PUWF 4GK0E 4UM3P 2YN6A 3Q5EA 3RYCE 4LF7T 3AVSA 3MA9A 2KXPB 1T7SA 2JJ9A 4UVAB 2K9AA 4HFHA 3RYHE 5FP3A 2XNTA 2WM9A 4OFZA 4UM1A 4DIDB 2CM0A 2XNVA 1UURA 3C64A 5JVDE 3FB2A 4IDZA 4XHEA 2A3DA 3G06A 3RC8A 5HYAA 2A2FX 1VRBA 2EHOD 1HNZT 2EHOC 2VWAA 3RGLA 2A72A 4Z91A 2ODVA 3O9XA 2JPFA 4OK0A 4EEDA 4AQYT 5SYOA 3EAMA 3E22E 3CQCB 3NKZA 1L0VA 2PJQA 1OEDC 4C91A 3VU7H 5AQUB 2W63A 2VASA 3ZDGA 4X1IE 5ABGA 5FMNA 2J47A 4ZI7E 3NZQA 4UF0A 1Z0PA 2X9XA 3PJAA 4PAGA 2NW8A 5L3CB 2W67A 2HN1A 5DQWA 3RRWA 3BQKA 3A7MA 4HWFA 3L3PA 2XAGB 2H88A 2NOXA 2VB6A 5LMNT 4YHHT 2D9DA 3LK42 3M3ZB 3I1AA 3H3MA 3IF8B 4H9OC 5DABA 2PH9A 2VL8A 2BYSA 2UU9T 5L3FB 2YDSA 3KV9A 2DHRA 2D2SA 3ESLA 3AE5A 1BR0A 1D0ZA 3UULA 3PJAJ 5C3JA 4QACA 3N9QA 5ADXL 4AKHA 3T8OA 5HXEA 3NWIA 3CK6A 4YT0A 4TV8E
chains in the Genus database with same CATH topology
5L4HA 2WZYA 2YMEA 4XHEA 3RQUA 3UQ4A 4A98A 3C84A 5AFHA 5JMEA 5J5IA 2W8GA 4IREA 2LKHA 3P4WA 4QAAA 5AFLA 4WV9A 4TWDA 3SH1A 4IL4A 4UM3A 4FRRA 3RIFA 4XK9A 1OEDE 5AFKA 3WTJA 2WNCA 2Y54A 2BJ0A 2YMDA 3LSVA 3PMZA 5AFMA 4Z91A 3WTIA 5HCMA 2UZ6A 3U8NA 2XZ6A 4X5TA 3UU3A 4NZBA 4UXUA 5CFBA 5FJVA 4HFDA 4AFTA 3UQ7A 4UY2A 2LLYA 5HEGA 2QC1B 3EAMA 2BG9A 5CO5A 5SYOA 5J5FA 3JAEA 4ILCA 3U8LA 1OEDC 3WTLA 5BRXA 2YKSA 2ZJUA 4LMJA 4IL9A 1I9BA 2XQ9A 3TLWA 3PEOA 4TWFA 3SQ6A 4COFA 3ZDGA 3GUAA 1UX2A 2BYRA 3U8JA 5BW2A 1UV6A 4QH4A 2BYQA 2XYSA 4ZRUA 3WTHA 2MAWA 4NPPA 4F8HA 3UUBA 4PIRA 2KSRA 3RIAA 3UU5A 2PGZA 4ZJSA 3ZKRA 4DBMA 3WTMA 2Y57A 2M6BA 2WNJA 3SIOA 5LXBA 3TLUA 2XQ7A 3TLVA 5BP0A 5L47A 4ZK4A 2BG9C 4TWHA 2M6IA 4LMLA 5KZUA 2C9TA 2X00A 2W8FA 3C79A 5J5HA 4B5DA 4LMKA 4A97A 2XQ4A 4ZJTA 5HEJA 2Y58A 3WTNA 5HEHA 1OEDB 4UM3S 2BG9E 2LKGA 5AINA 3TLTA 5L4EA 3RQWA 2XZ5A 3UU4A 2XQ3A 2VL0A 5J5GA 4ALXA 4ILAA 5LG3A 3ZDHA 2LM2A 4D01A 2XQAA 2XNUA 4QH1A 4HFEA 2PH9A 3SQ9A 4EZ1A 5KE4A 5AFMB 4HQPA 5HCJA 2BYSA 4Z90A 3UU6A 4UM3P 2YN6A 4ZZBA 4ZR6A 2XYTA 3IGQA 3U8MA 2BYNA 2WNLA 4AFHA 2BR7A 3WIPA 4AFGA 2Y7YA 4HFBA 4QABA 1UW6A 1OEDA 2XQ6A 3JAFA 2BG9B 4HFCA 5AFJA 2WN9A 5J0ZA 4ILBA 4TNVA 5AFNA 3EHZA 2ZJVA 4BQTA 3UU8A 4HFHA 4ZZCA 3TLSA 2BYPA 5HEUA 4BFQA 2XQ8A 2XQ5A 3P50A 2XNTA 4QACA 4TNWA 3T4MA 5TVCA 4UM1A 2YOEA 3RHWA 2BR8A 3RI5A 3WTOA 3WTKA 2XNVA 3JADA 4QH5A 5IUXA 2Y56A 5HEOA 3U8KA 2X00D 3EI0A 4ZK1A 4HFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L4H A;  2WZY A;  2YME A;  4XHE A;  3RQU A;  3UQ4 A;  4A98 A;  3C84 A;  5AFH A;  5JME A;  5J5I A;  2W8G A;  4IRE A;  2LKH A;  3P4W A;  4QAA A;  5AFL A;  4WV9 A;  4TWD A;  3SH1 A;  4IL4 A;  4UM3 A;  4FRR A;  3RIF A;  4XK9 A;  1OED E;  5AFK A;  3WTJ A;  2WNC A;  2Y54 A;  2BJ0 A;  2YMD A;  3LSV A;  3PMZ A;  5AFM A;  4Z91 A;  3WTI A;  5HCM A;  2UZ6 A;  3U8N A;  2XZ6 A;  4X5T A;  3UU3 A;  4NZB A;  4UXU A;  5CFB A;  5FJV A;  4HFD A;  4AFT A;  3UQ7 A;  4UY2 A;  2LLY A;  5HEG A;  2QC1 B;  3EAM A;  2BG9 A;  5CO5 A;  5SYO A;  5J5F A;  3JAE A;  4ILC A;  3U8L A;  1OED C;  3WTL A;  5BRX A;  2YKS A;  2ZJU A;  4LMJ A;  4IL9 A;  1I9B A;  2XQ9 A;  3TLW A;  3PEO A;  4TWF A;  3SQ6 A;  4COF A;  3ZDG A;  3GUA A;  1UX2 A;  2BYR A;  3U8J A;  5BW2 A;  1UV6 A;  4QH4 A;  2BYQ A;  2XYS A;  4ZRU A;  3WTH A;  2MAW A;  4NPP A;  4F8H A;  3UUB A;  4PIR A;  2KSR A;  3RIA A;  3UU5 A;  2PGZ A;  4ZJS A;  3ZKR A;  4DBM A;  3WTM A;  2Y57 A;  2M6B A;  2WNJ A;  3SIO A;  5LXB A;  3TLU A;  2XQ7 A;  3TLV A;  5BP0 A;  5L47 A;  4ZK4 A;  2BG9 C;  4TWH A;  2M6I A;  4LML A;  5KZU A;  2C9T A;  2X00 A;  2W8F A;  3C79 A;  5J5H A;  4B5D A;  4LMK A;  4A97 A;  2XQ4 A;  4ZJT A;  5HEJ A;  2Y58 A;  3WTN A;  5HEH A;  1OED B;  4UM3 S;  2BG9 E;  2LKG A;  5AIN A;  3TLT A;  5L4E A;  3RQW A;  2XZ5 A;  3UU4 A;  2XQ3 A;  2VL0 A;  5J5G A;  4ALX A;  4ILA A;  5LG3 A;  3ZDH A;  2LM2 A;  4D01 A;  2XQA A;  2XNU A;  4QH1 A;  4HFE A;  2PH9 A;  3SQ9 A;  4EZ1 A;  5KE4 A;  5AFM B;  4HQP A;  5HCJ A;  2BYS A;  4Z90 A;  3UU6 A;  4UM3 P;  2YN6 A;  4ZZB A;  4ZR6 A;  2XYT A;  3IGQ A;  3U8M A;  2BYN A;  2WNL A;  4AFH A;  2BR7 A;  3WIP A;  4AFG A;  2Y7Y A;  4HFB A;  4QAB A;  1UW6 A;  1OED A;  2XQ6 A;  3JAF A;  2BG9 B;  4HFC A;  5AFJ A;  2WN9 A;  5J0Z A;  4ILB A;  4TNV A;  5AFN A;  3EHZ A;  2ZJV A;  4BQT A;  3UU8 A;  4HFH A;  4ZZC A;  3TLS A;  2BYP A;  5HEU A;  4BFQ A;  2XQ8 A;  2XQ5 A;  3P50 A;  2XNT A;  4QAC A;  4TNW A;  3T4M A;  5TVC A;  4UM1 A;  2YOE A;  3RHW A;  2BR8 A;  3RI5 A;  3WTO A;  3WTK A;  2XNV A;  3JAD A;  4QH5 A;  5IUX A;  2Y56 A;  5HEO A;  3U8K A;  2X00 D;  3EI0 A;  4ZK1 A;  4HFI A; 
#chains in the Genus database with same CATH topology
 3PU8 A;  4DR1 T;  5LBM A;  3CQX C;  5AFL A;  3SH1 A;  4UM3 A;  4JYA T;  2CA5 A;  2Y54 A;  2V7L A;  2YMD A;  4X20 E;  1WR0 A;  5LGU B;  3PMZ A;  5HCM A;  4UF0 B;  1HX1 B;  5ABF A;  2VUR A;  4ILC A;  5HXC A;  3V5S A;  2BS3 A;  3P4S A;  5KX5 E;  4TWF A;  4COF A;  2V26 A;  2OLT A;  3FZL B;  4UVB B;  2JQQ A;  3CX8 B;  4B3T T;  2X68 A;  2BKN A;  3AEC A;  4IHJ E;  3CX6 B;  4JI1 T;  3HKB E;  4IDQ A;  4DUY T;  5EK3 A;  2ACZ A;  5AQN B;  4DR5 T;  3E08 A;  4A97 A;  1IBK T;  4EZ4 A;  5HEH A;  3AVR A;  2B1E A;  4ZOL E;  2Q9Q D;  3QB5 A;  4DV0 T;  2Q9Q C;  2Y6X A;  4U31 A;  4HFE A;  3HI2 A;  3DP7 A;  3H37 A;  4JLE A;  2BS4 A;  2HPL A;  4AFH A;  4H63 V;  2MYS A;  1UW6 A;  2YDR A;  4GYS A;  2BYP A;  3WAK A;  1V9D A;  3CWZ B;  2UXB T;  3T4M A;  2YOE A;  4GIW A;  2X00 D;  4JEH B;  2JRK A;  4TN7 B;  4I55 E;  3C50 A;  4ILU A;  4JI4 T;  1OED E;  2RA1 A;  3QNU A;  1M7K A;  2CMR A;  3LSV A;  1ZP0 A;  3WTI A;  4X64 T;  4AFT A;  4UXU A;  4HFD A;  4WW0 A;  2OV9 A;  3MJX A;  3ANW A;  2BG9 A;  3FXE B;  2MBG A;  2XJ7 A;  3P8C D;  2X0L B;  2CXF A;  1MMD A;  3AAE B;  4DR3 T;  3U8J A;  2CEA A;  4AQF C;  4K0K T;  4DR4 T;  3RIA A;  2YK0 A;  3X1D A;  2DI4 A;  2WAU A;  5J5H A;  4LMK A;  4UEL A;  2E5L T;  1SUM B;  2WDV A;  2WS3 A;  5HEJ A;  2LEH A;  4ASK A;  2WY2 A;  5J2U E;  1T72 A;  4H9P C;  2C5J A;  2W62 A;  5E0O A;  5LCY A;  3QK6 A;  4QH1 A;  2IHR 1;  5AQL B;  4CI3 B;  4AQG A;  2V8S V;  2IDO B;  3U78 A;  2VKO A;  3ZCI A;  3PUQ A;  4HFC A;  3B13 A;  3Q5W A;  3RRC A;  4YTP A;  3AAI A;  4HTE A;  3LDQ B;  1N36 T;  2LSG A;  4DR7 T;  2NTX A;  4DMV A;  3VHL A;  2JMK A;  2DWG A;  4CXY A;  2D0T A;  3LG7 A;  2WZY A;  4QX8 B;  4PK4 A;  3LK2 B;  4MAL A;  4UVC B;  5AQR B;  2XAQ B;  4P09 A;  4X1Y E;  5AQH B;  3HKE E;  3OYX A;  3AEB A;  3ONL C;  4U7I A;  1D0X A;  3QOF A;  2ZLY A;  1LRZ A;  2VVS A;  4PK6 A;  3IA3 A;  4HWC A;  1WLX A;  4CN1 A;  4QH4 A;  1N32 T;  3P4Q A;  4LF8 T;  3PUY F;  5CJ5 A;  3VR9 A;  3K3N A;  4UR9 A;  5FYM A;  3V5U A;  4KBM B;  4LF4 T;  4ZK4 A;  2QVA A;  4U7Y A;  4DND A;  2J62 A;  4HE8 A;  2BVM A;  1YKH B;  5FL1 A;  2KZ7 B;  5DQV A;  3P4P A;  3AXJ A;  3UU4 A;  5LG3 A;  5CGM A;  5JDQ A;  2FUP A;  5LMU T;  2FBW A;  5AQQ B;  4WBN E;  4YY3 T;  2XYT A;  2JQ9 A;  1WYB A;  4AFG A;  4QAB A;  4M1P A;  3HR0 A;  5J0Z A;  3J9X 1;  2N9D A;  1J5W A;  4BFQ A;  4JI6 T;  1FEW A;  3H3A A;  4EB6 E;  4WNK A;  4TZ4 C;  4HFI A;  3PDY A;  3LK3 B;  3UFE A;  5J5I A;  2H7O A;  2FJB A;  3RC3 A;  1YXR A;  5HAX A;  5AFK A;  4PFP A;  3EAB A;  2E9X D;  3PUV F;  3Q2M A;  3ONJ A;  1I94 T;  3CPZ A;  2E9X C;  1NWM X;  4X1K E;  2LLY A;  2XQY A;  4ZS3 A;  2YU2 A;  2XQ9 A;  3ZMU B;  4DBQ A;  4DR2 T;  4CZZ B;  3GUA A;  2RPA A;  2X67 A;  4F6R C;  4B3S T;  3AXJ B;  1J1J A;  3A8Y C;  3VKG A;  3C51 A;  1LVF A;  5L47 A;  3NRY A;  5KXJ A;  4TWH A;  2M6I A;  4U2Z A;  3JC6 D;  2YEV C;  2ZM2 A;  3O1H A;  2LRL A;  2I0M A;  2VKD A;  2Y48 B;  3CVR A;  5FY1 A;  1J5E T;  3VRB A;  3AE9 A;  5LXT E;  2KLQ A;  5AQI B;  2XTL A;  4JEU B;  5JR9 B;  2XQA A;  4UXN B;  4JI5 T;  5JDG A;  3T1H T;  3N9L A;  1UGO A;  4NXM T;  2LSK A;  3DTO A;  4TNV A;  4KUM B;  1KFY A;  2W2U A;  5LA6 E;  5FKY A;  1W09 A;  2PBI A;  2N2N A;  2X51 A;  3M65 A;  3L39 A;  5AQO B;  3I0Q A;  2VQE T;  5HEO A;  2LHN A;  2V7J A;  3RQU A;  5LHH B;  1KK7 A;  4LF9 T;  3ZT7 A;  3AE3 A;  4QX7 B;  1WR6 A;  1O3X A;  5LOV E;  4QXC B;  5FJV A;  4I0U A;  4PNI A;  4PW8 A;  3UU3 A;  1UK5 A;  2WMN A;  5HEG A;  2ACX A;  5BRX A;  2CXD A;  2V7I A;  4JI0 T;  4IDN A;  4CN6 A;  2R6G F;  4DUZ T;  2J4G A;  2PTF A;  4PJM A;  3KIN B;  1UX2 A;  2H89 A;  4HFV A;  2JMH A;  4U33 A;  1U4Q A;  3WTM A;  4ZEY A;  3MXZ A;  4YSY A;  3TLV A;  4XBF B;  2BG9 C;  4EYY R;  1BR4 A;  2G0U A;  3KVB A;  4IGU A;  2CLY C;  5C8Y E;  3ETU A;  4IE6 A;  2LKG A;  4ILA A;  5FVL A;  1E1H B;  4D01 A;  3W15 B;  4NUU A;  3J7Y q;  2DLR A;  5L3D B;  1W9R A;  3OKQ A;  2WB5 A;  2QGS A;  3K1S A;  3FZH B;  4I50 E;  1Y01 A;  2D5U A;  4YLH A;  3WTO A;  4QXB B;  2PFV A;  2X0H A;  2ZM8 A;  5BMV E;  4PJL A;  1HNX T;  2YME A;  3IHR A;  1BR2 A;  2W8G A;  2VQF T;  4IL4 A;  1T8B A;  3LBX A;  3RIU A;  3U3I A;  3C4W A;  2CBI A;  4DV7 T;  4WYV A;  3PUR A;  3FBZ A;  4IDP A;  2F4V T;  4IL9 A;  3SOL A;  3FXD B;  4MFR A;  2XAF B;  2UXN B;  1FJG T;  4NPP A;  4F8H A;  1E2A A;  3R84 B;  3PE0 A;  1VOM A;  2WNJ A;  3TLU A;  3ZCJ A;  2V5C A;  4H9S E;  4AIU A;  2W8F A;  2N1G A;  4E7Z A;  1NEK A;  4ZJT A;  3WTN A;  2WU2 A;  2YU1 A;  5FXW A;  3CML A;  1ZEE A;  3FZF B;  4YHJ A;  5J5G A;  2W4X A;  2LJL A;  2QRX A;  2IW5 B;  1KF6 A;  4LF6 T;  3N2K E;  1UX4 A;  4E7S A;  4EEB A;  5L3G B;  4IE7 A;  2BYN A;  4JI8 T;  2HH7 A;  3WIP A;  4YTN A;  4H63 H;  4IT4 A;  1IJ6 A;  4KMC A;  2LT3 A;  5L3E B;  5HEU A;  3C4X A;  1XMQ T;  2K5B B;  2WU5 A;  2BR8 A;  1MMG A;  2WP9 A;  3LBX B;  1KEY A;  4DO0 A;  3HKD E;  5JTG A;  3WI3 A;  4H9N C;  5IHY A;  2UUC T;  3RKG A;  4P0B A;  4QAA A;  1SA0 E;  4BAY B;  1JNR A;  3GN5 A;  3AE8 A;  2WNC A;  2V6Y A;  3NZP A;  4UIG A;  4A5X A;  1IZN B;  4DR6 T;  5FXZ A;  2BS2 A;  2XAH B;  4LFB T;  2UUA T;  1N33 T;  4P0A A;  4JV5 T;  3PEO A;  2VVN A;  2WSS V;  2WDR A;  1IJ5 A;  2C0S A;  3NRX A;  4DV3 T;  3I9W A;  5ETW A;  4ADZ A;  4X62 T;  3F31 A;  5LXB A;  2I6H A;  3KBU A;  4HWH A;  2JQK A;  5M4Y A;  4B5D A;  3QB5 K;  3UT5 E;  4QXH B;  2LRK A;  2BBH A;  4TV9 E;  5AIN A;  1W0A A;  2CHO A;  1YQ4 A;  2K3W A;  4NIQ A;  5FL0 A;  4EV6 A;  3ZDH A;  1ZOY A;  2XNU A;  2CRB A;  2W66 A;  2ZM6 T;  2BR7 A;  3UUN A;  1OED A;  2XQ6 A;  3EUH A;  2L8K A;  3OTO T;  2ES0 A;  3N9M A;  4ZI2 D;  1ZHC A;  3MZK B;  4PFO A;  2BZB A;  4ZI2 C;  3GN5 B;  3OYZ A;  3AE4 A;  5LB7 B;  3AE6 A;  2V6Y B;  2Y56 A;  2WQY A;  4UEM A;  4ZK1 A;  4JI3 T;  1MIW A;  3KV5 A;  3KDS E;  4FJO A;  4A98 A;  5JME A;  2I59 A;  1XWM A;  4JBW F;  2SPC A;  1AJ3 A;  5HWY A;  4GOU A;  1D1B A;  4QHO A;  4EGW A;  5CO5 A;  5AQF B;  4K0U A;  1UCU A;  3CX7 B;  4GK5 E;  1I9B A;  3WAJ A;  2IIU A;  4GYR A;  5CA1 E;  1X79 A;  3PUZ F;  3WTH A;  2Z6E A;  3UUB A;  2MOZ A;  1HTJ F;  4CI1 B;  2EHO B;  4P1N A;  4CI2 B;  3HL6 A;  5LBQ B;  4ISS A;  1GQE A;  1WFD A;  2XHE B;  1OED B;  4FI5 A;  5L4E A;  3RQW A;  3OBV E;  5DJQ C;  3AA0 B;  2CHN A;  4AI6 A;  4Z8X A;  3ABV A;  4HQP A;  5HCJ A;  4JI2 T;  1KNR A;  2XY8 B;  2WNL A;  1R8I A;  3N5L A;  3EHZ A;  3MK7 C;  4AKL A;  2XQ5 A;  2X9H A;  2CE7 A;  4IE5 A;  1HR0 T;  4YFS A;  3HKC E;  3SWH A;  2FJD A;  3PUG A;  1U5P A;  2YIN A;  1NEN A;  3PV0 F;  4BJN A;  2LSJ A;  3GWH A;  3RKO A;  3F2E A;  5JR9 A;  4L5G A;  1XNQ T;  2Q9Q A;  1FIO A;  5LGN B;  3R6N A;  2UZ6 A;  5JRC A;  3U8N A;  4YTM A;  2NR4 A;  2IC9 A;  2KT9 A;  4UY2 A;  3I9Y A;  4I43 B;  5J5F A;  3A5X A;  5IYZ E;  1MMN A;  4LMJ A;  2AXD S;  3HA4 A;  2X9Y A;  2GK9 A;  3CKD A;  3BK9 A;  3RIU C;  1HCI A;  2FJE A;  2P9B A;  4YXD A;  3AAA B;  4HKA A;  2Y57 A;  2IC6 A;  3ZC0 A;  3PUS A;  3RF1 A;  3RYF E;  5KZU A;  2X00 A;  4DV1 T;  1M62 A;  2WCA A;  1D0Y A;  1XDP A;  1G8X A;  2M67 A;  2NW7 A;  2B76 A;  3CIR A;  5LP6 E;  3EDU A;  2V5D A;  4V1A v;  5CA0 E;  3VKH A;  4EZH A;  4ILB A;  4OHF A;  4B3R T;  4BQT A;  3UU8 A;  4ZZC A;  3BQI A;  5CB4 E;  5JH7 E;  4TNW A;  3ZJ2 A;  3ZLI A;  4AQF A;  4HWD A;  4MBQ A;  4O4L E;  1HG5 A;  5GON E;  3IEE A;  4AKR B;  3CQG B;  3SS1 A;  4QH5 A;  2Q9Q B;  4LFC T;  3EI0 A;  5KE4 A;  5JRC B;  2XAS B;  5L4H A;  2W0G A;  3UQ4 A;  3ZYL A;  4QKN A;  4IRE A;  1XDO A;  4EAH A;  5EK4 A;  4WV9 A;  2V7K A;  4UV8 B;  4FRR A;  3WTJ A;  5FY7 A;  4IE0 A;  3O4X E;  1I6Z A;  2NW9 A;  3AA6 B;  3B5M A;  4X5T A;  3RYI E;  3ZSS A;  3P7I A;  2WDQ A;  5AQT B;  4YSZ A;  2X66 A;  2YKS A;  2KWH A;  4CXX A;  2X0Y A;  1MNE A;  3E0Z A;  3UFG A;  4JUY A;  3P4R A;  1WYC A;  1CHU A;  4AKG A;  3SIO A;  3UUM A;  2XQ7 A;  2DWK A;  5AQV B;  4J2C A;  2C9T A;  1VCT A;  2CWO A;  5J2T E;  2Y58 A;  2VKJ A;  2VL0 A;  3ZMS B;  4EOZ B;  5ABH A;  4LFA T;  1OXZ A;  2E8I A;  5JDN A;  4EZ1 A;  3OJA A;  5AFM B;  2XM2 A;  4ZR6 A;  2LSY A;  3U8M A;  4IIJ E;  1YKE B;  1IBM T;  3ONX A;  2NWB A;  4YJ2 E;  4X66 T;  5AQS B;  2ZJV A;  5LJM A;  4O4I E;  2XAJ B;  5FNV E;  2BKP A;  2YDQ A;  1IBL T;  3RHW A;  2ZMA A;  4ANJ A;  5L2L A;  1US7 B;  4DV2 T;  3QUJ A;  2WMO A;  4JI7 T;  4AKI A;  2HHH T;  1FMW A;  1YW0 A;  4L9I A;  5JDF A;  4X65 T;  5LYJ E;  2LKH A;  3P4W A;  3NVO A;  2J1D G;  4TWD A;  2XSB A;  4I4T E;  4U2Y A;  4NXN T;  2RP4 A;  4OX9 T;  2LSI A;  1LVK A;  3N9O A;  4UV9 B;  4NZB A;  2BBJ A;  2WWU A;  4PJN A;  4U72 A;  5KMG P;  4QWN B;  3ZT5 A;  3SQ6 A;  1B7T A;  3EVY A;  1KNZ A;  2BYR A;  2K24 A;  2BYQ A;  5AQM B;  5LGT B;  1BR1 A;  3UU5 A;  2M6B A;  3N2G E;  1D1A A;  3K3Q C;  3MAC A;  3OPC A;  3AE1 A;  1NAF A;  4XZC A;  4LML A;  4EIW A;  4O4H E;  1S94 A;  3TLT A;  4OYK A;  3O1I A;  2XQ3 A;  1S35 A;  1ZV4 X;  4ZS2 A;  4WBO A;  4H9R C;  2E9X A;  3SQ9 A;  3B57 A;  1HX8 A;  3IGQ A;  2Y7Y A;  5LNK A;  4N78 D;  3AEG A;  5AFN A;  4YJ3 E;  1SE7 A;  2UXX B;  5C2T A;  1HF8 A;  3P50 A;  1HS7 A;  4DV5 T;  2ZM0 A;  2ODU A;  3KFW X;  3ZPO A;  5JDH A;  3Q5X A;  4EXT A;  3FZM B;  2DNX A;  2QYW A;  5LHI B;  5J1G A;  5KDM C;  4PK5 A;  4MHC A;  3SFE A;  3AEF A;  4O8S A;  3ZN1 B;  3AEA A;  1KNP A;  3RIF A;  3FHN A;  4BJM A;  5ABE A;  3AB3 B;  4AIS A;  2BJ0 A;  1JNZ A;  4OYJ A;  2K48 A;  2NTY A;  3KBT A;  5EZY E;  3TKL B;  2MTQ A;  3UQ7 A;  2FJA A;  5IWA T;  2QC1 B;  2ZJU A;  5F8P A;  1MIY A;  5JR9 C;  3KV4 A;  4Q25 A;  2XYS A;  4YSX A;  3PUX F;  2W00 A;  4XAX B;  4DVD A;  2A9U A;  3MKD A;  3ZKR A;  4B6X A;  1XNR T;  5BP0 A;  1VCS A;  2E9X B;  3AA7 B;  5L3B B;  4TX5 A;  1UUS A;  1XZY A;  3RX6 A;  5AFU L;  1D1C A;  2LHR A;  2JQH A;  3T1Y T;  4U74 A;  4O4J E;  2LE8 A;  2BG9 E;  2UXC T;  4ZHQ E;  4H9Q C;  3ZC1 A;  3ZMT B;  3LJC A;  3D0T A;  2UXD T;  5AQJ B;  2AE9 A;  3SFD A;  3N2O A;  4G2A A;  4L0R A;  4A56 A;  4IST A;  3AA1 B;  5AQG B;  5FXV A;  4B3M T;  5ABF B;  2WN9 A;  2VKH A;  2WBL A;  3FZK B;  3UUX B;  4U3C A;  3TLS A;  2L3L A;  2XQ8 A;  3ETV A;  4DBR A;  5FVK A;  5LG4 A;  1UX5 A;  2EHO A;  2OA5 A;  4IE4 A;  3WTK A;  5H6Q B;  2LM9 A;  1MIV A;  5F3J A;  5IUX A;  5LJN A;  3AE7 A;  5AQP B;  1QUU A;  5A1L A;  2IUB A;  3JCF A;  2CPT A;  3ZN0 B;  3F57 A;  2XPK A;  4GKJ T;  4CN4 A;  3BQL A;  1Z8U A;  2XZ6 A;  2X9W A;  2WWV A;  4KX6 A;  5HWX A;  2BVL A;  3GMI A;  5HXH A;  3FBL A;  1QSD A;  5FXX A;  2BDE A;  4KI0 F;  5BW2 A;  2V1D B;  3Q9D A;  3C98 B;  3OVU A;  3L8R A;  5JDM A;  2PGZ A;  3EDV A;  5H6R B;  3S4U A;  2CCQ A;  3O1J A;  5HXR A;  3C79 A;  2V6X A;  4TUY E;  3RPU A;  1YQ3 A;  4NUV A;  3K3O A;  3PUA A;  2E5V A;  2VK9 A;  4HGA A;  1HG2 A;  2IAK A;  2LOP A;  2V7M A;  2XZ5 A;  4ALX A;  4ZI3 D;  3N9P A;  3PU3 A;  1DU2 A;  4ZI3 C;  3UU6 A;  4ZZB A;  2MPK A;  4DV4 T;  4HFB A;  2WZH A;  3N9N A;  3ANW B;  2BG9 B;  2WZI A;  3ZMV B;  1WRD A;  4PJJ A;  2CLY B;  3NBX X;  4LF5 T;  4KHP T;  3ZEF B;  3KVA A;  3RI5 A;  3SRZ A;  2HPJ A;  2CWY A;  1SHZ C;  3JAD A;  5TAO A;  1T98 A;  5BR8 T;  4C90 A;  2XSA A;  3I0O A;  1CUN A;  2XUE A;  2KIN B;  5F5W A;  1YD8 G;  2PG8 A;  2XZE A;  3ZYK A;  2CBJ A;  5EK2 A;  1MMA A;  2E2A A;  1W0B A;  2KWI B;  1HNW T;  3ZJ1 A;  1Y64 B;  5CFB A;  4MLK A;  3JAE A;  1XMO T;  3WTL A;  5JRE A;  3TLW A;  1HFA A;  4G63 A;  3VRA A;  3QC9 A;  4ZRU A;  3AEE A;  2LOS A;  5HXS A;  4HWI B;  4PIR A;  1E7P A;  3ZMZ B;  2BKO A;  2KND A;  2CXL A;  3ZT6 A;  3AE2 A;  2UUB T;  1WCR A;  5AQK B;  4AXP A;  2Y8D A;  3RH3 A;  1N34 T;  4BA9 A;  2LM2 A;  3ZYM A;  4HN9 A;  1H7C A;  3C4Z A;  4Z90 A;  2DCF A;  4CQI A;  4EYU A;  1X9B A;  3JAF A;  4O2A E;  5AFJ A;  2C5K T;  3PTR B;  2C5I T;  1FMV A;  2HN2 A;  4ZXL A;  4IDO A;  1MND A;  3ZST A;  3KV6 A;  4WZX A;  5TVC A;  3K8P C;  2JIW A;  3GA8 A;  5JDL A;  2KMF A;  4DMW A;  1EZ3 A;  3U8K A;  3IBP A;  3LFM A;  2DL1 A;  1LKX A;  2QA7 A;  4HEA A;  3RLF F;  3C84 A;  5AFH A;  3UTK A;  2IML A;  4KP3 C;  4XK9 A;  2L9Q A;  1G73 A;  1OWA A;  5AFM A;  5JQG E;  1IAP A;  4O2B E;  3U8L A;  3DJB A;  2H3R A;  3JC6 C;  1ZKE A;  2XM1 A;  1UV6 A;  2MAW A;  3AED A;  2KSR A;  2D0U A;  3VR8 A;  4ZJS A;  4CXW A;  4DBM A;  2W61 A;  1QLB A;  5FY0 A;  2XQ4 A;  4UM3 S;  4ERR A;  2H7V C;  4DV6 T;  4GKK T;  3L09 A;  2NP9 A;  3Q5D A;  4KHZ F;  5LHG B;  3PUW F;  4GK0 E;  4UM3 P;  2YN6 A;  3Q5E A;  3RYC E;  4LF7 T;  3AVS A;  3MA9 A;  2KXP B;  1T7S A;  2JJ9 A;  4UVA B;  2K9A A;  4HFH A;  3RYH E;  5FP3 A;  2XNT A;  2WM9 A;  4OFZ A;  4UM1 A;  4DID B;  2CM0 A;  2XNV A;  1UUR A;  3C64 A;  5JVD E;  3FB2 A;  4IDZ A;  4XHE A;  2A3D A;  3G06 A;  3RC8 A;  5HYA A;  2A2F X;  1VRB A;  2EHO D;  1HNZ T;  2EHO C;  2VWA A;  3RGL A;  2A72 A;  4Z91 A;  2ODV A;  3O9X A;  2JPF A;  4OK0 A;  4EED A;  4AQY T;  5SYO A;  3EAM A;  3E22 E;  3CQC B;  3NKZ A;  1L0V A;  2PJQ A;  1OED C;  4C91 A;  3VU7 H;  5AQU B;  2W63 A;  2VAS A;  3ZDG A;  4X1I E;  5ABG A;  5FMN A;  2J47 A;  4ZI7 E;  3NZQ A;  4UF0 A;  1Z0P A;  2X9X A;  3PJA A;  4PAG A;  2NW8 A;  5L3C B;  2W67 A;  2HN1 A;  5DQW A;  3RRW A;  3BQK A;  3A7M A;  4HWF A;  3L3P A;  2XAG B;  2H88 A;  2NOX A;  2VB6 A;  5LMN T;  4YHH T;  2D9D A;  3LK4 2;  3M3Z B;  3I1A A;  3H3M A;  3IF8 B;  4H9O C;  5DAB A;  2PH9 A;  2VL8 A;  2BYS A;  2UU9 T;  5L3F B;  2YDS A;  3KV9 A;  2DHR A;  2D2S A;  3ESL A;  3AE5 A;  1BR0 A;  1D0Z A;  3UUL A;  3PJA J;  5C3J A;  4QAC A;  3N9Q A;  5ADX L;  4AKH A;  3T8O A;  5HXE A;  3NWI A;  3CK6 A;  4YT0 A;  4TV8 E; 
#chains in the Genus database with same CATH homology
 5L4H A;  2WZY A;  2YME A;  4XHE A;  3RQU A;  3UQ4 A;  4A98 A;  3C84 A;  5AFH A;  5JME A;  5J5I A;  2W8G A;  4IRE A;  2LKH A;  3P4W A;  4QAA A;  5AFL A;  4WV9 A;  4TWD A;  3SH1 A;  4IL4 A;  4UM3 A;  4FRR A;  3RIF A;  4XK9 A;  1OED E;  5AFK A;  3WTJ A;  2WNC A;  2Y54 A;  2BJ0 A;  2YMD A;  3LSV A;  3PMZ A;  5AFM A;  4Z91 A;  3WTI A;  5HCM A;  2UZ6 A;  3U8N A;  2XZ6 A;  4X5T A;  3UU3 A;  4NZB A;  4UXU A;  5CFB A;  5FJV A;  4HFD A;  4AFT A;  3UQ7 A;  4UY2 A;  2LLY A;  5HEG A;  2QC1 B;  3EAM A;  2BG9 A;  5CO5 A;  5SYO A;  5J5F A;  3JAE A;  4ILC A;  3U8L A;  1OED C;  3WTL A;  5BRX A;  2YKS A;  2ZJU A;  4LMJ A;  4IL9 A;  1I9B A;  2XQ9 A;  3TLW A;  3PEO A;  4TWF A;  3SQ6 A;  4COF A;  3ZDG A;  3GUA A;  1UX2 A;  2BYR A;  3U8J A;  5BW2 A;  1UV6 A;  4QH4 A;  2BYQ A;  2XYS A;  4ZRU A;  3WTH A;  2MAW A;  4NPP A;  4F8H A;  3UUB A;  4PIR A;  2KSR A;  3RIA A;  3UU5 A;  2PGZ A;  4ZJS A;  3ZKR A;  4DBM A;  3WTM A;  2Y57 A;  2M6B A;  2WNJ A;  3SIO A;  5LXB A;  3TLU A;  2XQ7 A;  3TLV A;  5BP0 A;  5L47 A;  4ZK4 A;  2BG9 C;  4TWH A;  2M6I A;  4LML A;  5KZU A;  2C9T A;  2X00 A;  2W8F A;  3C79 A;  5J5H A;  4B5D A;  4LMK A;  4A97 A;  2XQ4 A;  4ZJT A;  5HEJ A;  2Y58 A;  3WTN A;  5HEH A;  1OED B;  4UM3 S;  2BG9 E;  2LKG A;  5AIN A;  3TLT A;  5L4E A;  3RQW A;  2XZ5 A;  3UU4 A;  2XQ3 A;  2VL0 A;  5J5G A;  4ALX A;  4ILA A;  5LG3 A;  3ZDH A;  2LM2 A;  4D01 A;  2XQA A;  2XNU A;  4QH1 A;  4HFE A;  2PH9 A;  3SQ9 A;  4EZ1 A;  5KE4 A;  5AFM B;  4HQP A;  5HCJ A;  2BYS A;  4Z90 A;  3UU6 A;  4UM3 P;  2YN6 A;  4ZZB A;  4ZR6 A;  2XYT A;  3IGQ A;  3U8M A;  2BYN A;  2WNL A;  4AFH A;  2BR7 A;  3WIP A;  4AFG A;  2Y7Y A;  4HFB A;  4QAB A;  1UW6 A;  1OED A;  2XQ6 A;  3JAF A;  2BG9 B;  4HFC A;  5AFJ A;  2WN9 A;  5J0Z A;  4ILB A;  4TNV A;  5AFN A;  3EHZ A;  2ZJV A;  4BQT A;  3UU8 A;  4HFH A;  4ZZC A;  3TLS A;  2BYP A;  5HEU A;  4BFQ A;  2XQ8 A;  2XQ5 A;  3P50 A;  2XNT A;  4QAC A;  4TNW A;  3T4M A;  5TVC A;  4UM1 A;  2YOE A;  3RHW A;  2BR8 A;  3RI5 A;  3WTO A;  3WTK A;  2XNV A;  3JAD A;  4QH5 A;  5IUX A;  2Y56 A;  5HEO A;  3U8K A;  2X00 D;  3EI0 A;  4ZK1 A;  4HFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...