3EHZA

X-ray structure of the pentameric ligand gated ion channel of gloebacter violaceus (glic) in a presumptive open conformation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a potentially open state of a proton-activated pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein
molecule keywords Glr4197 protein
total genus 81
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3ehzA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3ehzA01
4ZJSA 3PMZA 4WV9A 5AFHA 3U8NA 3TLSA 4QAAA 5L4EA 2BR8A 3WTOA 2MAWA 5LXBA 2BG9C 3P50A 4ZJTA 2XQ4A 4HFEA 2ZJVA 2LKHA 2Y57A 5HEUA 4BQTA 2BG9E 5HEHA 3TLTA 3JAEA 2VL0A 3RI5A 5AFJA 5AFKA 2XQ6A 4TWFA 4AFGA 5AFLA 2LKGA 5HEJA 2W8FA 2YMEA 4UM1A 4ILCA 5AFNA 2XNUA 3WTIA 3JADA 3GUAA 2BG9B 5TVCA 5L4HA 3RHWA 2XQ5A 2BYQA 2PGZA 2XNTA 2YKSA 4Z91A 5BP0A 2QC1B 4QABA 5HEOA 3UU5A 3LSVA 3ZDGA 3U8MA 4ILAA 3UQ4A 2WNJA 2Y54A 3WTJA 2WNCA 4ZZCA 2WNLA 3TLWA 2KSRA 3U8KA 4EZ1A 2XQAA 4XHEA 3SQ9A 3UU6A 3WTMA 3SQ6A 4ZZBA 4TWDA 4Z90A 4FRRA 2BJ0A 3JAFA 4BFQA 5J5IA 4LMKA 2XYSA 4HFBA 2YOEA 3WTLA 4X5TA 3EAMA 3RIAA 2XZ6A 4QACA 2PH9A 2XQ3A 4A97A 2BYPA 2ZJUA 3SH1A 4HFCA 4TNWA 4LMLA 3WIPA 2XQ9A 5FJVA 5AFMB 2M6BA 5J5HA 1OEDA 2X00A 5CO5A 2WN9A 3U8LA 5J5FA 2YN6A 3SIOA 4UM3P 3C79A 5CFBA 4ZK4A 4IL9A 2BYSA 4NPPA 4QH5A 1UV6A 4A98A 3RIFA 3TLUA 5AINA 3RQWA 5HCMA 4B5DA 3U8JA 5HCJA 4D01A 2M6IA 2BYRA 5BW2A 5KZUA 2X00D 4HFDA 2Y7YA 3UU8A 5KE4A 3IGQA 4UY2A 2BR7A 5J0ZA 5L47A 4HFIA 3P4WA 3EHZA 2XZ5A 3C84A 4IREA 3ZDHA 2XQ8A 3T4MA 4AFHA 5J5GA 1OEDB 4ZK1A 2LM2A 3WTHA 4UXUA 4HFHA 5AFMA 3TLVA 4ZRUA 3WTKA 4ILBA 3UU4A 2BYNA 4ALXA 1UX2A 4HQPA 2BG9A 2YMDA 4XK9A 4COFA 2UZ6A 2WZYA 1OEDE 3UU3A 2XQ7A 3PEOA 4PIRA 4UM3A 5SYOA 4QH1A 2Y56A 5JMEA 5IUXA 2C9TA 1I9BA 4LMJA 3UQ7A 1OEDC 4TWHA 3ZKRA 2W8GA 4UM3S 1UW6A 5LG3A 4NZBA 3WTNA 2XNVA 4ZR6A 4IL4A 2LLYA 5BRXA 4TNVA 3EI0A 4F8HA 2Y58A 5HEGA 2XYTA 4AFTA 4DBMA 3RQUA 4QH4A 3UUBA
chains in the Genus database with same CATH superfamily
2LE8A 1NEKA 2J4GA 5LXTE 4X62T 4NUUA 3CX6B 3ZYKA 2ZM8A 5LG4A 3HKBE 3KV9A 4U33A 2EHOB 4ISTA 3ONXA 3CQXC 3FB2A 1MMAA 4P0BA 3I9YA 2X9YA 2YMEA 2XQYA 5FKYA 5TVCA 3BQKA 1HF8A 3ZT7A 1YKEB 4U2YA 3C4WA 4ILAA 4B3RT 2WNCA 3FZKB 1UUSA 5LHGB 2QGSA 2FJAA 4TZ4C 2JJ9A 5FY7A 2V7LA 3WTMA 3P4QA 2NW8A 2LSIA 4OYKA 2YOEA 3CKDA 2XQ3A 1HS7A 4U74A 3CVRA 3VRAA 3FHNA 2LSGA 4OK0A 3UT5E 4O2BE 3LK2B 4ZI3D 1Z0PA 3CX8B 1IAPA 1U4QA 3DP7A 2ZM6T 3V5SA 2WS3A 2CRBA 4QHOA 1OEDB 2CPTA 2B76A 1T8BA 2PFVA 4YLHA 5C3JA 5FMNA 2WZIA 5AQQB 4XK9A 3RIUC 4GK0E 3UQ7A 3IF8B 2L9QA 1LKXA 1NWMX 3K1SA 2Y6XA 3I9WA 1M62A 1EZ3A 3WTOA 5LXBA 3RKGA 5E0OA 2BS2A 4CI2B 3PU3A 4JEHB 4DV5T 5AQFB 5L3FB 1KK7A 3QC9A 4PFOA 3P7IA 2LSJA 3O1JA 2WNLA 2Q9QC 5JDNA 3ZN0B 1MNDA 4MALA 3F31A 3RKOA 4AKRB 2QYWA 3E0ZA 2V5DA 5FXWA 2AXDS 4BA9A 3FZLB 4JYAT 2X00A 2WN9A 3SIOA 5CFBA 2XUEA 4ZK4A 1UX4A 1XNRT 3QUJA 2P9BA 5FXVA 5L3CB 1D1BA 2Y7YA 2L8KA 1HCIA 3T4MA 2UXCT 4IDPA 4FJOA 5HXHA 3WAJA 5HYAA 5F3JA 3EVYA 5AFUL 4ZRUA 2BKNA 2E9XA 3IHRA 1HG2A 4HQPA 4ZS2A 5AQSB 4P09A 4EOZB 5AQIB 3D0TA 4AKGA 1UW6A 2X0YA 2Y58A 4AFTA 4DV1T 4BJNA 3C98B 4F6RC 1ZOYA 3ZMVB 4WV9A 2FJDA 2H3RA 4HTEA 3NBXX 4LF5T 3FZMB 3O4XE 3OTOT 3AEEA 4HFEA 2XM2A 3JAEA 5AQUB 2N9DA 2W00A 2XNUA 3T1YT 2CWYA 3FXDB 2ODUA 1D0XA 4QXHB 3SS1A 5H6RB 4KUMB 3UQ4A 2F4VT 4EZ1A 2XQAA 2W62A 5FP3A 3UU6A 4CN6A 2BJ0A 2BZBA 4BFQA 3N9QA 4UF0A 4IE7A 2VWAA 3ZCJA 2UUCT 2XZ6A 4UF0B 2XQ9A 2PG8A 3L39A 1J1JA 3SRZA 4UIGA 2UXNB 4L5GA 3M65A 1X79A 1S94A 4ZI3C 2VURA 5J2UE 2CXDA 4UY2A 1UX5A 1J5WA 4IREA 1IBMT 4OX9T 4ZK1A 2HH7A 4IE5A 4IT4A 4I0UA 4HFHA 3OYXA 4P1NA 4OHFA 1HNWT 4DR1T 4C91A 3OBVE 1OEDC 5H6QB 5LG3A 2X0HA 3ZMSB 3RQUA 4I4TE 2XTLA 3AE8A 1MMNA 1XZYA 4TUYE 5HEUA 3N9NA 5AFJA 4HWHA 3NVOA 5AFLA 2JQKA 2L3LA 3ZSSA 2CHNA 2X68A 2NP9A 5BP0A 2W66A 2VKDA 4DUZT 2WNJA 3RRCA 4JI3T 1L0VA 3SQ6A 2X0LB 1WCRA 4YSXA 4LMKA 2XYSA 1JNRA 3M3ZB 2W61A 2Y8DA 3LBXA 4DMWA 3NZPA 4GYRA 3P4SA 4TX5A 2LRKA 2CMRA 3GN5A 5LJNA 2IHR1 2NTYA 2X66A 2LSYA 2X00D 1N33T 2KLQA 5KE4A 4DV0T 4AKHA 2XZ5A 4H9QC 3E08A 2JQQA 5LOVE 2VQFT 2K3WA 4U72A 5IUXA 4O2AE 3NWIA 4YJ2E 3EUHA 4NZBA 4QX7B 5FYMA 3HKDE 3IBPA 1E1HB 5FL1A 5HXCA 3KFWX 2W4XA 2E9XB 4IDZA 4JV5T 1MIVA 4LF4T 3ZMZB 4JUYA 3VRBA 4AFGA 3AVRA 2QRXA 3E22E 4ILUA 3WTIA 2XNTA 4I50E 3UUMA 1MIWA 1W9RA 4O8SA 3RYHE 1JNZA 5LCYA 1HX8A 4AKLA 2WP9A 1CUNA 2V8SV 2BS4A 4AKIA 2Z6EA 4HFBA 3N2KE 3OVUA 4ZS3A 3PUAA 2BYPA 1NENA 4YFSA 1HNZT 3N2OA 5CO5A 1E7PA 3FZFB 2C5IT 3PTRB 3C79A 4GKJT 2Q9QB 4QH5A 3VKGA 1E2AA 1N34T 4YTMA 4CQIA 3AA1B 2N1GA 2RA1A 1UGOA 4ZHQE 2BR7A 3AE4A 5C8YE 3NKZA 3RGLA 3PUVF 2H7VC 3ZDHA 2K9AA 5JDGA 4PW8A 4JI7T 4MHCA 1T72A 4PIRA 5JMEA 4PAGA 1VRBA 3AE9A 1G73A 3SFEA 2LLYA 2X67A 3B57A 2HPJA 2CM0A 5AQRB 4YTPA 3KVAA 2IAKA 5AQPB 2KZ7B 3RIUA 3ESLA 2I59A 5HXSA 2BBJA 1FIOA 2MAWA 2CLYC 2K48A 2WWUA 2ZJVA 2VKOA 5J1GA 3EDUA 2BG9E 4EEBA 5L3EB 1YQ3A 3PUXF 2LKGA 2YDRA 4N78D 5HEJA 5GONE 3BQLA 2BBHA 2XQ5A 2WQYA 2YKSA 4QABA 4EEDA 2IW5B 2BS3A 3AE2A 1FEWA 2CWOA 3U8KA 3OYZA 3RF1A 4WNKA 4IE6A 2DCFA 4AXPA 2D5UA 2WAUA 1XMQT 3RYFE 4KHZF 3H37A 2KT9A 3KBTA 1WFDA 1KNPA 3F2EA 4HWIB 1YQ4A 5FJVA 4LF6T 5J5HA 1OEDA 4KMCA 3P8CD 4B6XA 5LGNB 2LSKA 2UXXB 2HN1A 1UV6A 4UV9B 5LMUT 4B3TT 2D0UA 4B5DA 3ONJA 4D01A 5BW2A 3AXJB 1D0YA 4DV3T 4AQYT 4CXYA 1R8IA 2ZM0A 4PK5A 3FBZA 3H3MA 5DABA 5AFMA 3I0OA 4ILBA 2D0TA 3HKEE 1B7TA 3HL6A 4IDOA 4COFA 2XQ7A 5AQOB 3P4RA 5LA6E 2I0MA 1I9BA 3W15B 4OYJA 5JVDE 4DR7T 4JEUB 5BRXA 2FJEA 2W2UA 3ZJ2A 5A1LA 4IE4A 5LP6E 2Q9QA 3KBUA 3PMZA 2A9UA 1XDPA 1XNQT 2MBGA 3WI3A 2E9XC 1DU2A 5HEHA 4Z8XA 4H9OC 2XQ6A 1UCUA 4TWFA 2VQET 3C4XA 4QXCB 3J7Yq 3V5UA 5JDHA 5F5WA 5F8PA 4ZZCA 4B3ST 1QSDA 4KX6A 3HI2A 4TWDA 4L9IA 2VKJA 5L3DB 5LBMA 3SFDA 4PJMA 1SA0E 3AEFA 5J5FA 1GQEA 4ZI7E 3RIFA 2CA5A 3TLUA 4UV8B 1YD8G 5HCJA 3Q5WA 4GK5E 4H9SE 4DNDA 4QWNB 2PTFA 2ACZA 5JDFA 3IGQA 2H7OA 3GA8A 4EV6A 4QKNA 3RC8A 4L0RA 5LB7B 4M1PA 1WLXA 5J5GA 3WTHA 4JBWF 2WWVA 3WTKA 4U7YA 5JRCA 4ASKA 2W8GA 1I6ZA 2J62A 4KI0F 4F8HA 1FMWA 1V9DA 1KNZA 5JQGE 4I43B 3TLSA 4LFCT 4U7IA 4X20E 4X1KE 4ZJTA 4BQTA 3UTKA 2FBWA 4DV6T 3R6NA 5JTGA 4DV4T 1O3XA 4IIJE 2LRLA 3RI5A 4X64T 5AFKA 3PDYA 4WBNE 3AEDA 4DR3T 3KINB 3LFMA 4Z91A 1BR4A 5HEOA 3PV0F 4LF9T 3U8MA 3N9LA 4NUVA 2KSRA 3RPUA 3ZT6A 2V7JA 2CHOA 1N36T 2LJLA 4HN9A 5HXRA 3G06A 3OKQA 2IDOB 5ABFB 2YU2A 3WTLA 4WW0A 2VKHA 4EYUA 2LOPA 2PH9A 4LMLA 3DTOA 3MK7C 4AQFA 5ABFA 3JC6C 2H89A 5AQGB 5AINA 3AB3B 2BKPA 1ZKEA 2Q9QD 4X1IE 2BYRA 2V26A 2XM1A 4HE8A 4GIWA 5L47A 5AQJB 3NRXA 5AQVB 5LBQB 4ZI2D 1XMOT 3IEEA 2BDEA 2LM9A 3UU4A 1FMVA 2E5VA 2BG9A 3AEGA 3T1HT 3VR9A 1ZV4X 3PUZF 4ZOLE 1MIYA 4TWHA 2WM9A 4BAYB 3U78A 4UM3S 2XNVA 3RH3A 3C4ZA 4NXNT 3N2GE 4JLEA 3U8NA 5L4EA 2A2FX 2KMFA 2WDQA 2E9XD 2YINA 1AJ3A 4LF8T 2XQ4A 2I6HA 2XY8B 4ISSA 5JR9B 2C0SA 5AFNA 3ABVA 3JADA 5BMVE 2PGZA 2EHOC 5LHHB 2A72A 2D2SA 2BVLA 2LEHA 2N2NA 4MLKA 3ZMTB 3AE5A 3VU7H 4PJLA 3PUQA 4JI8T 3RIAA 2WB5A 2XZEA 3WAKA 4PK6A 2ZMAA 2X9HA 2VL8A 2OA5A 3K8PC 2W63A 3UUXB 4IL9A 3CK6A 3L3PA 5AQMB 5HCMA 2WU5A 2X9XA 5HXEA 5KZUA 2MOZA 3CWZB 2B1EA 4WYVA 3ZC1A 4U3CA 3PUWF 3UU8A 3MKDA 4HFVA 4HFIA 2PBIA 4GOUA 4YJ3E 5DQWA 5HWXA 2JPFA 4PJNA 2JMHA 2XSAA 2E2AA 1IZNB 2D9DA 3LDQB 3AA6B 1J5ET 1T98A 2DLRA 1BR0A 1OEDE 3UU3A 4DR2T 2NW7A 3KV5A 1XDOA 4BJMA 2V5CA 3X1DA 4ILCA 5TAOA 2DWGA 4CZZB 2NR4A 4UEMA 5JRCB 5BR8T 2JRKA 2WZHA 3NRYA 1VOMA 3ZN1B 3TLTA 2CXFA 2VL0A 2DHRA 2MYSA 3P4PA 4JI4T 1KNRA 1Y01A 2W8FA 4HWDA 5LMNT 2YU1A 4JI1T 5L4HA 3Q2MA 3C50A 4DIDB 2CBJA 3PUYF 1YKHB 2QC1B 1MNEA 2X9WA 3TLWA 1X9BA 5HWYA 2KINB 5HAXA 2M67A 4V1Av 4DBRA 4A97A 3SH1A 3L09A 5AFMB 5JH7E 2UUBT 3JC6D 5LJMA 3U8LA 2C5JA 2WU2A 1N32T 4U31A 1WYCA 4UVAB 2ZM2A 4YHJA 1HX1B 3AA0B 3UUNA 2IIUA 1LRZA 4CN1A 1QUUA 4U2ZA 5KXJA 5FXXA 4JI2T 3AE7A 3P4WA 2UXDT 3KV6A 4UVCB 4ZI2C 3SWHA 2LOSA 2VVSA 4NXMT 4ALXA 4HEAA 2IC6A 2BKOA 3LJCA 5ADXL 3MXZA 2PJQA 2CXLA 2XJ7A 1US7B 2VVNA 4ZR6A 3EI0A 3MJXA 5AQLB 5HEGA 4EZ4A 4QH4A 4PJJA 4TN7B 5AFHA 4QAAA 3DJBA 4ZXLA 3RX6A 3ETVA 3HKCE 1HNXT 3FBLA 3MA9A 3FZHB 1H7CA 4WZXA 4B3MT 4TV8E 4DR6T 1U5PA 4YTNA 4IE0A 4QXBB 2BG9B 3ANWA 2V6XA 3RHWA 2A3DA 5ETWA 4PK4A 2WY2A 4UR9A 3AE3A 4XAXB 2V1DB 4FRRA 3BQIA 1CHUA 5J5IA 3ZYMA 4CXXA 1WYBA 2JQHA 3GMIA 3U3IA 4QACA 5FY1A 2ZJUA 5JR9A 4OFZA 4CI1B 3PUGA 5FXZA 3AEAA 4A98A 3AEBA 2W67A 5EK3A 2XAJB 2XAGB 3EDVA 2LM2A 3CQGB 1UURA 3OJAA 4E7ZA 2EHOD 5EK4A 4H9PC 3TLVA 2LHRA 2J1DG 4CXWA 3BK9A 4UM3A 2MTQA 2JMKA 4LMJA 3LBXB 2XSBA 5JR9C 3AAEB 4PNIA 1Z8UA 2C5KT 5AQNB 2J47A 1SUMB 4H9NC 4DBQA 4I55E 4DVDA 4K0KT 1ZHCA 3RYIE 2BYQA 4ERRA 2HPLA 2OV9A 3ZDGA 2Y54A 1IJ6A 3QB5K 1ZEEA 5CB4E 3SOLA 2JIWA 3JAFA 4G63A 5AQKB 2BVMA 3CQCB 4X5TA 2YEVC 2SPCA 3EAMA 2WBLA 2WDVA 1I94T 2LT3A 2YN6A 5DJQC 2DL1A 4NPPA 2XASB 4MFRA 4EGWA 2DNXA 3PE0A 2WCAA 4KHPT 5CA1E 4CN4A 2RPAA 3EABA 3CIRA 3PJAJ 2V7IA 3TKLB 1IJ5A 2YDQA 5KMGP 1XWMA 4IHJE 3C84A 4AI6A 3ZYLA 1BR1A 1Y64B 3FXEB 2WSSV 3ZMUB 4X66T 3A7MA 2NTXA 3ZLIA 3RC3A 2Y48B 5L2LA 2YMDA 3A8YC 2UZ6A 4HWCA 4Q25A 5C2TA 4J2CA 4YSYA 4YY3T 3AA7B 3AVSA 2XYTA 2V6YA 3AAIA 3O9XA 2BR8A 5IYZE 1ZP0A 3ZJ1A 2IMLA 2ODVA 2YDSA 3R84B 4DR4T 4K0UA 1KEYA 4QX8B 4ZEYA 1MMDA 3ONLC 4HGAA 3UU5A 1D0ZA 4EZHA 3K3OA 4MBQA 3PJAA 4ZZBA 3PUSA 5L3GB 3F57A 5FY0A 1OWAA 1D1AA 4P0AA 4UVBB 2ES0A 3WIPA 2VK9A 2DI4A 1D1CA 2LHNA 2DWKA 3VHLA 3ANWB 1BR2A 4YXDA 3HA4A 5JDLA 3MACA 3RQWA 1SHZC 2VB6A 1WRDA 2FUPA 3J9X1 2CE7A 3UULA 1NAFA 4PFPA 4DMVA 5JDQA 1LVFA 4GKKT 3OPCA 1HG5A 3PU8A 4UELA 5EK2A 5SYOA 3C51A 1HFAA 2C9TA 5FNVE 3HR0A 4X65T 2IUBA 5LGTB 5J2TE 4IL4A 2WDRA 2CBIA 3N9OA 4H9RC 4ZJSA 3NZQA 3C64A 4TV9E 1W09A 5JREA 4FI5A 1QLBA 2XHEB 4IDQA 2FJBA 3CPZA 4XBFB 2ZLYA 3AECA 5CGMA 5L3BB 4LFBT 2K5BB 2CLYB 4DV2T 5LGUB 2V7KA 4WBOA 4H63V 4O4HE 2QA7A 4XHEA 2XAHB 4Z90A 1WR6A 5DQVA 4DUYT 3GN5B 2NW9A 4C90A 3I1AA 4AQGA 4HFCA 3CMLA 3ZPOA 4DR5T 5ABGA 3ZCIA 2XPKA 2QVAA 3U8JA 4EAHA 5LYJE 2WMOA 4HFDA 4DO0A 4JI0T 5J0ZA 3KDSE 4EXTA 3AE1A 3JCFA 3CX7B 4H63H 3Q5DA 3Q9DA 4JI5T 4O4IE 3K3QC 3RYCE 2G0UA 3L8RA 2WZYA 4YHHT 2EHOA 3ETUA 3QB5A 3WTNA 4A56A 5CA0E 3RLFF 5CJ5A 1VCTA 3UUBA 2UU9T 4IGUA 3UFGA 3ZT5A 2KWIB 2R6GF 2BG9C 3QNUA 4NIQA 2H88A 2Y57A 2CCQA 3O1HA 3O1IA 1S35A 4EIWA 4E7SA 2MPKA 3RRWA 5AQTB 4GYSA 2KNDA 4ADZA 2V6YB 3LSVA 4XZCA 1W0BA 2KXPB 3Q5EA 2WMNA 3I0QA 1SE7A 3ZC0A 2K24A 1T7SA 1FJGT 2YK0A 4LFAT 5LNKA 1HTJF 4TNWA 2OLTA 4O4JE 2E5LT 3MZKB 1M7KA 1KF6A 2NWBA 2X51A 3N9PA 1KFYA 2JQ9A 3AE6A 4DV7T 3KVBA 2UXBT 2GK9A 5LHIB 4ANJA 2VASA 3LK3B 5FVKA 3VR8A 5ABHA 2E8IA 3EHZA 2XQ8A 4AFHA 1OXZA 3N9MA 4UXUA 2XAQB 3UFEA 2BYNA 2ACXA 3KV4A 4O4LE 3PEOA 2Y56A 3S4UA 3QK6A 1IBLT 2UUAT 4AISA 1WR0A 4TNVA 5KDMC 4DBMA 3A5XA 3B13A 1UK5A 2HHHT 1LVKA 5AQHB 3P50A 1YXRA 2AE9A 2LKHA 5IWAT 4HKAA 3Q5XA 3K3NA 3PURA 5FL0A 2CEAA 4YSZA 4CI3B 4UM1A 4A5XA 3T8OA 3GUAA 2NOXA 4AIUA 2IC9A 2V7MA 2W0GA 5KX5E 2XAFB 4X1YE 3WTJA 1MMGA 4KBMB 3AAAB 3QOFA 3H3AA 1W0AA 5FVLA 3SQ9A 3AXJA 3LG7A 3ZEFB 3LK42 4JI6T 3ZSTA 2HN2A 2M6BA 4UM3P 4YT0A 2BYSA 3N5LA 5JDMA 3GWHA 2M6IA 5M4YA 1G8XA 3VKHA 1HR0T 4EYYR 3IA3A 4AQFC 5IHYA 2KWHA 4IDNA 5EZYE 1UX2A 1VCSA 4UXNB 4QH1A 3B5MA 1YW0A 3ZKRA 4KP3C 1IBKT 4EB6E 5ABEA 4HWFA 2RP4A 4LF7T 4G2AA
chains in the Genus database with same CATH topology
4ZJSA 3PMZA 4WV9A 5AFHA 3U8NA 3TLSA 4QAAA 5L4EA 2BR8A 3WTOA 2MAWA 5LXBA 2BG9C 3P50A 4ZJTA 2XQ4A 4HFEA 2ZJVA 2LKHA 2Y57A 5HEUA 4BQTA 2BG9E 5HEHA 3TLTA 3JAEA 2VL0A 3RI5A 5AFJA 5AFKA 2XQ6A 4TWFA 4AFGA 5AFLA 2LKGA 5HEJA 2W8FA 2YMEA 4UM1A 4ILCA 5AFNA 2XNUA 3WTIA 3JADA 3GUAA 2BG9B 5TVCA 5L4HA 3RHWA 2XQ5A 2BYQA 2PGZA 2XNTA 2YKSA 4Z91A 5BP0A 2QC1B 4QABA 5HEOA 3UU5A 3LSVA 3ZDGA 3U8MA 4ILAA 3UQ4A 2WNJA 2Y54A 3WTJA 2WNCA 4ZZCA 2WNLA 3TLWA 2KSRA 3U8KA 4EZ1A 2XQAA 4XHEA 3SQ9A 3UU6A 3WTMA 3SQ6A 4ZZBA 4TWDA 4Z90A 4FRRA 2BJ0A 3JAFA 4BFQA 5J5IA 4LMKA 2XYSA 4HFBA 2YOEA 3WTLA 4X5TA 3EAMA 3RIAA 2XZ6A 4QACA 2PH9A 2XQ3A 4A97A 2BYPA 2ZJUA 3SH1A 4HFCA 4TNWA 4LMLA 3WIPA 2XQ9A 5FJVA 5AFMB 2M6BA 5J5HA 1OEDA 2X00A 5CO5A 2WN9A 3U8LA 5J5FA 2YN6A 3SIOA 4UM3P 3C79A 5CFBA 4ZK4A 4IL9A 2BYSA 4NPPA 4QH5A 1UV6A 4A98A 3RIFA 3TLUA 5AINA 3RQWA 5HCMA 4B5DA 3U8JA 5HCJA 4D01A 2M6IA 2BYRA 5BW2A 5KZUA 2X00D 4HFDA 2Y7YA 3UU8A 5KE4A 3IGQA 4UY2A 2BR7A 5J0ZA 5L47A 4HFIA 3P4WA 3EHZA 2XZ5A 3C84A 4IREA 3ZDHA 2XQ8A 3T4MA 4AFHA 5J5GA 1OEDB 4ZK1A 2LM2A 3WTHA 4UXUA 4HFHA 5AFMA 3TLVA 4ZRUA 3WTKA 4ILBA 3UU4A 2BYNA 4ALXA 1UX2A 4HQPA 2BG9A 2YMDA 4XK9A 4COFA 2UZ6A 2WZYA 1OEDE 3UU3A 2XQ7A 3PEOA 4PIRA 4UM3A 5SYOA 4QH1A 2Y56A 5JMEA 5IUXA 2C9TA 1I9BA 4LMJA 3UQ7A 1OEDC 4TWHA 3ZKRA 2W8GA 4UM3S 1UW6A 5LG3A 4NZBA 3WTNA 2XNVA 4ZR6A 4IL4A 2LLYA 5BRXA 4TNVA 3EI0A 4F8HA 2Y58A 5HEGA 2XYTA 4AFTA 4DBMA 3RQUA 4QH4A 3UUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZJS A;  3PMZ A;  4WV9 A;  5AFH A;  3U8N A;  3TLS A;  4QAA A;  5L4E A;  2BR8 A;  3WTO A;  2MAW A;  5LXB A;  2BG9 C;  3P50 A;  4ZJT A;  2XQ4 A;  4HFE A;  2ZJV A;  2LKH A;  2Y57 A;  5HEU A;  4BQT A;  2BG9 E;  5HEH A;  3TLT A;  3JAE A;  2VL0 A;  3RI5 A;  5AFJ A;  5AFK A;  2XQ6 A;  4TWF A;  4AFG A;  5AFL A;  2LKG A;  5HEJ A;  2W8F A;  2YME A;  4UM1 A;  4ILC A;  5AFN A;  2XNU A;  3WTI A;  3JAD A;  3GUA A;  2BG9 B;  5TVC A;  5L4H A;  3RHW A;  2XQ5 A;  2BYQ A;  2PGZ A;  2XNT A;  2YKS A;  4Z91 A;  5BP0 A;  2QC1 B;  4QAB A;  5HEO A;  3UU5 A;  3LSV A;  3ZDG A;  3U8M A;  4ILA A;  3UQ4 A;  2WNJ A;  2Y54 A;  3WTJ A;  2WNC A;  4ZZC A;  2WNL A;  3TLW A;  2KSR A;  3U8K A;  4EZ1 A;  2XQA A;  4XHE A;  3SQ9 A;  3UU6 A;  3WTM A;  3SQ6 A;  4ZZB A;  4TWD A;  4Z90 A;  4FRR A;  2BJ0 A;  3JAF A;  4BFQ A;  5J5I A;  4LMK A;  2XYS A;  4HFB A;  2YOE A;  3WTL A;  4X5T A;  3EAM A;  3RIA A;  2XZ6 A;  4QAC A;  2PH9 A;  2XQ3 A;  4A97 A;  2BYP A;  2ZJU A;  3SH1 A;  4HFC A;  4TNW A;  4LML A;  3WIP A;  2XQ9 A;  5FJV A;  5AFM B;  2M6B A;  5J5H A;  1OED A;  2X00 A;  5CO5 A;  2WN9 A;  3U8L A;  5J5F A;  2YN6 A;  3SIO A;  4UM3 P;  3C79 A;  5CFB A;  4ZK4 A;  4IL9 A;  2BYS A;  4NPP A;  4QH5 A;  1UV6 A;  4A98 A;  3RIF A;  3TLU A;  5AIN A;  3RQW A;  5HCM A;  4B5D A;  3U8J A;  5HCJ A;  4D01 A;  2M6I A;  2BYR A;  5BW2 A;  5KZU A;  2X00 D;  4HFD A;  2Y7Y A;  3UU8 A;  5KE4 A;  3IGQ A;  4UY2 A;  2BR7 A;  5J0Z A;  5L47 A;  4HFI A;  3P4W A;  3EHZ A;  2XZ5 A;  3C84 A;  4IRE A;  3ZDH A;  2XQ8 A;  3T4M A;  4AFH A;  5J5G A;  1OED B;  4ZK1 A;  2LM2 A;  3WTH A;  4UXU A;  4HFH A;  5AFM A;  3TLV A;  4ZRU A;  3WTK A;  4ILB A;  3UU4 A;  2BYN A;  4ALX A;  1UX2 A;  4HQP A;  2BG9 A;  2YMD A;  4XK9 A;  4COF A;  2UZ6 A;  2WZY A;  1OED E;  3UU3 A;  2XQ7 A;  3PEO A;  4PIR A;  4UM3 A;  5SYO A;  4QH1 A;  2Y56 A;  5JME A;  5IUX A;  2C9T A;  1I9B A;  4LMJ A;  3UQ7 A;  1OED C;  4TWH A;  3ZKR A;  2W8G A;  4UM3 S;  1UW6 A;  5LG3 A;  4NZB A;  3WTN A;  2XNV A;  4ZR6 A;  4IL4 A;  2LLY A;  5BRX A;  4TNV A;  3EI0 A;  4F8H A;  2Y58 A;  5HEG A;  2XYT A;  4AFT A;  4DBM A;  3RQU A;  4QH4 A;  3UUB A; 
#chains in the Genus database with same CATH topology
 2LE8 A;  1NEK A;  2J4G A;  5LXT E;  4X62 T;  4NUU A;  3CX6 B;  3ZYK A;  2ZM8 A;  5LG4 A;  3HKB E;  3KV9 A;  4U33 A;  2EHO B;  4IST A;  3ONX A;  3CQX C;  3FB2 A;  1MMA A;  4P0B A;  3I9Y A;  2X9Y A;  2YME A;  2XQY A;  5FKY A;  5TVC A;  3BQK A;  1HF8 A;  3ZT7 A;  1YKE B;  4U2Y A;  3C4W A;  4ILA A;  4B3R T;  2WNC A;  3FZK B;  1UUS A;  5LHG B;  2QGS A;  2FJA A;  4TZ4 C;  2JJ9 A;  5FY7 A;  2V7L A;  3WTM A;  3P4Q A;  2NW8 A;  2LSI A;  4OYK A;  2YOE A;  3CKD A;  2XQ3 A;  1HS7 A;  4U74 A;  3CVR A;  3VRA A;  3FHN A;  2LSG A;  4OK0 A;  3UT5 E;  4O2B E;  3LK2 B;  4ZI3 D;  1Z0P A;  3CX8 B;  1IAP A;  1U4Q A;  3DP7 A;  2ZM6 T;  3V5S A;  2WS3 A;  2CRB A;  4QHO A;  1OED B;  2CPT A;  2B76 A;  1T8B A;  2PFV A;  4YLH A;  5C3J A;  5FMN A;  2WZI A;  5AQQ B;  4XK9 A;  3RIU C;  4GK0 E;  3UQ7 A;  3IF8 B;  2L9Q A;  1LKX A;  1NWM X;  3K1S A;  2Y6X A;  3I9W A;  1M62 A;  1EZ3 A;  3WTO A;  5LXB A;  3RKG A;  5E0O A;  2BS2 A;  4CI2 B;  3PU3 A;  4JEH B;  4DV5 T;  5AQF B;  5L3F B;  1KK7 A;  3QC9 A;  4PFO A;  3P7I A;  2LSJ A;  3O1J A;  2WNL A;  2Q9Q C;  5JDN A;  3ZN0 B;  1MND A;  4MAL A;  3F31 A;  3RKO A;  4AKR B;  2QYW A;  3E0Z A;  2V5D A;  5FXW A;  2AXD S;  4BA9 A;  3FZL B;  4JYA T;  2X00 A;  2WN9 A;  3SIO A;  5CFB A;  2XUE A;  4ZK4 A;  1UX4 A;  1XNR T;  3QUJ A;  2P9B A;  5FXV A;  5L3C B;  1D1B A;  2Y7Y A;  2L8K A;  1HCI A;  3T4M A;  2UXC T;  4IDP A;  4FJO A;  5HXH A;  3WAJ A;  5HYA A;  5F3J A;  3EVY A;  5AFU L;  4ZRU A;  2BKN A;  2E9X A;  3IHR A;  1HG2 A;  4HQP A;  4ZS2 A;  5AQS B;  4P09 A;  4EOZ B;  5AQI B;  3D0T A;  4AKG A;  1UW6 A;  2X0Y A;  2Y58 A;  4AFT A;  4DV1 T;  4BJN A;  3C98 B;  4F6R C;  1ZOY A;  3ZMV B;  4WV9 A;  2FJD A;  2H3R A;  4HTE A;  3NBX X;  4LF5 T;  3FZM B;  3O4X E;  3OTO T;  3AEE A;  4HFE A;  2XM2 A;  3JAE A;  5AQU B;  2N9D A;  2W00 A;  2XNU A;  3T1Y T;  2CWY A;  3FXD B;  2ODU A;  1D0X A;  4QXH B;  3SS1 A;  5H6R B;  4KUM B;  3UQ4 A;  2F4V T;  4EZ1 A;  2XQA A;  2W62 A;  5FP3 A;  3UU6 A;  4CN6 A;  2BJ0 A;  2BZB A;  4BFQ A;  3N9Q A;  4UF0 A;  4IE7 A;  2VWA A;  3ZCJ A;  2UUC T;  2XZ6 A;  4UF0 B;  2XQ9 A;  2PG8 A;  3L39 A;  1J1J A;  3SRZ A;  4UIG A;  2UXN B;  4L5G A;  3M65 A;  1X79 A;  1S94 A;  4ZI3 C;  2VUR A;  5J2U E;  2CXD A;  4UY2 A;  1UX5 A;  1J5W A;  4IRE A;  1IBM T;  4OX9 T;  4ZK1 A;  2HH7 A;  4IE5 A;  4IT4 A;  4I0U A;  4HFH A;  3OYX A;  4P1N A;  4OHF A;  1HNW T;  4DR1 T;  4C91 A;  3OBV E;  1OED C;  5H6Q B;  5LG3 A;  2X0H A;  3ZMS B;  3RQU A;  4I4T E;  2XTL A;  3AE8 A;  1MMN A;  1XZY A;  4TUY E;  5HEU A;  3N9N A;  5AFJ A;  4HWH A;  3NVO A;  5AFL A;  2JQK A;  2L3L A;  3ZSS A;  2CHN A;  2X68 A;  2NP9 A;  5BP0 A;  2W66 A;  2VKD A;  4DUZ T;  2WNJ A;  3RRC A;  4JI3 T;  1L0V A;  3SQ6 A;  2X0L B;  1WCR A;  4YSX A;  4LMK A;  2XYS A;  1JNR A;  3M3Z B;  2W61 A;  2Y8D A;  3LBX A;  4DMW A;  3NZP A;  4GYR A;  3P4S A;  4TX5 A;  2LRK A;  2CMR A;  3GN5 A;  5LJN A;  2IHR 1;  2NTY A;  2X66 A;  2LSY A;  2X00 D;  1N33 T;  2KLQ A;  5KE4 A;  4DV0 T;  4AKH A;  2XZ5 A;  4H9Q C;  3E08 A;  2JQQ A;  5LOV E;  2VQF T;  2K3W A;  4U72 A;  5IUX A;  4O2A E;  3NWI A;  4YJ2 E;  3EUH A;  4NZB A;  4QX7 B;  5FYM A;  3HKD E;  3IBP A;  1E1H B;  5FL1 A;  5HXC A;  3KFW X;  2W4X A;  2E9X B;  4IDZ A;  4JV5 T;  1MIV A;  4LF4 T;  3ZMZ B;  4JUY A;  3VRB A;  4AFG A;  3AVR A;  2QRX A;  3E22 E;  4ILU A;  3WTI A;  2XNT A;  4I50 E;  3UUM A;  1MIW A;  1W9R A;  4O8S A;  3RYH E;  1JNZ A;  5LCY A;  1HX8 A;  4AKL A;  2WP9 A;  1CUN A;  2V8S V;  2BS4 A;  4AKI A;  2Z6E A;  4HFB A;  3N2K E;  3OVU A;  4ZS3 A;  3PUA A;  2BYP A;  1NEN A;  4YFS A;  1HNZ T;  3N2O A;  5CO5 A;  1E7P A;  3FZF B;  2C5I T;  3PTR B;  3C79 A;  4GKJ T;  2Q9Q B;  4QH5 A;  3VKG A;  1E2A A;  1N34 T;  4YTM A;  4CQI A;  3AA1 B;  2N1G A;  2RA1 A;  1UGO A;  4ZHQ E;  2BR7 A;  3AE4 A;  5C8Y E;  3NKZ A;  3RGL A;  3PUV F;  2H7V C;  3ZDH A;  2K9A A;  5JDG A;  4PW8 A;  4JI7 T;  4MHC A;  1T72 A;  4PIR A;  5JME A;  4PAG A;  1VRB A;  3AE9 A;  1G73 A;  3SFE A;  2LLY A;  2X67 A;  3B57 A;  2HPJ A;  2CM0 A;  5AQR B;  4YTP A;  3KVA A;  2IAK A;  5AQP B;  2KZ7 B;  3RIU A;  3ESL A;  2I59 A;  5HXS A;  2BBJ A;  1FIO A;  2MAW A;  2CLY C;  2K48 A;  2WWU A;  2ZJV A;  2VKO A;  5J1G A;  3EDU A;  2BG9 E;  4EEB A;  5L3E B;  1YQ3 A;  3PUX F;  2LKG A;  2YDR A;  4N78 D;  5HEJ A;  5GON E;  3BQL A;  2BBH A;  2XQ5 A;  2WQY A;  2YKS A;  4QAB A;  4EED A;  2IW5 B;  2BS3 A;  3AE2 A;  1FEW A;  2CWO A;  3U8K A;  3OYZ A;  3RF1 A;  4WNK A;  4IE6 A;  2DCF A;  4AXP A;  2D5U A;  2WAU A;  1XMQ T;  3RYF E;  4KHZ F;  3H37 A;  2KT9 A;  3KBT A;  1WFD A;  1KNP A;  3F2E A;  4HWI B;  1YQ4 A;  5FJV A;  4LF6 T;  5J5H A;  1OED A;  4KMC A;  3P8C D;  4B6X A;  5LGN B;  2LSK A;  2UXX B;  2HN1 A;  1UV6 A;  4UV9 B;  5LMU T;  4B3T T;  2D0U A;  4B5D A;  3ONJ A;  4D01 A;  5BW2 A;  3AXJ B;  1D0Y A;  4DV3 T;  4AQY T;  4CXY A;  1R8I A;  2ZM0 A;  4PK5 A;  3FBZ A;  3H3M A;  5DAB A;  5AFM A;  3I0O A;  4ILB A;  2D0T A;  3HKE E;  1B7T A;  3HL6 A;  4IDO A;  4COF A;  2XQ7 A;  5AQO B;  3P4R A;  5LA6 E;  2I0M A;  1I9B A;  3W15 B;  4OYJ A;  5JVD E;  4DR7 T;  4JEU B;  5BRX A;  2FJE A;  2W2U A;  3ZJ2 A;  5A1L A;  4IE4 A;  5LP6 E;  2Q9Q A;  3KBU A;  3PMZ A;  2A9U A;  1XDP A;  1XNQ T;  2MBG A;  3WI3 A;  2E9X C;  1DU2 A;  5HEH A;  4Z8X A;  4H9O C;  2XQ6 A;  1UCU A;  4TWF A;  2VQE T;  3C4X A;  4QXC B;  3J7Y q;  3V5U A;  5JDH A;  5F5W A;  5F8P A;  4ZZC A;  4B3S T;  1QSD A;  4KX6 A;  3HI2 A;  4TWD A;  4L9I A;  2VKJ A;  5L3D B;  5LBM A;  3SFD A;  4PJM A;  1SA0 E;  3AEF A;  5J5F A;  1GQE A;  4ZI7 E;  3RIF A;  2CA5 A;  3TLU A;  4UV8 B;  1YD8 G;  5HCJ A;  3Q5W A;  4GK5 E;  4H9S E;  4DND A;  4QWN B;  2PTF A;  2ACZ A;  5JDF A;  3IGQ A;  2H7O A;  3GA8 A;  4EV6 A;  4QKN A;  3RC8 A;  4L0R A;  5LB7 B;  4M1P A;  1WLX A;  5J5G A;  3WTH A;  4JBW F;  2WWV A;  3WTK A;  4U7Y A;  5JRC A;  4ASK A;  2W8G A;  1I6Z A;  2J62 A;  4KI0 F;  4F8H A;  1FMW A;  1V9D A;  1KNZ A;  5JQG E;  4I43 B;  3TLS A;  4LFC T;  4U7I A;  4X20 E;  4X1K E;  4ZJT A;  4BQT A;  3UTK A;  2FBW A;  4DV6 T;  3R6N A;  5JTG A;  4DV4 T;  1O3X A;  4IIJ E;  2LRL A;  3RI5 A;  4X64 T;  5AFK A;  3PDY A;  4WBN E;  3AED A;  4DR3 T;  3KIN B;  3LFM A;  4Z91 A;  1BR4 A;  5HEO A;  3PV0 F;  4LF9 T;  3U8M A;  3N9L A;  4NUV A;  2KSR A;  3RPU A;  3ZT6 A;  2V7J A;  2CHO A;  1N36 T;  2LJL A;  4HN9 A;  5HXR A;  3G06 A;  3OKQ A;  2IDO B;  5ABF B;  2YU2 A;  3WTL A;  4WW0 A;  2VKH A;  4EYU A;  2LOP A;  2PH9 A;  4LML A;  3DTO A;  3MK7 C;  4AQF A;  5ABF A;  3JC6 C;  2H89 A;  5AQG B;  5AIN A;  3AB3 B;  2BKP A;  1ZKE A;  2Q9Q D;  4X1I E;  2BYR A;  2V26 A;  2XM1 A;  4HE8 A;  4GIW A;  5L47 A;  5AQJ B;  3NRX A;  5AQV B;  5LBQ B;  4ZI2 D;  1XMO T;  3IEE A;  2BDE A;  2LM9 A;  3UU4 A;  1FMV A;  2E5V A;  2BG9 A;  3AEG A;  3T1H T;  3VR9 A;  1ZV4 X;  3PUZ F;  4ZOL E;  1MIY A;  4TWH A;  2WM9 A;  4BAY B;  3U78 A;  4UM3 S;  2XNV A;  3RH3 A;  3C4Z A;  4NXN T;  3N2G E;  4JLE A;  3U8N A;  5L4E A;  2A2F X;  2KMF A;  2WDQ A;  2E9X D;  2YIN A;  1AJ3 A;  4LF8 T;  2XQ4 A;  2I6H A;  2XY8 B;  4ISS A;  5JR9 B;  2C0S A;  5AFN A;  3ABV A;  3JAD A;  5BMV E;  2PGZ A;  2EHO C;  5LHH B;  2A72 A;  2D2S A;  2BVL A;  2LEH A;  2N2N A;  4MLK A;  3ZMT B;  3AE5 A;  3VU7 H;  4PJL A;  3PUQ A;  4JI8 T;  3RIA A;  2WB5 A;  2XZE A;  3WAK A;  4PK6 A;  2ZMA A;  2X9H A;  2VL8 A;  2OA5 A;  3K8P C;  2W63 A;  3UUX B;  4IL9 A;  3CK6 A;  3L3P A;  5AQM B;  5HCM A;  2WU5 A;  2X9X A;  5HXE A;  5KZU A;  2MOZ A;  3CWZ B;  2B1E A;  4WYV A;  3ZC1 A;  4U3C A;  3PUW F;  3UU8 A;  3MKD A;  4HFV A;  4HFI A;  2PBI A;  4GOU A;  4YJ3 E;  5DQW A;  5HWX A;  2JPF A;  4PJN A;  2JMH A;  2XSA A;  2E2A A;  1IZN B;  2D9D A;  3LDQ B;  3AA6 B;  1J5E T;  1T98 A;  2DLR A;  1BR0 A;  1OED E;  3UU3 A;  4DR2 T;  2NW7 A;  3KV5 A;  1XDO A;  4BJM A;  2V5C A;  3X1D A;  4ILC A;  5TAO A;  2DWG A;  4CZZ B;  2NR4 A;  4UEM A;  5JRC B;  5BR8 T;  2JRK A;  2WZH A;  3NRY A;  1VOM A;  3ZN1 B;  3TLT A;  2CXF A;  2VL0 A;  2DHR A;  2MYS A;  3P4P A;  4JI4 T;  1KNR A;  1Y01 A;  2W8F A;  4HWD A;  5LMN T;  2YU1 A;  4JI1 T;  5L4H A;  3Q2M A;  3C50 A;  4DID B;  2CBJ A;  3PUY F;  1YKH B;  2QC1 B;  1MNE A;  2X9W A;  3TLW A;  1X9B A;  5HWY A;  2KIN B;  5HAX A;  2M67 A;  4V1A v;  4DBR A;  4A97 A;  3SH1 A;  3L09 A;  5AFM B;  5JH7 E;  2UUB T;  3JC6 D;  5LJM A;  3U8L A;  2C5J A;  2WU2 A;  1N32 T;  4U31 A;  1WYC A;  4UVA B;  2ZM2 A;  4YHJ A;  1HX1 B;  3AA0 B;  3UUN A;  2IIU A;  1LRZ A;  4CN1 A;  1QUU A;  4U2Z A;  5KXJ A;  5FXX A;  4JI2 T;  3AE7 A;  3P4W A;  2UXD T;  3KV6 A;  4UVC B;  4ZI2 C;  3SWH A;  2LOS A;  2VVS A;  4NXM T;  4ALX A;  4HEA A;  2IC6 A;  2BKO A;  3LJC A;  5ADX L;  3MXZ A;  2PJQ A;  2CXL A;  2XJ7 A;  1US7 B;  2VVN A;  4ZR6 A;  3EI0 A;  3MJX A;  5AQL B;  5HEG A;  4EZ4 A;  4QH4 A;  4PJJ A;  4TN7 B;  5AFH A;  4QAA A;  3DJB A;  4ZXL A;  3RX6 A;  3ETV A;  3HKC E;  1HNX T;  3FBL A;  3MA9 A;  3FZH B;  1H7C A;  4WZX A;  4B3M T;  4TV8 E;  4DR6 T;  1U5P A;  4YTN A;  4IE0 A;  4QXB B;  2BG9 B;  3ANW A;  2V6X A;  3RHW A;  2A3D A;  5ETW A;  4PK4 A;  2WY2 A;  4UR9 A;  3AE3 A;  4XAX B;  2V1D B;  4FRR A;  3BQI A;  1CHU A;  5J5I A;  3ZYM A;  4CXX A;  1WYB A;  2JQH A;  3GMI A;  3U3I A;  4QAC A;  5FY1 A;  2ZJU A;  5JR9 A;  4OFZ A;  4CI1 B;  3PUG A;  5FXZ A;  3AEA A;  4A98 A;  3AEB A;  2W67 A;  5EK3 A;  2XAJ B;  2XAG B;  3EDV A;  2LM2 A;  3CQG B;  1UUR A;  3OJA A;  4E7Z A;  2EHO D;  5EK4 A;  4H9P C;  3TLV A;  2LHR A;  2J1D G;  4CXW A;  3BK9 A;  4UM3 A;  2MTQ A;  2JMK A;  4LMJ A;  3LBX B;  2XSB A;  5JR9 C;  3AAE B;  4PNI A;  1Z8U A;  2C5K T;  5AQN B;  2J47 A;  1SUM B;  4H9N C;  4DBQ A;  4I55 E;  4DVD A;  4K0K T;  1ZHC A;  3RYI E;  2BYQ A;  4ERR A;  2HPL A;  2OV9 A;  3ZDG A;  2Y54 A;  1IJ6 A;  3QB5 K;  1ZEE A;  5CB4 E;  3SOL A;  2JIW A;  3JAF A;  4G63 A;  5AQK B;  2BVM A;  3CQC B;  4X5T A;  2YEV C;  2SPC A;  3EAM A;  2WBL A;  2WDV A;  1I94 T;  2LT3 A;  2YN6 A;  5DJQ C;  2DL1 A;  4NPP A;  2XAS B;  4MFR A;  4EGW A;  2DNX A;  3PE0 A;  2WCA A;  4KHP T;  5CA1 E;  4CN4 A;  2RPA A;  3EAB A;  3CIR A;  3PJA J;  2V7I A;  3TKL B;  1IJ5 A;  2YDQ A;  5KMG P;  1XWM A;  4IHJ E;  3C84 A;  4AI6 A;  3ZYL A;  1BR1 A;  1Y64 B;  3FXE B;  2WSS V;  3ZMU B;  4X66 T;  3A7M A;  2NTX A;  3ZLI A;  3RC3 A;  2Y48 B;  5L2L A;  2YMD A;  3A8Y C;  2UZ6 A;  4HWC A;  4Q25 A;  5C2T A;  4J2C A;  4YSY A;  4YY3 T;  3AA7 B;  3AVS A;  2XYT A;  2V6Y A;  3AAI A;  3O9X A;  2BR8 A;  5IYZ E;  1ZP0 A;  3ZJ1 A;  2IML A;  2ODV A;  2YDS A;  3R84 B;  4DR4 T;  4K0U A;  1KEY A;  4QX8 B;  4ZEY A;  1MMD A;  3ONL C;  4HGA A;  3UU5 A;  1D0Z A;  4EZH A;  3K3O A;  4MBQ A;  3PJA A;  4ZZB A;  3PUS A;  5L3G B;  3F57 A;  5FY0 A;  1OWA A;  1D1A A;  4P0A A;  4UVB B;  2ES0 A;  3WIP A;  2VK9 A;  2DI4 A;  1D1C A;  2LHN A;  2DWK A;  3VHL A;  3ANW B;  1BR2 A;  4YXD A;  3HA4 A;  5JDL A;  3MAC A;  3RQW A;  1SHZ C;  2VB6 A;  1WRD A;  2FUP A;  3J9X 1;  2CE7 A;  3UUL A;  1NAF A;  4PFP A;  4DMV A;  5JDQ A;  1LVF A;  4GKK T;  3OPC A;  1HG5 A;  3PU8 A;  4UEL A;  5EK2 A;  5SYO A;  3C51 A;  1HFA A;  2C9T A;  5FNV E;  3HR0 A;  4X65 T;  2IUB A;  5LGT B;  5J2T E;  4IL4 A;  2WDR A;  2CBI A;  3N9O A;  4H9R C;  4ZJS A;  3NZQ A;  3C64 A;  4TV9 E;  1W09 A;  5JRE A;  4FI5 A;  1QLB A;  2XHE B;  4IDQ A;  2FJB A;  3CPZ A;  4XBF B;  2ZLY A;  3AEC A;  5CGM A;  5L3B B;  4LFB T;  2K5B B;  2CLY B;  4DV2 T;  5LGU B;  2V7K A;  4WBO A;  4H63 V;  4O4H E;  2QA7 A;  4XHE A;  2XAH B;  4Z90 A;  1WR6 A;  5DQV A;  4DUY T;  3GN5 B;  2NW9 A;  4C90 A;  3I1A A;  4AQG A;  4HFC A;  3CML A;  3ZPO A;  4DR5 T;  5ABG A;  3ZCI A;  2XPK A;  2QVA A;  3U8J A;  4EAH A;  5LYJ E;  2WMO A;  4HFD A;  4DO0 A;  4JI0 T;  5J0Z A;  3KDS E;  4EXT A;  3AE1 A;  3JCF A;  3CX7 B;  4H63 H;  3Q5D A;  3Q9D A;  4JI5 T;  4O4I E;  3K3Q C;  3RYC E;  2G0U A;  3L8R A;  2WZY A;  4YHH T;  2EHO A;  3ETU A;  3QB5 A;  3WTN A;  4A56 A;  5CA0 E;  3RLF F;  5CJ5 A;  1VCT A;  3UUB A;  2UU9 T;  4IGU A;  3UFG A;  3ZT5 A;  2KWI B;  2R6G F;  2BG9 C;  3QNU A;  4NIQ A;  2H88 A;  2Y57 A;  2CCQ A;  3O1H A;  3O1I A;  1S35 A;  4EIW A;  4E7S A;  2MPK A;  3RRW A;  5AQT B;  4GYS A;  2KND A;  4ADZ A;  2V6Y B;  3LSV A;  4XZC A;  1W0B A;  2KXP B;  3Q5E A;  2WMN A;  3I0Q A;  1SE7 A;  3ZC0 A;  2K24 A;  1T7S A;  1FJG T;  2YK0 A;  4LFA T;  5LNK A;  1HTJ F;  4TNW A;  2OLT A;  4O4J E;  2E5L T;  3MZK B;  1M7K A;  1KF6 A;  2NWB A;  2X51 A;  3N9P A;  1KFY A;  2JQ9 A;  3AE6 A;  4DV7 T;  3KVB A;  2UXB T;  2GK9 A;  5LHI B;  4ANJ A;  2VAS A;  3LK3 B;  5FVK A;  3VR8 A;  5ABH A;  2E8I A;  3EHZ A;  2XQ8 A;  4AFH A;  1OXZ A;  3N9M A;  4UXU A;  2XAQ B;  3UFE A;  2BYN A;  2ACX A;  3KV4 A;  4O4L E;  3PEO A;  2Y56 A;  3S4U A;  3QK6 A;  1IBL T;  2UUA T;  4AIS A;  1WR0 A;  4TNV A;  5KDM C;  4DBM A;  3A5X A;  3B13 A;  1UK5 A;  2HHH T;  1LVK A;  5AQH B;  3P50 A;  1YXR A;  2AE9 A;  2LKH A;  5IWA T;  4HKA A;  3Q5X A;  3K3N A;  3PUR A;  5FL0 A;  2CEA A;  4YSZ A;  4CI3 B;  4UM1 A;  4A5X A;  3T8O A;  3GUA A;  2NOX A;  4AIU A;  2IC9 A;  2V7M A;  2W0G A;  5KX5 E;  2XAF B;  4X1Y E;  3WTJ A;  1MMG A;  4KBM B;  3AAA B;  3QOF A;  3H3A A;  1W0A A;  5FVL A;  3SQ9 A;  3AXJ A;  3LG7 A;  3ZEF B;  3LK4 2;  4JI6 T;  3ZST A;  2HN2 A;  2M6B A;  4UM3 P;  4YT0 A;  2BYS A;  3N5L A;  5JDM A;  3GWH A;  2M6I A;  5M4Y A;  1G8X A;  3VKH A;  1HR0 T;  4EYY R;  3IA3 A;  4AQF C;  5IHY A;  2KWH A;  4IDN A;  5EZY E;  1UX2 A;  1VCS A;  4UXN B;  4QH1 A;  3B5M A;  1YW0 A;  3ZKR A;  4KP3 C;  1IBK T;  4EB6 E;  5ABE A;  4HWF A;  2RP4 A;  4LF7 T;  4G2A A; 
#chains in the Genus database with same CATH homology
 4ZJS A;  3PMZ A;  4WV9 A;  5AFH A;  3U8N A;  3TLS A;  4QAA A;  5L4E A;  2BR8 A;  3WTO A;  2MAW A;  5LXB A;  2BG9 C;  3P50 A;  4ZJT A;  2XQ4 A;  4HFE A;  2ZJV A;  2LKH A;  2Y57 A;  5HEU A;  4BQT A;  2BG9 E;  5HEH A;  3TLT A;  3JAE A;  2VL0 A;  3RI5 A;  5AFJ A;  5AFK A;  2XQ6 A;  4TWF A;  4AFG A;  5AFL A;  2LKG A;  5HEJ A;  2W8F A;  2YME A;  4UM1 A;  4ILC A;  5AFN A;  2XNU A;  3WTI A;  3JAD A;  3GUA A;  2BG9 B;  5TVC A;  5L4H A;  3RHW A;  2XQ5 A;  2BYQ A;  2PGZ A;  2XNT A;  2YKS A;  4Z91 A;  5BP0 A;  2QC1 B;  4QAB A;  5HEO A;  3UU5 A;  3LSV A;  3ZDG A;  3U8M A;  4ILA A;  3UQ4 A;  2WNJ A;  2Y54 A;  3WTJ A;  2WNC A;  4ZZC A;  2WNL A;  3TLW A;  2KSR A;  3U8K A;  4EZ1 A;  2XQA A;  4XHE A;  3SQ9 A;  3UU6 A;  3WTM A;  3SQ6 A;  4ZZB A;  4TWD A;  4Z90 A;  4FRR A;  2BJ0 A;  3JAF A;  4BFQ A;  5J5I A;  4LMK A;  2XYS A;  4HFB A;  2YOE A;  3WTL A;  4X5T A;  3EAM A;  3RIA A;  2XZ6 A;  4QAC A;  2PH9 A;  2XQ3 A;  4A97 A;  2BYP A;  2ZJU A;  3SH1 A;  4HFC A;  4TNW A;  4LML A;  3WIP A;  2XQ9 A;  5FJV A;  5AFM B;  2M6B A;  5J5H A;  1OED A;  2X00 A;  5CO5 A;  2WN9 A;  3U8L A;  5J5F A;  2YN6 A;  3SIO A;  4UM3 P;  3C79 A;  5CFB A;  4ZK4 A;  4IL9 A;  2BYS A;  4NPP A;  4QH5 A;  1UV6 A;  4A98 A;  3RIF A;  3TLU A;  5AIN A;  3RQW A;  5HCM A;  4B5D A;  3U8J A;  5HCJ A;  4D01 A;  2M6I A;  2BYR A;  5BW2 A;  5KZU A;  2X00 D;  4HFD A;  2Y7Y A;  3UU8 A;  5KE4 A;  3IGQ A;  4UY2 A;  2BR7 A;  5J0Z A;  5L47 A;  4HFI A;  3P4W A;  3EHZ A;  2XZ5 A;  3C84 A;  4IRE A;  3ZDH A;  2XQ8 A;  3T4M A;  4AFH A;  5J5G A;  1OED B;  4ZK1 A;  2LM2 A;  3WTH A;  4UXU A;  4HFH A;  5AFM A;  3TLV A;  4ZRU A;  3WTK A;  4ILB A;  3UU4 A;  2BYN A;  4ALX A;  1UX2 A;  4HQP A;  2BG9 A;  2YMD A;  4XK9 A;  4COF A;  2UZ6 A;  2WZY A;  1OED E;  3UU3 A;  2XQ7 A;  3PEO A;  4PIR A;  4UM3 A;  5SYO A;  4QH1 A;  2Y56 A;  5JME A;  5IUX A;  2C9T A;  1I9B A;  4LMJ A;  3UQ7 A;  1OED C;  4TWH A;  3ZKR A;  2W8G A;  4UM3 S;  1UW6 A;  5LG3 A;  4NZB A;  3WTN A;  2XNV A;  4ZR6 A;  4IL4 A;  2LLY A;  5BRX A;  4TNV A;  3EI0 A;  4F8H A;  2Y58 A;  5HEG A;  2XYT A;  4AFT A;  4DBM A;  3RQU A;  4QH4 A;  3UUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...