3TLTA

The glic pentameric ligand-gated ion channel h11'f mutant in a locally-closed conformation (lc1 subtype)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAFIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tltA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tltA01
5AINA 1UW6A 5AFMA 2PH9A 2BG9A 5HEHA 4HFDA 4IL4A 3U8NA 2QC1B 4UM3A 2Y57A 2XQ5A 4QACA 3WTIA 4QH1A 4ZJTA 4TWHA 4TNWA 2LM2A 2X00D 3U8JA 2BR7A 2WNLA 2ZJUA 5LXBA 2W8FA 5L4EA 3WTJA 4XHEA 3SIOA 3JAEA 4B5DA 5IUXA 4ZRUA 3UU4A 2XQ6A 2XZ5A 5JMEA 5AFJA 5J5IA 2XQ3A 2Y7YA 3WTNA 2XNVA 4AFGA 1UX2A 2Y56A 2YMEA 3WTKA 4ZR6A 3RQUA 4BQTA 2XYTA 1OEDB 2XQAA 4LMJA 2WN9A 5J5HA 3WTMA 5HCJA 3U8LA 3WTHA 3PEOA 2YMDA 3IGQA 4UM3S 5BW2A 2M6IA 4FRRA 2MAWA 5AFHA 2BYQA 3RQWA 3UU3A 4QAAA 2WZYA 4WV9A 4XK9A 3EAMA 2BG9C 3TLWA 1I9BA 3PMZA 5AFNA 3P4WA 4COFA 2XQ4A 2WNCA 5AFKA 3ZDHA 4QH5A 2LKGA 2YOEA 3EHZA 3ZKRA 5J0ZA 3UUBA 4Z90A 4ZZBA 3SH1A 1OEDE 3RIAA 4ZZCA 5BP0A 4UXUA 3U8KA 5HCMA 2BYSA 3WTOA 5HEGA 4IREA 5HEOA 3JADA 5HEUA 3UQ4A 3LSVA 5L4HA 4NZBA 2XNTA 2Y54A 4PIRA 2ZJVA 2XZ6A 4ALXA 2WNJA 2XNUA 2XYSA 2X00A 2M6BA 3WIPA 5CO5A 4TWFA 4TWDA 2UZ6A 2KSRA 2XQ8A 3ZDGA 4HFEA 3EI0A 4NPPA 1OEDA 5SYOA 3UU5A 5J5FA 2LLYA 3UU6A 4F8HA 4LMKA 5J5GA 2XQ7A 4A97A 5TVCA 3WTLA 5AFMB 2LKHA 4QH4A 3C84A 4ZK4A 4QABA 2BG9B 5FJVA 2YKSA 2BYRA 4UM3P 4ILCA 4ILAA 3TLUA 3SQ9A 3UU8A 5L47A 2BYNA 5HEJA 3RI5A 2XQ9A 2VL0A 3RIFA 3TLSA 5CFBA 2BJ0A 3C79A 4DBMA 2C9TA 3TLTA 3UQ7A 3P50A 3SQ6A 4UY2A 4X5TA 4Z91A 5LG3A 3U8MA 5AFLA 4HFHA 4ILBA 4UM1A 4LMLA 5KE4A 4HQPA 3RHWA 4HFCA 3T4MA 4ZK1A 1UV6A 3JAFA 2BG9E 4IL9A 4ZJSA 5BRXA 4EZ1A 2W8GA 2YN6A 4D01A 4HFBA 4A98A 4BFQA 4AFTA 2BYPA 2PGZA 4AFHA 3TLVA 5KZUA 4HFIA 2Y58A 3GUAA 1OEDC 4TNVA 2BR8A
chains in the Genus database with same CATH superfamily
2UXBT 5AFMA 4H63V 3HKDE 2ES0A 4H9RC 4IE4A 2W2UA 3U78A 3AE5A 4I55E 3AB3B 3PU3A 3SIOA 2E5LT 1X79A 5L3EB 1M62A 3AE7A 1OEDB 4H9QC 2YMDA 1SE7A 2MAWA 1IJ5A 4Z8XA 2YU1A 5AQRB 4TUYE 2WU5A 2ZM0A 4H63H 2LKGA 1D0XA 5EK3A 2OA5A 4ZHQE 4YT0A 3RIAA 4ZZCA 4E7ZA 4BA9A 4DUZT 2QVAA 1N36T 4PIRA 5AQKB 1XDOA 1VCSA 3AAAB 1W0AA 3OYZA 2XASB 1LKXA 2IC6A 4JEHB 4PK4A 4ILCA 4AKGA 2W62A 3RIFA 4O4IE 3PJAA 2VL8A 4HGAA 4UM1A 3AXJB 4L9IA 4DR4T 4HFCA 1KF6A 2YN6A 3CQGB 4ISTA 2X0YA 3GUAA 1OEDC 2W61A 2V7KA 3GWHA 2M67A 5IYZE 4YJ3E 1Y64B 2WU2A 2D0TA 4HFDA 2XQYA 2NOXA 2NWBA 3ZLIA 2FJAA 3JC6D 4QH1A 4TWHA 1IZNB 2X67A 3VR8A 2RA1A 2BS4A 2V7MA 4UVBB 4DBQA 3PURA 3RRWA 2UUBT 4HWCA 4WBOA 5LMNT 1T8BA 3RYCE 2XNVA 4UV9B 3RKGA 1YQ4A 1G8XA 4LMJA 1LVFA 3A8YC 3KVBA 3PMZA 5AQOB 1N34T 4AQYT 2PBIA 3C98B 4QH5A 3B5MA 3MK7C 4HWHA 4U33A 5JR9B 5J0ZA 2E9XD 4U2ZA 4JI7T 3N2KE 3CMLA 3PU8A 3NRYA 5LP6E 2VKJA 5L4HA 3SWHA 3I1AA 2X00A 3TKLB 5HWXA 3LBXB 1QLBA 1HCIA 2CLYB 5FYMA 2CE7A 3HKBE 3UFGA 4EB6E 3ANWB 1UUSA 3AE3A 2H89A 1Z0PA 4O4JE 1OWAA 5JVDE 3CX7B 2K5BB 5HXRA 3O4XE 4EZ1A 2XUEA 4F6RC 4DNDA 4AFHA 3TLVA 4WNKA 2K24A 3CX6B 1HX8A 3FB2A 3FXDB 2WS3A 3K3NA 5AQHB 4AKIA 4UM3A 2Y57A 5JR9C 2L9QA 3AVSA 3G06A 1IJ6A 4XHEA 3GN5A 5FNVE 4B5DA 3MJXA 3MACA 4DV4T 1MNEA 5KX5E 3WTKA 4ZR6A 3WAKA 2WZHA 4I50E 3WTHA 4UM3S 4UR9A 5L3CB 4GK0E 2CLYC 4ASKA 1XZYA 3Q5DA 5JDFA 2H88A 4COFA 1HS7A 2V7IA 3EHZA 3ZKRA 3ONXA 3NVOA 4CXYA 3U8KA 2DL1A 3UQ4A 5JDNA 3A7MA 2Y54A 3P4SA 3PUZF 5AQIB 3UU5A 5J5FA 1CHUA 4IE0A 4B6XA 5CA1E 2DLRA 3X1DA 5C8YE 4UF0B 2MBGA 5DJQC 2VQET 5FP3A 3RLFF 4JI2T 2CXLA 5CFBA 4QX8B 4YXDA 3MA9A 5EK2A 5C2TA 2YDRA 2X66A 1KNRA 2V5DA 1ZKEA 4D01A 4A98A 5HXCA 4AKHA 1QUUA 3GMIA 4FJOA 4JI3T 5JREA 2IW5B 5AQMB 2JMHA 4CQIA 3ETVA 1YD8G 3RC3A 4GKKT 1GQEA 2X00D 4H9NC 3I0QA 5ADXL 2UXNB 2WQYA 5JMEA 3SFDA 5BR8T 3NKZA 1B7TA 1FIOA 1HR0T 5HCJA 2HHHT 4TV9E 2NTYA 2X51A 3PE0A 4JI4T 2XTLA 3RQWA 3RYHE 5ABFB 4ERRA 4YSYA 3P4WA 5L2LA 1FMWA 4G63A 5AQUB 4X66T 3OPCA 2Q9QD 4DV7T 2B76A 3HL6A 2PFVA 3RKOA 3SH1A 4LF5T 2BYSA 3AVRA 4YTPA 3VU7H 4ZS3A 4C91A 4AIUA 3AEBA 2LLYA 3HKEE 2B1EA 3N9PA 4UELA 5EK4A 2ODUA 3ZCJA 1S35A 2LE8A 4ADZA 2KLQA 3F57A 2C9TA 1WLXA 2I0MA 4Z91A 4LMLA 4DIDB 3T4MA 2IAKA 4ZJSA 2P9BA 3OJAA 2XAJB 1BR2A 2JQQA 3CKDA 4HWFA 5HXHA 5LHIB 3RX6A 4X1YE 3PUXF 3U8NA 3EABA 5ABEA 1FJGT 5HWYA 1WYBA 4U74A 3AEFA 2LM9A 2FUPA 3WI3A 3VRAA 1MNDA 2LHRA 4L0RA 4QX7B 3RQUA 2N1GA 3RH3A 4B3ST 5J5HA 3HR0A 1O3XA 3ZJ1A 3CK6A 1MMNA 4O4LE 4X65T 1HG2A 2K3WA 4YHJA 3LK3B 3BQKA 2K48A 2ZLYA 3J9X1 1HTJF 2N9DA 3FZKB 2Y48B 1XNRT 3JADA 4X64T 3IEEA 3MZKB 4H9SE 4K0KT 2WP9A 1VOMA 1SA0E 4X1KE 2XY8B 4OFZA 4IGUA 3UT5E 3UUNA 5JRCB 3OVUA 3N2OA 5TVCA 5AFMB 2CWYA 3B13A 4PAGA 2YKSA 2BYRA 5LJNA 4UM3P 2BYNA 2BJ0A 3C79A 3BQIA 2WCAA 4AKRB 5AQSB 3KV4A 4KHPT 4IDOA 1HNXT 4XBFB 4ZK1A 2Z6EA 3IBPA 4GYRA 4E7SA 5JDGA 4YFSA 2J62A 3P8CD 3CIRA 2WSSV 1T7SA 4NXNT 4DR5T 5AQLB 2D2SA 5AQQB 2L8KA 3N9QA 5HEHA 2JMKA 1I6ZA 3BK9A 4CN1A 4WW0A 3KFWX 3E08A 2EHOC 2E9XA 5IUXA 3D0TA 5FXXA 2XZ5A 5AFJA 3O1IA 5J2UE 3CX8B 3ZJ2A 1SUMB 4MBQA 3OTOT 3WAJA 2IIUA 4BQTA 2XQAA 5AQTB 2AE9A 3U8LA 2YINA 4FRRA 2XZEA 2V1DB 4ZI2D 4QHOA 3F31A 2HN2A 2V8SV 2FBWA 3V5UA 3L39A 3ZSTA 4IREA 4HWDA 4WZXA 3P4RA 1XMOT 2WNJA 2X9XA 3EI0A 3UU6A 4DV0T 4A97A 5H6RB 2YEVC 5C3JA 4GKJT 5CGMA 3UU8A 3CQXC 1NEKA 2IUBA 2XQ9A 2HH7A 1YKHB 4IE7A 4AQFC 3PUQA 4EAHA 5LG3A 4LF4T 4AI6A 1LVKA 3UUXB 3FBLA 2BG9E 4UIGA 3PUSA 4IE5A 5CJ5A 2PGZA 2JJ9A 4HFIA 5FL0A 3ONJA 2XAHB 3L8RA 3WIPA 3UUMA 4B3RT 2X68A 2VVSA 2YU2A 2CA5A 3ZPOA 1W0BA 2Y8DA 2L3LA 1ZEEA 4ZI3C 3LJCA 3U8JA 3ZMZB 3PUAA 4U72A 2ZJUA 4LF8T 5L4EA 4TV8E 1J5ET 2SPCA 1EZ3A 5HXEA 3R84B 2UXDT 3K8PC 2LT3A 4YTMA 5AFHA 3AEDA 4XAXB 4JLEA 4CI2B 5AFNA 2BKPA 2WNCA 4QXBB 4CI3B 3T1YT 3ZDHA 2CRBA 2DCFA 4JI1T 5LG4A 1UK5A 5HEOA 5BMVE 5KXJA 4DV6T 4P0BA 5DQVA 3Q5EA 4TWDA 1IAPA 3LK2B 3KBUA 1KNZA 3N9MA 4QABA 3HA4A 1NENA 1WFDA 5L3BB 2KZ7B 1HNWT 2PTFA 1U4QA 4CXWA 2I59A 3GN5B 2JQKA 2V7JA 4NXMT 5KDMC 4PNIA 2QGSA 3ZYMA 4MFRA 2BBJA 3FHNA 5BRXA 2VASA 3FZMB 3V5SA 2XHEB 1CUNA 2BYPA 1MIWA 4ZI7E 5DQWA 3N2GE 3AE8A 1J5WA 5JQGE 2A9UA 4CI1B 2BG9A 4AXPA 1N32T 2E2AA 3IHRA 5F3JA 2G0UA 4IDNA 1D1BA 4TNWA 3ZMVB 5M4YA 1FEWA 2WNLA 4JYAT 2LSIA 2Q9QA 2WDRA 4JV5T 3WTNA 4PJJA 2NR4A 4LFBT 2E8IA 4EOZB 2JQ9A 5FVKA 4ILUA 3LK42 3IGQA 3ETUA 4DR7T 2X9YA 4TX5A 4LFCT 1I9BA 2DHRA 5AFKA 4YTNA 4JI0T 3J7Yq 4JI6T 3P4QA 5HEGA 2C0SA 3LSVA 2ZM8A 3ZT5A 2XNTA 2XYSA 3H3MA 3FZLB 3CVRA 4EYYR 2WZIA 2RPAA 3QK6A 2CHNA 3C84A 4WBNE 4ILAA 1SHZC 5LGTB 4HKAA 3ESLA 3P50A 4UY2A 3AA6B 4MLKA 5AFLA 1LRZA 4KBMB 3ZSSA 2DI4A 4HN9A 3KV5A 5JDQA 2V6YA 1E7PA 4JUYA 3Q5XA 4DR6T 2NW8A 2X9WA 2FJBA 5JTGA 2ZM6T 1KEYA 3A5XA 2PH9A 3OYXA 3QUJA 1XNQT 1MMDA 5ETWA 3C4WA 3L09A 5L3DB 2ACXA 2UU9T 3JAEA 4IHJE 5ABGA 4ZRUA 2XQ6A 1QSDA 1XWMA 4XZCA 2F4VT 4NUUA 3RRCA 1U5PA 4OHFA 3AE6A 4CZZB 3N9LA 5JH7E 4ZEYA 5CB4E 3TLWA 2XSAA 4ZOLE 2MTQA 2X0LB 3R6NA 4ISSA 3FBZA 3RC8A 2ACZA 2CBJA 3QNUA 5AQPB 3VR9A 4NZBA 1JNRA 2XZ6A 1E1HB 3RYIE 3ZDGA 1X9BA 5EZYE 1YXRA 3K3QC 3CWZB 2X9HA 3SQ9A 3FZHB 4DUYT 3TLSA 3UQ7A 4OK0A 4UF0A 3U8MA 4ZXLA 2I6HA 3UFEA 5FY7A 5FXVA 4AFTA 3CPZA 3FXEB 5AINA 3K1SA 4HTEA 2WDVA 2QC1B 4DV2T 2KXPB 2MYSA 2CWOA 2W63A 3AE4A 1US7B 2JIWA 2K9AA 4N78D 1XMQT 3T1HT 3VKGA 5FMNA 5FY1A 1WR0A 2XM2A 2CEAA 4KHZF 3PUWF 1UX5A 2YDQA 2M6IA 4K0UA 2BYQA 4EZ4A 4PJMA 4QAAA 4WV9A 4XK9A 2ZM2A 2D9DA 5ABFA 1BR4A 4Z90A 3KBTA 3PDYA 1MMGA 2NW7A 3ABVA 2CM0A 3MKDA 4O4HE 1VRBA 4B3MT 2GK9A 4ALXA 1UGOA 5J1GA 4GK5E 4HFEA 1WRDA 3DTOA 4F8HA 3NRXA 5LBQB 4KMCA 3QC9A 1J1JA 4U7YA 5L47A 4P0AA 2H3RA 4AQGA 3TLTA 3SQ6A 5F5WA 3AAIA 2E9XB 5CA0E 1UV6A 2JQHA 4J2CA 1IBKT 1HF8A 3AEAA 4BFQA 3ZYLA 5IWAT 5KMGP 2CXDA 3ZN0B 3KV6A 1MIVA 3O1HA 4TNVA 5LMUT 1UW6A 2VKOA 4I0UA 5FVLA 4EEBA 5LB7B 4DV1T 3PTRB 3E22E 2WWVA 3JC6C 3O1JA 3GA8A 2XM1A 4DO0A 1XDPA 3AAEB 4KP3C 2VVNA 4OX9T 2YMEA 1IBLT 1L0VA 2BVLA 4LF7T 3WTMA 5JDLA 4G2AA 5BW2A 1AJ3A 3AEEA 1HNZT 3RIUC 4KI0F 4H9OC 2XQ4A 3UULA 1OEDE 4GIWA 1KFYA 5TAOA 3W15B 2W66A 3EDVA 5JDMA 1YW0A 2E9XC 2EHOA 2LRKA 2VWAA 4DR1T 2X0HA 4CN6A 2KSRA 4JBWF 4NPPA 1HX1B 4YJ2E 3F2EA 2J47A 3VRBA 2BDEA 2LOSA 4IDQA 3RF1A 2UUCT 3OKQA 2CMRA 4ANJA 5HEJA 2VL0A 4BJNA 2H7VC 3AA1B 3AEGA 4X5TA 2OLTA 2KWHA 4HQPA 3RHWA 3T8OA 4M1PA 5LBMA 3HI2A 2WB5A 4IL9A 4DMWA 2CXFA 4L5GA 4BJMA 2BS2A 2XJ7A 1NWMX 1MIYA 4LF9T 4U7IA 2IDOB 2WM9A 3ZT7A 3M3ZB 5ABHA 2KT9A 5HAXA 5LJMA 2XQ5A 1T72A 4PFOA 2MOZA 3ZMUB 3WTJA 4TZ4C 4AQFA 2MPKA 2PG8A 5LCYA 2WY2A 2XQ3A 2CBIA 3L3PA 4YSXA 2V26A 3U3IA 4QKNA 3Q5WA 4I4TE 2D0UA 3EAMA 4NIQA 5LYJE 2UXCT 4EIWA 2YK0A 4EEDA 4QXHB 4ZZBA 4YSZA 4P09A 4DR2T 5BP0A 4AISA 2C5IT 1WCRA 3H3AA 2M6BA 2DWGA 2XQ8A 1D0YA 1OEDA 2RP4A 2C5KT 2NP9A 1FMVA 3WTLA 1WR6A 3E0ZA 2BG9B 3ZMTB 4PK6A 2WMNA 4TN7B 2WWUA 3O9XA 2HN1A 3IF8B 5E0OA 2Q9QB 5FXZA 4O2AE 2Y6XA 3JAFA 1N33T 4QXCB 5HYAA 3NZPA 1HFAA 1M7KA 1D1AA 1D0ZA 3VHLA 5AQJB 2A72A 2FJDA 5LA6E 2NTXA 1V9DA 3OBVE 3P4PA 2EHOD 2LM2A 4KUMB 4JEUB 2W4XA 2R6GF 2XSBA 3PUGA 3SFEA 2BKNA 1WYCA 3AXJA 1E2AA 2UUAT 2DWKA 1Z8UA 4AFGA 1UX2A 4YHHT 2JRKA 4DV3T 2XYTA 2VKHA 2LSJA 1YQ3A 3AE9A 4O8SA 2LJLA 1IBMT 3Q2MA 1ZP0A 2LHNA 1ZHCA 2BG9C 2J4GA 4BAYB 2PJQA 2BBHA 2YOEA 3NWIA 3I9WA 3KINB 3FZFB 2LSYA 3NBXX 3KVAA 3SOLA 4UXUA 2HPLA 4HFVA 2Q9QC 1OXZA 2ZJVA 2V6YB 3C51A 3QB5A 2XNUA 4TWFA 1MMAA 5SYOA 2XQ7A 1G73A 4ZK4A 5LHGB 5FJVA 2A3DA 4ZS2A 4AKLA 4JI5T 3LFMA 3N9OA 5LHHB 3HKCE 4DBMA 5JR9A 2KNDA 3SS1A 4HFHA 4ILBA 5AQFB 1W09A 4YY3T 4PJNA 2WDQA 2LRLA 4DV5T 2VK9A 2CPTA 3LBXA 4YLHA 3NZQA 5LGUB 2XPKA 4UVCB 4DBRA 4JI8T 3RYFE 4ZI3D 4IL4A 1BR0A 4CN4A 1W9RA 2LOPA 2HPJA 4ZJTA 5FY0A 3ANWA 2E5VA 2C5JA 5L3GB 3ZYKA 5J5IA 3AE2A 5AFUL 2Y7YA 2BKOA 2KWIB 2KMFA 2Y56A 5GONE 3C4ZA 1KNPA 4U3CA 1H7CA 4PFPA 3CQCB 5FKYA 5LOVE 4I43B 4KX6A 2YDSA 4C90A 2AXDS 2UXXB 3UUBA 3P7IA 3DP7A 3I0OA 3AECA 5F8PA 3ONLC 2IHR1 2VKDA 3ZN1B 2XAQB 4U31A 2VQFT 5CO5A 3S4UA 4OYKA 4X20E 4LMKA 5J5GA 2A2FX 3AE1A 3TLUA 1KK7A 2IMLA 4PK5A 2BZBA 1Y01A 1YKEB 2NW9A 2CHOA 5A1LA 2VB6A 2QA7A 2IC9A 3PUVF 5KE4A 2LSKA 3QOFA 2DNXA 4HE8A 2JPFA 4HWIB 2H7OA 3QB5K 2W8GA 2BVMA 4OYJA 1HG5A 3IA3A 4UEMA 3SRZA 3KV9A 3N5LA 5FXWA 3WTIA 1UCUA 3UTKA 4EXTA 2QYWA 3ZMSB 4GYSA 5LXBA 2W8FA 4FI5A 4EGWA 3ZEFB 4IDZA 4EZHA 3UU4A 4IIJE 4A5XA 5FL1A 1T98A 4GOUA 3LG7A 3PEOA 2ZMAA 1ZOYA 5HXSA 2WZYA 3ZT6A 4U2YA 3B57A 1JNZA 4ZI2C 4EV6A 3KDSE 2KINB 3LDQB 4V1Av 2CCQA 2W00A 5HEUA 4B3TT 4H9PC 1UURA 5LXTE 3EUHA 3M65A 2UZ6A 4MALA 2LEHA 4PW8A 2LKHA 2LSGA 4QH4A 4IT4A 2VURA 3BQLA 3H37A 4EYUA 2V7LA 3VKHA 4DR3T 3JCFA 2V5CA 3Q9DA 5JDHA 3I9YA 4LF6T 5DABA 3EDUA 4LFAT 1UX4A 2WAUA 4X1IE 1DU2A 5LGNB 4UVAB 4A56A 1S94A 5KZUA 2Y58A 3AA0B 3DJBA 4IDPA 2XAFB 5J2TE 1D1CA 3C4XA 4QACA 4UV8B 2BS3A 5AQVB 1VCTA 2BR7A 4DVDA 3RPUA 4QWNB 2W67A 3C64A 4O2BE 3PV0F 2WBLA 3AA7B 2EHOB 1ZV4X 4NUVA 4PJLA 3ZC1A 2XAGB 3MXZA 5H6QB 2WN9A 2N2NA 3ZCIA 3UU3A 2D5UA 3EVYA 5AQGB 1BR1A 1R8IA 5L3FB 2V6XA 2OV9A 3K3OA 3PJAJ 1I94T 5HCMA 3WTOA 4DMVA 2J1DG 2WMOA 3ZC0A 2ODVA 3RGLA 4P1NA 5IHYA 4CXXA 4WYVA 4MHCA 2W0GA 3C50A 3PUYF 5LNKA 3RIUA 5AQNB 3RI5A 1NAFA 4IE6A 4X62T 2FJEA 4HEAA 4UXNB 4Q25A 3N9NA 2QRXA 4HFBA 2BR8A 5JRCA
chains in the Genus database with same CATH topology
5AINA 1UW6A 5AFMA 2PH9A 2BG9A 5HEHA 4HFDA 4IL4A 3U8NA 2QC1B 4UM3A 2Y57A 2XQ5A 4QACA 3WTIA 4QH1A 4ZJTA 4TWHA 4TNWA 2LM2A 2X00D 3U8JA 2BR7A 2WNLA 2ZJUA 5LXBA 2W8FA 5L4EA 3WTJA 4XHEA 3SIOA 3JAEA 4B5DA 5IUXA 4ZRUA 3UU4A 2XQ6A 2XZ5A 5JMEA 5AFJA 5J5IA 2XQ3A 2Y7YA 3WTNA 2XNVA 4AFGA 1UX2A 2Y56A 2YMEA 3WTKA 4ZR6A 3RQUA 4BQTA 2XYTA 1OEDB 2XQAA 4LMJA 2WN9A 5J5HA 3WTMA 5HCJA 3U8LA 3WTHA 3PEOA 2YMDA 3IGQA 4UM3S 5BW2A 2M6IA 4FRRA 2MAWA 5AFHA 2BYQA 3RQWA 3UU3A 4QAAA 2WZYA 4WV9A 4XK9A 3EAMA 2BG9C 3TLWA 1I9BA 3PMZA 5AFNA 3P4WA 4COFA 2XQ4A 2WNCA 5AFKA 3ZDHA 4QH5A 2LKGA 2YOEA 3EHZA 3ZKRA 5J0ZA 3UUBA 4Z90A 4ZZBA 3SH1A 1OEDE 3RIAA 4ZZCA 5BP0A 4UXUA 3U8KA 5HCMA 2BYSA 3WTOA 5HEGA 4IREA 5HEOA 3JADA 5HEUA 3UQ4A 3LSVA 5L4HA 4NZBA 2XNTA 2Y54A 4PIRA 2ZJVA 2XZ6A 4ALXA 2WNJA 2XNUA 2XYSA 2X00A 2M6BA 3WIPA 5CO5A 4TWFA 4TWDA 2UZ6A 2KSRA 2XQ8A 3ZDGA 4HFEA 3EI0A 4NPPA 1OEDA 5SYOA 3UU5A 5J5FA 2LLYA 3UU6A 4F8HA 4LMKA 5J5GA 2XQ7A 4A97A 5TVCA 3WTLA 5AFMB 2LKHA 4QH4A 3C84A 4ZK4A 4QABA 2BG9B 5FJVA 2YKSA 2BYRA 4UM3P 4ILCA 4ILAA 3TLUA 3SQ9A 3UU8A 5L47A 2BYNA 5HEJA 3RI5A 2XQ9A 2VL0A 3RIFA 3TLSA 5CFBA 2BJ0A 3C79A 4DBMA 2C9TA 3TLTA 3UQ7A 3P50A 3SQ6A 4UY2A 4X5TA 4Z91A 5LG3A 3U8MA 5AFLA 4HFHA 4ILBA 4UM1A 4LMLA 5KE4A 4HQPA 3RHWA 4HFCA 3T4MA 4ZK1A 1UV6A 3JAFA 2BG9E 4IL9A 4ZJSA 5BRXA 4EZ1A 2W8GA 2YN6A 4D01A 4HFBA 4A98A 4BFQA 4AFTA 2BYPA 2PGZA 4AFHA 3TLVA 5KZUA 4HFIA 2Y58A 3GUAA 1OEDC 4TNVA 2BR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIN A;  1UW6 A;  5AFM A;  2PH9 A;  2BG9 A;  5HEH A;  4HFD A;  4IL4 A;  3U8N A;  2QC1 B;  4UM3 A;  2Y57 A;  2XQ5 A;  4QAC A;  3WTI A;  4QH1 A;  4ZJT A;  4TWH A;  4TNW A;  2LM2 A;  2X00 D;  3U8J A;  2BR7 A;  2WNL A;  2ZJU A;  5LXB A;  2W8F A;  5L4E A;  3WTJ A;  4XHE A;  3SIO A;  3JAE A;  4B5D A;  5IUX A;  4ZRU A;  3UU4 A;  2XQ6 A;  2XZ5 A;  5JME A;  5AFJ A;  5J5I A;  2XQ3 A;  2Y7Y A;  3WTN A;  2XNV A;  4AFG A;  1UX2 A;  2Y56 A;  2YME A;  3WTK A;  4ZR6 A;  3RQU A;  4BQT A;  2XYT A;  1OED B;  2XQA A;  4LMJ A;  2WN9 A;  5J5H A;  3WTM A;  5HCJ A;  3U8L A;  3WTH A;  3PEO A;  2YMD A;  3IGQ A;  4UM3 S;  5BW2 A;  2M6I A;  4FRR A;  2MAW A;  5AFH A;  2BYQ A;  3RQW A;  3UU3 A;  4QAA A;  2WZY A;  4WV9 A;  4XK9 A;  3EAM A;  2BG9 C;  3TLW A;  1I9B A;  3PMZ A;  5AFN A;  3P4W A;  4COF A;  2XQ4 A;  2WNC A;  5AFK A;  3ZDH A;  4QH5 A;  2LKG A;  2YOE A;  3EHZ A;  3ZKR A;  5J0Z A;  3UUB A;  4Z90 A;  4ZZB A;  3SH1 A;  1OED E;  3RIA A;  4ZZC A;  5BP0 A;  4UXU A;  3U8K A;  5HCM A;  2BYS A;  3WTO A;  5HEG A;  4IRE A;  5HEO A;  3JAD A;  5HEU A;  3UQ4 A;  3LSV A;  5L4H A;  4NZB A;  2XNT A;  2Y54 A;  4PIR A;  2ZJV A;  2XZ6 A;  4ALX A;  2WNJ A;  2XNU A;  2XYS A;  2X00 A;  2M6B A;  3WIP A;  5CO5 A;  4TWF A;  4TWD A;  2UZ6 A;  2KSR A;  2XQ8 A;  3ZDG A;  4HFE A;  3EI0 A;  4NPP A;  1OED A;  5SYO A;  3UU5 A;  5J5F A;  2LLY A;  3UU6 A;  4F8H A;  4LMK A;  5J5G A;  2XQ7 A;  4A97 A;  5TVC A;  3WTL A;  5AFM B;  2LKH A;  4QH4 A;  3C84 A;  4ZK4 A;  4QAB A;  2BG9 B;  5FJV A;  2YKS A;  2BYR A;  4UM3 P;  4ILC A;  4ILA A;  3TLU A;  3SQ9 A;  3UU8 A;  5L47 A;  2BYN A;  5HEJ A;  3RI5 A;  2XQ9 A;  2VL0 A;  3RIF A;  3TLS A;  5CFB A;  2BJ0 A;  3C79 A;  4DBM A;  2C9T A;  3TLT A;  3UQ7 A;  3P50 A;  3SQ6 A;  4UY2 A;  4X5T A;  4Z91 A;  5LG3 A;  3U8M A;  5AFL A;  4HFH A;  4ILB A;  4UM1 A;  4LML A;  5KE4 A;  4HQP A;  3RHW A;  4HFC A;  3T4M A;  4ZK1 A;  1UV6 A;  3JAF A;  2BG9 E;  4IL9 A;  4ZJS A;  5BRX A;  4EZ1 A;  2W8G A;  2YN6 A;  4D01 A;  4HFB A;  4A98 A;  4BFQ A;  4AFT A;  2BYP A;  2PGZ A;  4AFH A;  3TLV A;  5KZU A;  4HFI A;  2Y58 A;  3GUA A;  1OED C;  4TNV A;  2BR8 A; 
#chains in the Genus database with same CATH topology
 2UXB T;  5AFM A;  4H63 V;  3HKD E;  2ES0 A;  4H9R C;  4IE4 A;  2W2U A;  3U78 A;  3AE5 A;  4I55 E;  3AB3 B;  3PU3 A;  3SIO A;  2E5L T;  1X79 A;  5L3E B;  1M62 A;  3AE7 A;  1OED B;  4H9Q C;  2YMD A;  1SE7 A;  2MAW A;  1IJ5 A;  4Z8X A;  2YU1 A;  5AQR B;  4TUY E;  2WU5 A;  2ZM0 A;  4H63 H;  2LKG A;  1D0X A;  5EK3 A;  2OA5 A;  4ZHQ E;  4YT0 A;  3RIA A;  4ZZC A;  4E7Z A;  4BA9 A;  4DUZ T;  2QVA A;  1N36 T;  4PIR A;  5AQK B;  1XDO A;  1VCS A;  3AAA B;  1W0A A;  3OYZ A;  2XAS B;  1LKX A;  2IC6 A;  4JEH B;  4PK4 A;  4ILC A;  4AKG A;  2W62 A;  3RIF A;  4O4I E;  3PJA A;  2VL8 A;  4HGA A;  4UM1 A;  3AXJ B;  4L9I A;  4DR4 T;  4HFC A;  1KF6 A;  2YN6 A;  3CQG B;  4IST A;  2X0Y A;  3GUA A;  1OED C;  2W61 A;  2V7K A;  3GWH A;  2M67 A;  5IYZ E;  4YJ3 E;  1Y64 B;  2WU2 A;  2D0T A;  4HFD A;  2XQY A;  2NOX A;  2NWB A;  3ZLI A;  2FJA A;  3JC6 D;  4QH1 A;  4TWH A;  1IZN B;  2X67 A;  3VR8 A;  2RA1 A;  2BS4 A;  2V7M A;  4UVB B;  4DBQ A;  3PUR A;  3RRW A;  2UUB T;  4HWC A;  4WBO A;  5LMN T;  1T8B A;  3RYC E;  2XNV A;  4UV9 B;  3RKG A;  1YQ4 A;  1G8X A;  4LMJ A;  1LVF A;  3A8Y C;  3KVB A;  3PMZ A;  5AQO B;  1N34 T;  4AQY T;  2PBI A;  3C98 B;  4QH5 A;  3B5M A;  3MK7 C;  4HWH A;  4U33 A;  5JR9 B;  5J0Z A;  2E9X D;  4U2Z A;  4JI7 T;  3N2K E;  3CML A;  3PU8 A;  3NRY A;  5LP6 E;  2VKJ A;  5L4H A;  3SWH A;  3I1A A;  2X00 A;  3TKL B;  5HWX A;  3LBX B;  1QLB A;  1HCI A;  2CLY B;  5FYM A;  2CE7 A;  3HKB E;  3UFG A;  4EB6 E;  3ANW B;  1UUS A;  3AE3 A;  2H89 A;  1Z0P A;  4O4J E;  1OWA A;  5JVD E;  3CX7 B;  2K5B B;  5HXR A;  3O4X E;  4EZ1 A;  2XUE A;  4F6R C;  4DND A;  4AFH A;  3TLV A;  4WNK A;  2K24 A;  3CX6 B;  1HX8 A;  3FB2 A;  3FXD B;  2WS3 A;  3K3N A;  5AQH B;  4AKI A;  4UM3 A;  2Y57 A;  5JR9 C;  2L9Q A;  3AVS A;  3G06 A;  1IJ6 A;  4XHE A;  3GN5 A;  5FNV E;  4B5D A;  3MJX A;  3MAC A;  4DV4 T;  1MNE A;  5KX5 E;  3WTK A;  4ZR6 A;  3WAK A;  2WZH A;  4I50 E;  3WTH A;  4UM3 S;  4UR9 A;  5L3C B;  4GK0 E;  2CLY C;  4ASK A;  1XZY A;  3Q5D A;  5JDF A;  2H88 A;  4COF A;  1HS7 A;  2V7I A;  3EHZ A;  3ZKR A;  3ONX A;  3NVO A;  4CXY A;  3U8K A;  2DL1 A;  3UQ4 A;  5JDN A;  3A7M A;  2Y54 A;  3P4S A;  3PUZ F;  5AQI B;  3UU5 A;  5J5F A;  1CHU A;  4IE0 A;  4B6X A;  5CA1 E;  2DLR A;  3X1D A;  5C8Y E;  4UF0 B;  2MBG A;  5DJQ C;  2VQE T;  5FP3 A;  3RLF F;  4JI2 T;  2CXL A;  5CFB A;  4QX8 B;  4YXD A;  3MA9 A;  5EK2 A;  5C2T A;  2YDR A;  2X66 A;  1KNR A;  2V5D A;  1ZKE A;  4D01 A;  4A98 A;  5HXC A;  4AKH A;  1QUU A;  3GMI A;  4FJO A;  4JI3 T;  5JRE A;  2IW5 B;  5AQM B;  2JMH A;  4CQI A;  3ETV A;  1YD8 G;  3RC3 A;  4GKK T;  1GQE A;  2X00 D;  4H9N C;  3I0Q A;  5ADX L;  2UXN B;  2WQY A;  5JME A;  3SFD A;  5BR8 T;  3NKZ A;  1B7T A;  1FIO A;  1HR0 T;  5HCJ A;  2HHH T;  4TV9 E;  2NTY A;  2X51 A;  3PE0 A;  4JI4 T;  2XTL A;  3RQW A;  3RYH E;  5ABF B;  4ERR A;  4YSY A;  3P4W A;  5L2L A;  1FMW A;  4G63 A;  5AQU B;  4X66 T;  3OPC A;  2Q9Q D;  4DV7 T;  2B76 A;  3HL6 A;  2PFV A;  3RKO A;  3SH1 A;  4LF5 T;  2BYS A;  3AVR A;  4YTP A;  3VU7 H;  4ZS3 A;  4C91 A;  4AIU A;  3AEB A;  2LLY A;  3HKE E;  2B1E A;  3N9P A;  4UEL A;  5EK4 A;  2ODU A;  3ZCJ A;  1S35 A;  2LE8 A;  4ADZ A;  2KLQ A;  3F57 A;  2C9T A;  1WLX A;  2I0M A;  4Z91 A;  4LML A;  4DID B;  3T4M A;  2IAK A;  4ZJS A;  2P9B A;  3OJA A;  2XAJ B;  1BR2 A;  2JQQ A;  3CKD A;  4HWF A;  5HXH A;  5LHI B;  3RX6 A;  4X1Y E;  3PUX F;  3U8N A;  3EAB A;  5ABE A;  1FJG T;  5HWY A;  1WYB A;  4U74 A;  3AEF A;  2LM9 A;  2FUP A;  3WI3 A;  3VRA A;  1MND A;  2LHR A;  4L0R A;  4QX7 B;  3RQU A;  2N1G A;  3RH3 A;  4B3S T;  5J5H A;  3HR0 A;  1O3X A;  3ZJ1 A;  3CK6 A;  1MMN A;  4O4L E;  4X65 T;  1HG2 A;  2K3W A;  4YHJ A;  3LK3 B;  3BQK A;  2K48 A;  2ZLY A;  3J9X 1;  1HTJ F;  2N9D A;  3FZK B;  2Y48 B;  1XNR T;  3JAD A;  4X64 T;  3IEE A;  3MZK B;  4H9S E;  4K0K T;  2WP9 A;  1VOM A;  1SA0 E;  4X1K E;  2XY8 B;  4OFZ A;  4IGU A;  3UT5 E;  3UUN A;  5JRC B;  3OVU A;  3N2O A;  5TVC A;  5AFM B;  2CWY A;  3B13 A;  4PAG A;  2YKS A;  2BYR A;  5LJN A;  4UM3 P;  2BYN A;  2BJ0 A;  3C79 A;  3BQI A;  2WCA A;  4AKR B;  5AQS B;  3KV4 A;  4KHP T;  4IDO A;  1HNX T;  4XBF B;  4ZK1 A;  2Z6E A;  3IBP A;  4GYR A;  4E7S A;  5JDG A;  4YFS A;  2J62 A;  3P8C D;  3CIR A;  2WSS V;  1T7S A;  4NXN T;  4DR5 T;  5AQL B;  2D2S A;  5AQQ B;  2L8K A;  3N9Q A;  5HEH A;  2JMK A;  1I6Z A;  3BK9 A;  4CN1 A;  4WW0 A;  3KFW X;  3E08 A;  2EHO C;  2E9X A;  5IUX A;  3D0T A;  5FXX A;  2XZ5 A;  5AFJ A;  3O1I A;  5J2U E;  3CX8 B;  3ZJ2 A;  1SUM B;  4MBQ A;  3OTO T;  3WAJ A;  2IIU A;  4BQT A;  2XQA A;  5AQT B;  2AE9 A;  3U8L A;  2YIN A;  4FRR A;  2XZE A;  2V1D B;  4ZI2 D;  4QHO A;  3F31 A;  2HN2 A;  2V8S V;  2FBW A;  3V5U A;  3L39 A;  3ZST A;  4IRE A;  4HWD A;  4WZX A;  3P4R A;  1XMO T;  2WNJ A;  2X9X A;  3EI0 A;  3UU6 A;  4DV0 T;  4A97 A;  5H6R B;  2YEV C;  5C3J A;  4GKJ T;  5CGM A;  3UU8 A;  3CQX C;  1NEK A;  2IUB A;  2XQ9 A;  2HH7 A;  1YKH B;  4IE7 A;  4AQF C;  3PUQ A;  4EAH A;  5LG3 A;  4LF4 T;  4AI6 A;  1LVK A;  3UUX B;  3FBL A;  2BG9 E;  4UIG A;  3PUS A;  4IE5 A;  5CJ5 A;  2PGZ A;  2JJ9 A;  4HFI A;  5FL0 A;  3ONJ A;  2XAH B;  3L8R A;  3WIP A;  3UUM A;  4B3R T;  2X68 A;  2VVS A;  2YU2 A;  2CA5 A;  3ZPO A;  1W0B A;  2Y8D A;  2L3L A;  1ZEE A;  4ZI3 C;  3LJC A;  3U8J A;  3ZMZ B;  3PUA A;  4U72 A;  2ZJU A;  4LF8 T;  5L4E A;  4TV8 E;  1J5E T;  2SPC A;  1EZ3 A;  5HXE A;  3R84 B;  2UXD T;  3K8P C;  2LT3 A;  4YTM A;  5AFH A;  3AED A;  4XAX B;  4JLE A;  4CI2 B;  5AFN A;  2BKP A;  2WNC A;  4QXB B;  4CI3 B;  3T1Y T;  3ZDH A;  2CRB A;  2DCF A;  4JI1 T;  5LG4 A;  1UK5 A;  5HEO A;  5BMV E;  5KXJ A;  4DV6 T;  4P0B A;  5DQV A;  3Q5E A;  4TWD A;  1IAP A;  3LK2 B;  3KBU A;  1KNZ A;  3N9M A;  4QAB A;  3HA4 A;  1NEN A;  1WFD A;  5L3B B;  2KZ7 B;  1HNW T;  2PTF A;  1U4Q A;  4CXW A;  2I59 A;  3GN5 B;  2JQK A;  2V7J A;  4NXM T;  5KDM C;  4PNI A;  2QGS A;  3ZYM A;  4MFR A;  2BBJ A;  3FHN A;  5BRX A;  2VAS A;  3FZM B;  3V5S A;  2XHE B;  1CUN A;  2BYP A;  1MIW A;  4ZI7 E;  5DQW A;  3N2G E;  3AE8 A;  1J5W A;  5JQG E;  2A9U A;  4CI1 B;  2BG9 A;  4AXP A;  1N32 T;  2E2A A;  3IHR A;  5F3J A;  2G0U A;  4IDN A;  1D1B A;  4TNW A;  3ZMV B;  5M4Y A;  1FEW A;  2WNL A;  4JYA T;  2LSI A;  2Q9Q A;  2WDR A;  4JV5 T;  3WTN A;  4PJJ A;  2NR4 A;  4LFB T;  2E8I A;  4EOZ B;  2JQ9 A;  5FVK A;  4ILU A;  3LK4 2;  3IGQ A;  3ETU A;  4DR7 T;  2X9Y A;  4TX5 A;  4LFC T;  1I9B A;  2DHR A;  5AFK A;  4YTN A;  4JI0 T;  3J7Y q;  4JI6 T;  3P4Q A;  5HEG A;  2C0S A;  3LSV A;  2ZM8 A;  3ZT5 A;  2XNT A;  2XYS A;  3H3M A;  3FZL B;  3CVR A;  4EYY R;  2WZI A;  2RPA A;  3QK6 A;  2CHN A;  3C84 A;  4WBN E;  4ILA A;  1SHZ C;  5LGT B;  4HKA A;  3ESL A;  3P50 A;  4UY2 A;  3AA6 B;  4MLK A;  5AFL A;  1LRZ A;  4KBM B;  3ZSS A;  2DI4 A;  4HN9 A;  3KV5 A;  5JDQ A;  2V6Y A;  1E7P A;  4JUY A;  3Q5X A;  4DR6 T;  2NW8 A;  2X9W A;  2FJB A;  5JTG A;  2ZM6 T;  1KEY A;  3A5X A;  2PH9 A;  3OYX A;  3QUJ A;  1XNQ T;  1MMD A;  5ETW A;  3C4W A;  3L09 A;  5L3D B;  2ACX A;  2UU9 T;  3JAE A;  4IHJ E;  5ABG A;  4ZRU A;  2XQ6 A;  1QSD A;  1XWM A;  4XZC A;  2F4V T;  4NUU A;  3RRC A;  1U5P A;  4OHF A;  3AE6 A;  4CZZ B;  3N9L A;  5JH7 E;  4ZEY A;  5CB4 E;  3TLW A;  2XSA A;  4ZOL E;  2MTQ A;  2X0L B;  3R6N A;  4ISS A;  3FBZ A;  3RC8 A;  2ACZ A;  2CBJ A;  3QNU A;  5AQP B;  3VR9 A;  4NZB A;  1JNR A;  2XZ6 A;  1E1H B;  3RYI E;  3ZDG A;  1X9B A;  5EZY E;  1YXR A;  3K3Q C;  3CWZ B;  2X9H A;  3SQ9 A;  3FZH B;  4DUY T;  3TLS A;  3UQ7 A;  4OK0 A;  4UF0 A;  3U8M A;  4ZXL A;  2I6H A;  3UFE A;  5FY7 A;  5FXV A;  4AFT A;  3CPZ A;  3FXE B;  5AIN A;  3K1S A;  4HTE A;  2WDV A;  2QC1 B;  4DV2 T;  2KXP B;  2MYS A;  2CWO A;  2W63 A;  3AE4 A;  1US7 B;  2JIW A;  2K9A A;  4N78 D;  1XMQ T;  3T1H T;  3VKG A;  5FMN A;  5FY1 A;  1WR0 A;  2XM2 A;  2CEA A;  4KHZ F;  3PUW F;  1UX5 A;  2YDQ A;  2M6I A;  4K0U A;  2BYQ A;  4EZ4 A;  4PJM A;  4QAA A;  4WV9 A;  4XK9 A;  2ZM2 A;  2D9D A;  5ABF A;  1BR4 A;  4Z90 A;  3KBT A;  3PDY A;  1MMG A;  2NW7 A;  3ABV A;  2CM0 A;  3MKD A;  4O4H E;  1VRB A;  4B3M T;  2GK9 A;  4ALX A;  1UGO A;  5J1G A;  4GK5 E;  4HFE A;  1WRD A;  3DTO A;  4F8H A;  3NRX A;  5LBQ B;  4KMC A;  3QC9 A;  1J1J A;  4U7Y A;  5L47 A;  4P0A A;  2H3R A;  4AQG A;  3TLT A;  3SQ6 A;  5F5W A;  3AAI A;  2E9X B;  5CA0 E;  1UV6 A;  2JQH A;  4J2C A;  1IBK T;  1HF8 A;  3AEA A;  4BFQ A;  3ZYL A;  5IWA T;  5KMG P;  2CXD A;  3ZN0 B;  3KV6 A;  1MIV A;  3O1H A;  4TNV A;  5LMU T;  1UW6 A;  2VKO A;  4I0U A;  5FVL A;  4EEB A;  5LB7 B;  4DV1 T;  3PTR B;  3E22 E;  2WWV A;  3JC6 C;  3O1J A;  3GA8 A;  2XM1 A;  4DO0 A;  1XDP A;  3AAE B;  4KP3 C;  2VVN A;  4OX9 T;  2YME A;  1IBL T;  1L0V A;  2BVL A;  4LF7 T;  3WTM A;  5JDL A;  4G2A A;  5BW2 A;  1AJ3 A;  3AEE A;  1HNZ T;  3RIU C;  4KI0 F;  4H9O C;  2XQ4 A;  3UUL A;  1OED E;  4GIW A;  1KFY A;  5TAO A;  3W15 B;  2W66 A;  3EDV A;  5JDM A;  1YW0 A;  2E9X C;  2EHO A;  2LRK A;  2VWA A;  4DR1 T;  2X0H A;  4CN6 A;  2KSR A;  4JBW F;  4NPP A;  1HX1 B;  4YJ2 E;  3F2E A;  2J47 A;  3VRB A;  2BDE A;  2LOS A;  4IDQ A;  3RF1 A;  2UUC T;  3OKQ A;  2CMR A;  4ANJ A;  5HEJ A;  2VL0 A;  4BJN A;  2H7V C;  3AA1 B;  3AEG A;  4X5T A;  2OLT A;  2KWH A;  4HQP A;  3RHW A;  3T8O A;  4M1P A;  5LBM A;  3HI2 A;  2WB5 A;  4IL9 A;  4DMW A;  2CXF A;  4L5G A;  4BJM A;  2BS2 A;  2XJ7 A;  1NWM X;  1MIY A;  4LF9 T;  4U7I A;  2IDO B;  2WM9 A;  3ZT7 A;  3M3Z B;  5ABH A;  2KT9 A;  5HAX A;  5LJM A;  2XQ5 A;  1T72 A;  4PFO A;  2MOZ A;  3ZMU B;  3WTJ A;  4TZ4 C;  4AQF A;  2MPK A;  2PG8 A;  5LCY A;  2WY2 A;  2XQ3 A;  2CBI A;  3L3P A;  4YSX A;  2V26 A;  3U3I A;  4QKN A;  3Q5W A;  4I4T E;  2D0U A;  3EAM A;  4NIQ A;  5LYJ E;  2UXC T;  4EIW A;  2YK0 A;  4EED A;  4QXH B;  4ZZB A;  4YSZ A;  4P09 A;  4DR2 T;  5BP0 A;  4AIS A;  2C5I T;  1WCR A;  3H3A A;  2M6B A;  2DWG A;  2XQ8 A;  1D0Y A;  1OED A;  2RP4 A;  2C5K T;  2NP9 A;  1FMV A;  3WTL A;  1WR6 A;  3E0Z A;  2BG9 B;  3ZMT B;  4PK6 A;  2WMN A;  4TN7 B;  2WWU A;  3O9X A;  2HN1 A;  3IF8 B;  5E0O A;  2Q9Q B;  5FXZ A;  4O2A E;  2Y6X A;  3JAF A;  1N33 T;  4QXC B;  5HYA A;  3NZP A;  1HFA A;  1M7K A;  1D1A A;  1D0Z A;  3VHL A;  5AQJ B;  2A72 A;  2FJD A;  5LA6 E;  2NTX A;  1V9D A;  3OBV E;  3P4P A;  2EHO D;  2LM2 A;  4KUM B;  4JEU B;  2W4X A;  2R6G F;  2XSB A;  3PUG A;  3SFE A;  2BKN A;  1WYC A;  3AXJ A;  1E2A A;  2UUA T;  2DWK A;  1Z8U A;  4AFG A;  1UX2 A;  4YHH T;  2JRK A;  4DV3 T;  2XYT A;  2VKH A;  2LSJ A;  1YQ3 A;  3AE9 A;  4O8S A;  2LJL A;  1IBM T;  3Q2M A;  1ZP0 A;  2LHN A;  1ZHC A;  2BG9 C;  2J4G A;  4BAY B;  2PJQ A;  2BBH A;  2YOE A;  3NWI A;  3I9W A;  3KIN B;  3FZF B;  2LSY A;  3NBX X;  3KVA A;  3SOL A;  4UXU A;  2HPL A;  4HFV A;  2Q9Q C;  1OXZ A;  2ZJV A;  2V6Y B;  3C51 A;  3QB5 A;  2XNU A;  4TWF A;  1MMA A;  5SYO A;  2XQ7 A;  1G73 A;  4ZK4 A;  5LHG B;  5FJV A;  2A3D A;  4ZS2 A;  4AKL A;  4JI5 T;  3LFM A;  3N9O A;  5LHH B;  3HKC E;  4DBM A;  5JR9 A;  2KND A;  3SS1 A;  4HFH A;  4ILB A;  5AQF B;  1W09 A;  4YY3 T;  4PJN A;  2WDQ A;  2LRL A;  4DV5 T;  2VK9 A;  2CPT A;  3LBX A;  4YLH A;  3NZQ A;  5LGU B;  2XPK A;  4UVC B;  4DBR A;  4JI8 T;  3RYF E;  4ZI3 D;  4IL4 A;  1BR0 A;  4CN4 A;  1W9R A;  2LOP A;  2HPJ A;  4ZJT A;  5FY0 A;  3ANW A;  2E5V A;  2C5J A;  5L3G B;  3ZYK A;  5J5I A;  3AE2 A;  5AFU L;  2Y7Y A;  2BKO A;  2KWI B;  2KMF A;  2Y56 A;  5GON E;  3C4Z A;  1KNP A;  4U3C A;  1H7C A;  4PFP A;  3CQC B;  5FKY A;  5LOV E;  4I43 B;  4KX6 A;  2YDS A;  4C90 A;  2AXD S;  2UXX B;  3UUB A;  3P7I A;  3DP7 A;  3I0O A;  3AEC A;  5F8P A;  3ONL C;  2IHR 1;  2VKD A;  3ZN1 B;  2XAQ B;  4U31 A;  2VQF T;  5CO5 A;  3S4U A;  4OYK A;  4X20 E;  4LMK A;  5J5G A;  2A2F X;  3AE1 A;  3TLU A;  1KK7 A;  2IML A;  4PK5 A;  2BZB A;  1Y01 A;  1YKE B;  2NW9 A;  2CHO A;  5A1L A;  2VB6 A;  2QA7 A;  2IC9 A;  3PUV F;  5KE4 A;  2LSK A;  3QOF A;  2DNX A;  4HE8 A;  2JPF A;  4HWI B;  2H7O A;  3QB5 K;  2W8G A;  2BVM A;  4OYJ A;  1HG5 A;  3IA3 A;  4UEM A;  3SRZ A;  3KV9 A;  3N5L A;  5FXW A;  3WTI A;  1UCU A;  3UTK A;  4EXT A;  2QYW A;  3ZMS B;  4GYS A;  5LXB A;  2W8F A;  4FI5 A;  4EGW A;  3ZEF B;  4IDZ A;  4EZH A;  3UU4 A;  4IIJ E;  4A5X A;  5FL1 A;  1T98 A;  4GOU A;  3LG7 A;  3PEO A;  2ZMA A;  1ZOY A;  5HXS A;  2WZY A;  3ZT6 A;  4U2Y A;  3B57 A;  1JNZ A;  4ZI2 C;  4EV6 A;  3KDS E;  2KIN B;  3LDQ B;  4V1A v;  2CCQ A;  2W00 A;  5HEU A;  4B3T T;  4H9P C;  1UUR A;  5LXT E;  3EUH A;  3M65 A;  2UZ6 A;  4MAL A;  2LEH A;  4PW8 A;  2LKH A;  2LSG A;  4QH4 A;  4IT4 A;  2VUR A;  3BQL A;  3H37 A;  4EYU A;  2V7L A;  3VKH A;  4DR3 T;  3JCF A;  2V5C A;  3Q9D A;  5JDH A;  3I9Y A;  4LF6 T;  5DAB A;  3EDU A;  4LFA T;  1UX4 A;  2WAU A;  4X1I E;  1DU2 A;  5LGN B;  4UVA B;  4A56 A;  1S94 A;  5KZU A;  2Y58 A;  3AA0 B;  3DJB A;  4IDP A;  2XAF B;  5J2T E;  1D1C A;  3C4X A;  4QAC A;  4UV8 B;  2BS3 A;  5AQV B;  1VCT A;  2BR7 A;  4DVD A;  3RPU A;  4QWN B;  2W67 A;  3C64 A;  4O2B E;  3PV0 F;  2WBL A;  3AA7 B;  2EHO B;  1ZV4 X;  4NUV A;  4PJL A;  3ZC1 A;  2XAG B;  3MXZ A;  5H6Q B;  2WN9 A;  2N2N A;  3ZCI A;  3UU3 A;  2D5U A;  3EVY A;  5AQG B;  1BR1 A;  1R8I A;  5L3F B;  2V6X A;  2OV9 A;  3K3O A;  3PJA J;  1I94 T;  5HCM A;  3WTO A;  4DMV A;  2J1D G;  2WMO A;  3ZC0 A;  2ODV A;  3RGL A;  4P1N A;  5IHY A;  4CXX A;  4WYV A;  4MHC A;  2W0G A;  3C50 A;  3PUY F;  5LNK A;  3RIU A;  5AQN B;  3RI5 A;  1NAF A;  4IE6 A;  4X62 T;  2FJE A;  4HEA A;  4UXN B;  4Q25 A;  3N9N A;  2QRX A;  4HFB A;  2BR8 A;  5JRC A; 
#chains in the Genus database with same CATH homology
 5AIN A;  1UW6 A;  5AFM A;  2PH9 A;  2BG9 A;  5HEH A;  4HFD A;  4IL4 A;  3U8N A;  2QC1 B;  4UM3 A;  2Y57 A;  2XQ5 A;  4QAC A;  3WTI A;  4QH1 A;  4ZJT A;  4TWH A;  4TNW A;  2LM2 A;  2X00 D;  3U8J A;  2BR7 A;  2WNL A;  2ZJU A;  5LXB A;  2W8F A;  5L4E A;  3WTJ A;  4XHE A;  3SIO A;  3JAE A;  4B5D A;  5IUX A;  4ZRU A;  3UU4 A;  2XQ6 A;  2XZ5 A;  5JME A;  5AFJ A;  5J5I A;  2XQ3 A;  2Y7Y A;  3WTN A;  2XNV A;  4AFG A;  1UX2 A;  2Y56 A;  2YME A;  3WTK A;  4ZR6 A;  3RQU A;  4BQT A;  2XYT A;  1OED B;  2XQA A;  4LMJ A;  2WN9 A;  5J5H A;  3WTM A;  5HCJ A;  3U8L A;  3WTH A;  3PEO A;  2YMD A;  3IGQ A;  4UM3 S;  5BW2 A;  2M6I A;  4FRR A;  2MAW A;  5AFH A;  2BYQ A;  3RQW A;  3UU3 A;  4QAA A;  2WZY A;  4WV9 A;  4XK9 A;  3EAM A;  2BG9 C;  3TLW A;  1I9B A;  3PMZ A;  5AFN A;  3P4W A;  4COF A;  2XQ4 A;  2WNC A;  5AFK A;  3ZDH A;  4QH5 A;  2LKG A;  2YOE A;  3EHZ A;  3ZKR A;  5J0Z A;  3UUB A;  4Z90 A;  4ZZB A;  3SH1 A;  1OED E;  3RIA A;  4ZZC A;  5BP0 A;  4UXU A;  3U8K A;  5HCM A;  2BYS A;  3WTO A;  5HEG A;  4IRE A;  5HEO A;  3JAD A;  5HEU A;  3UQ4 A;  3LSV A;  5L4H A;  4NZB A;  2XNT A;  2Y54 A;  4PIR A;  2ZJV A;  2XZ6 A;  4ALX A;  2WNJ A;  2XNU A;  2XYS A;  2X00 A;  2M6B A;  3WIP A;  5CO5 A;  4TWF A;  4TWD A;  2UZ6 A;  2KSR A;  2XQ8 A;  3ZDG A;  4HFE A;  3EI0 A;  4NPP A;  1OED A;  5SYO A;  3UU5 A;  5J5F A;  2LLY A;  3UU6 A;  4F8H A;  4LMK A;  5J5G A;  2XQ7 A;  4A97 A;  5TVC A;  3WTL A;  5AFM B;  2LKH A;  4QH4 A;  3C84 A;  4ZK4 A;  4QAB A;  2BG9 B;  5FJV A;  2YKS A;  2BYR A;  4UM3 P;  4ILC A;  4ILA A;  3TLU A;  3SQ9 A;  3UU8 A;  5L47 A;  2BYN A;  5HEJ A;  3RI5 A;  2XQ9 A;  2VL0 A;  3RIF A;  3TLS A;  5CFB A;  2BJ0 A;  3C79 A;  4DBM A;  2C9T A;  3TLT A;  3UQ7 A;  3P50 A;  3SQ6 A;  4UY2 A;  4X5T A;  4Z91 A;  5LG3 A;  3U8M A;  5AFL A;  4HFH A;  4ILB A;  4UM1 A;  4LML A;  5KE4 A;  4HQP A;  3RHW A;  4HFC A;  3T4M A;  4ZK1 A;  1UV6 A;  3JAF A;  2BG9 E;  4IL9 A;  4ZJS A;  5BRX A;  4EZ1 A;  2W8G A;  2YN6 A;  4D01 A;  4HFB A;  4A98 A;  4BFQ A;  4AFT A;  2BYP A;  2PGZ A;  4AFH A;  3TLV A;  5KZU A;  4HFI A;  2Y58 A;  3GUA A;  1OED C;  4TNV A;  2BR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...