3TLTA

The glic pentameric ligand-gated ion channel h11'f mutant in a locally-closed conformation (lc1 subtype)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAFIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tltA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tltA01
2M6IA 5JMEA 2X00D 2X00A 2XNTA 3T4MA 3WTMA 3TLVA 5KZUA 2XQ5A 4D01A 4ILAA 2QC1B 2LKHA 2C9TA 3WIPA 3C79A 1UX2A 4IL4A 3SH1A 3RIFA 2PH9A 2BYQA 3ZKRA 2Y7YA 4HFDA 4HFHA 3UU3A 3LSVA 2LM2A 4A97A 4AFHA 4LMKA 4ZJTA 4HFIA 2XYTA 4TWFA 2BG9E 3SQ6A 2YOEA 4Z90A 2YMDA 3RQUA 4UXUA 1OEDE 2BG9B 4ZJSA 3P50A 5AFMA 4COFA 4TNVA 2UZ6A 3SQ9A 3JADA 4LMJA 4TNWA 3U8NA 2Y58A 5TVCA 2XQ4A 5AFJA 5L4HA 3EI0A 4UM1A 4UM3S 5HEHA 2BR7A 4ZK4A 4HFBA 4PIRA 3TLUA 2XZ6A 3U8JA 5HEOA 2ZJVA 2BG9C 5L4EA 5CO5A 4TWHA 1OEDC 3UU4A 2WN9A 5AINA 2WZYA 3WTOA 4UM3A 4X5TA 4QH1A 2XZ5A 2XQ7A 5HCMA 3EAMA 3WTIA 3U8MA 2KSRA 5J5FA 2BR8A 3UUBA 2WNCA 4F8HA 3TLSA 4ILCA 2W8GA 3WTNA 5LXBA 3IGQA 4ALXA 3UU5A 2MAWA 5IUXA 2BYNA 4QABA 5J5GA 2BYRA 3ZDGA 2XQ9A 5J0ZA 2BJ0A 3RI5A 4UM3P 4HQPA 3C84A 5BRXA 4LMLA 2XQ6A 4AFGA 4HFEA 3U8LA 3WTHA 4ILBA 2M6BA 2YMEA 2ZJUA 3ZDHA 4TWDA 4Z91A 2YKSA 3JAEA 3UU8A 5J5HA 3UQ7A 5AFMB 5SYOA 4QAAA 2XYSA 3RQWA 4ZRUA 4QACA 3JAFA 2PGZA 4EZ1A 2WNJA 4ZR6A 4WV9A 5HCJA 2Y57A 3TLTA 5BP0A 5LG3A 1I9BA 1UV6A 5AFHA 2W8FA 5FJVA 4B5DA 5HEJA 3WTLA 5HEUA 4XHEA 2LLYA 5L47A 3RHWA 3PMZA 2XQAA 4QH5A 3EHZA 2BYPA 4NZBA 3P4WA 3WTJA 2VL0A 2Y54A 4UY2A 4NPPA 4A98A 2BG9A 4IL9A 4QH4A 1OEDA 3GUAA 2XNUA 3WTKA 4BQTA 1UW6A 3U8KA 5J5IA 4FRRA 5KE4A 2YN6A 2WNLA 5CFBA 5BW2A 4ZK1A 4DBMA 5AFKA 5AFNA 2XNVA 4AFTA 3TLWA 4HFCA 5HEGA 2BYSA 4XK9A 2XQ3A 3RIAA 4BFQA 5AFLA 3UQ4A 2LKGA 3UU6A 4ZZBA 1OEDB 4IREA 4ZZCA 2Y56A 3PEOA 3SIOA 2XQ8A
chains in the Genus database with same CATH superfamily
5AQVB 2X00A 1CHUA 3KBTA 2BDEA 3AB3B 1L0VA 4EGWA 2PH9A 2BYQA 2Y7YA 5HXSA 4HFHA 2YEVC 1W09A 2LSKA 5LGNB 4UV9B 1ZKEA 4ZJSA 2WY2A 2ZM8A 3A7MA 4JEHB 4J2CA 1MIWA 1M62A 1G73A 5E0OA 2QVAA 2XJ7A 5FY1A 3UU4A 2D0UA 4UM3A 4X5TA 1BR0A 5ETWA 2XQ7A 1WR6A 1HNZT 2DWGA 1GQEA 1N33T 5JDQA 4PK4A 3FXEB 4HE8A 3TLSA 3PUWF 3MACA 5J0ZA 2H89A 4AFGA 2V26A 2J1DG 4EB6E 3RYHE 4MFRA 3Q2MA 3UU8A 2ODVA 2BZBA 5CB4E 3KDSE 2Y57A 2WU5A 3ZMUB 2LM9A 3FZLB 4O2BE 5H6RB 3T1HT 3K3QC 4QH4A 4YTMA 2XNUA 5FVKA 1LVFA 2QYWA 3UFGA 2NW9A 2X67A 1QSDA 3PDYA 4O4JE 5AFKA 4IE4A 2Y56A 2CBJA 4HWDA 3C51A 1MNEA 2HH7A 4KP3C 1UX2A 3CKDA 3NRXA 4JI5T 2J47A 5CA0E 4C91A 3AE9A 3BQLA 3H3MA 3ZJ1A 2NOXA 4NIQA 5AFMA 1ZEEA 3N9QA 5AFJA 4UM1A 4QXCB 2BS2A 4N78D 5J2TE 2X9YA 5JDLA 3DTOA 2BR8A 2FJEA 4DBQA 2R6GF 4QXBB 4AQYT 4ISTA 2MYSA 2IC6A 4O8SA 3U8LA 4U33A 2M6BA 2ZJUA 4CZZB 4YSZA 5ABGA 5HWXA 2CXLA 5JDHA 3PMZA 2CE7A 1Z8UA 2JMKA 3F2EA 3WAJA 1HX8A 3QB5A 4PK5A 4YSYA 3H37A 3QK6A 2PTFA 3U8KA 2YN6A 1YXRA 4ZK1A 2XNVA 3NZPA 2BYSA 4GOUA 3WTMA 2CMRA 2I6HA 5FXVA 4V1Av 1SE7A 2WM9A 2BS4A 2CBIA 1R8IA 5AQNB 4JI0T 3AXJB 4IL4A 3RIFA 3AE8A 3AE1A 4HGAA 5C2TA 4ZI3D 2BG9B 1XMOT 3AEGA 3EI0A 4UM3S 5JDMA 2E9XB 3U8JA 3RH3A 5CO5A 5L4EA 1T72A 2WZYA 4UVCB 3HKEE 5HCMA 3FZHB 4ZS2A 2ODUA 2HPLA 2C5IT 2H7VC 4UELA 1I94T 2EHOD 5FXWA 3RIUA 5HYAA 1X79A 2BKOA 2YMEA 4UIGA 2MTQA 3CQCB 3A5XA 3B5MA 5SYOA 4AI6A 3UT5E 5L3CB 1BR4A 4KUMB 4Z8XA 3C4ZA 1BR2A 3C64A 3O9XA 5HEJA 1ZP0A 2X0HA 4OFZA 5HAXA 4AKLA 2UUCT 1HG5A 4LF4T 3PE0A 4PAGA 4NZBA 3QUJA 4UY2A 1WYCA 1WRDA 1WCRA 2VKHA 3TLWA 3AVRA 2CA5A 3AA6B 2XQ5A 2JQQA 5AQRB 4ZOLE 3K8PC 3IEEA 2C9TA 4BA9A 4TX5A 4QX7B 2V7JA 5FP3A 1UX4A 3AEFA 2W00A 2W0GA 4A97A 2E9XA 2VQET 3ZEFB 3SQ6A 3RQUA 4WW0A 1OEDE 4KHZF 4DUZT 5A1LA 3CPZA 4UF0B 4PIRA 2X0YA 1MIVA 3Q5EA 3FHNA 4TWHA 3PV0F 3AA0B 1QLBA 4LF6T 3PU3A 3WTIA 3LBXB 2W8GA 2BJ0A 2A2FX 4HQPA 5JDNA 5LJNA 3W15B 5LBQB 3UUXB 1O3XA 5DABA 4JYAT 2WNJA 2WAUA 2KMFA 3I0QA 3Q9DA 2ZM6T 3V5UA 1IAPA 3G06A 4FI5A 5FY7A 4B6XA 3AA7B 4IL9A 1MMGA 1FMVA 2AXDS 2FJBA 4AISA 2WNLA 4I0UA 5CFBA 5EZYE 1E7PA 5L3BB 2RA1A 3ZJ2A 2QGSA 3B13A 3RC8A 1T8BA 4YLHA 5AFLA 3L8RA 3SIOA 4DV3T 4ISSA 2B1EA 1KF6A 2M6IA 5ABFA 4K0UA 3PUVF 5AQOB 5AQMB 4DMWA 3Q5XA 3KFWX 3RF1A 4K0KT 3IBPA 2BBJA 4KBMB 3ZKRA 5DQVA 3HKDE 4QWNB 4UF0A 5L3EB 5AQGB 1UURA 4UXUA 3UTKA 1DU2A 1W0AA 5LHIB 1MMAA 1IJ6A 5AQHB 4AKIA 4HFBA 3LFMA 2WDVA 2XAHB 4U7IA 3HKBE 3WTOA 2X0LB 1HG2A 3U3IA 3I9YA 3UUBA 4F8HA 4ZI2C 2CXDA 2XASB 1S35A 2K9AA 3C84A 4PFPA 5BRXA 3AVSA 5IYZE 3JC6D 3FBZA 4TWDA 3CQXC 4X1KE 2MOZA 4EZ1A 5LJMA 2LHNA 1JNZA 2EHOC 5J2UE 4QH5A 2XY8B 3GN5A 2JQKA 2W63A 4NXNT 4EZ4A 4A98A 5KMGP 4KI0F 3FB2A 4I43B 4IE6A 2HHHT 1ZV4X 1Y01A 4U74A 4P09A 3OPCA 2WWVA 5JH7E 4UV8B 1QUUA 1LRZA 4DIDB 4LFAT 5F5WA 2X00D 5ADXL 3CX6B 4X65T 3TLVA 1D0YA 3OYZA 4D01A 4EEDA 1VRBA 3VHLA 3UU3A 1OXZA 4AFHA 5FYMA 2NW7A 2WZHA 3ZMZB 1HX1B 4TNWA 3RYCE 3AE2A 3MKDA 4IDQA 5F3JA 3WI3A 5AQIB 4I4TE 2H7OA 5KXJA 3AE5A 4ZI7E 4ZXLA 5IHYA 5AFUL 4IE7A 4QABA 2F4VT 3AAAB 3I1AA 3K1SA 1OWAA 2X9HA 4U2ZA 2X66A 4M1PA 5JRCA 2FJDA 3D0TA 5AFMB 4JI4T 4QACA 3EUHA 2K48A 4UVBB 2WQYA 4DR6T 2PG8A 3HR0A 1I9BA 5JVDE 3QC9A 2WCAA 2LSIA 2VK9A 2V8SV 3ZYLA 4DO0A 3AEEA 1UX5A 4H9OC 4GYSA 2BS3A 5AQFB 3O4XE 3UULA 1UCUA 2UXDT 4FRRA 2UXCT 1XMQT 4IGUA 3J7Yq 4WNKA 2K5BB 3RIAA 3PEOA 4O4LE 3DP7A 2C0SA 4JLEA 5LA6E 5JMEA 3C50A 5HWYA 4AKHA 1LKXA 2JJ9A 4WBNE 1UUSA 2VQFT 2X9XA 3BQKA 1V9DA 2H88A 3QNUA 3I0OA 4IDZA 4A5XA 2ACZA 3SQ9A 4IHJE 4LMJA 2Q9QC 4LF8T 4U7YA 3TLUA 3OYXA 2N1GA 5LCYA 2N9DA 1OEDC 4GKKT 1HTJF 2LT3A 5BMVE 5C8YE 2NP9A 4OK0A 3ZT7A 3ZLIA 5DJQC 3ZDGA 2ACXA 1S94A 4EEBA 5AQPB 4UEMA 1EZ3A 2DI4A 2LEHA 2CXFA 4QAAA 3ZT6A 4ZRUA 3P4PA 3L09A 1XNQT 1X9BA 4CXWA 4CN1A 5LHHB 4TUYE 5EK3A 4JI8T 2N2NA 4B3ST 3ZSSA 4NPPA 4DV4T 1IJ5A 4L5GA 3QOFA 2YU2A 3PUYF 2H3RA 4DV2T 4DR3T 4O4HE 4AQGA 3RLFF 3ONLC 3L39A 5JR9C 3ZSTA 1IZNB 3CQGB 2KT9A 4PJJA 2KWHA 1KNPA 1US7B 4JV5T 5H6QB 1MMDA 2D5UA 2LOPA 5AQKB 4E7SA 2IDOB 3ANWA 4ILUA 4YTPA 3X1DA 3GA8A 5EK2A 2DCFA 4TWFA 2BG9E 2WBLA 2YOEA 2V1DB 3JCFA 2VKJA 5FNVE 3U8NA 1SA0E 3FBLA 4CI1B 3OTOT 3FXDB 2V7MA 3N2OA 4IDPA 4BAYB 4I55E 1WYBA 1J1JA 2CLYB 4P0BA 3CX7B 4O2AE 5LP6E 2PBIA 5LXBA 3VR8A 2XZEA 3FZKB 3IHRA 2IMLA 1ZOYA 4H63H 3PTRB 3DJBA 1N36T 4X64T 2YKSA 5ABHA 2UU9T 2K3WA 3AE7A 4HN9A 4B5DA 1VCSA 2X68A 5HEUA 5L47A 5FL0A 3AE6A 1YW0A 2LE8A 3RKOA 2ZM0A 4DR4T 1HNWT 1UW6A 3ETUA 5LG4A 5J1GA 4ADZA 4DV6T 4AFTA 4X1YE 4L0RA 3R84B 1HCIA 3UQ4A 4ZZCA 1YD8G 3M3ZB 2IW5B 2V7IA 4ILAA 3O1HA 2XAQB 3WIPA 2YK0A 5JQGE 2PJQA 2OLTA 4EOZB 2Y6XA 2E9XD 4ZJTA 2XYTA 2W4XA 4H63V 3JADA 2GK9A 1U5PA 2XQ4A 5L4HA 2DWKA 4TV8E 2BR7A 2W2UA 2XQYA 5HEOA 4TN7B 5CGMA 3UFEA 4DV7T 3AEBA 2IAKA 4QH1A 3LK3B 4IT4A 5ABFB 2VKOA 3U8MA 2V7KA 2V7LA 4AQFA 5CA1E 3ZCIA 2IC9A 2XHEB 4Q25A 3T8OA 3UU5A 4ALXA 3CX8B 1IBMT 2L9QA 2LRKA 2LOSA 3UQ7A 3KBUA 2PGZA 3HL6A 4ZR6A 2V5DA 2XSBA 5AFHA 3E22E 2IHR1 5AQJB 3RHWA 3M65A 3ZPOA 2BYPA 2C5KT 4TZ4C 5LHGB 2E5VA 4DR5T 3GUAA 2E5LT 4DBMA 1UGOA 2VL8A 3KV6A 2PFVA 4U72A 4CI3B 1OEDB 2XSAA 3PUSA 2KWIB 3N9NA 4HEAA 1KNZA 4JI6T 3ONJA 3NZQA 4HFDA 1KK7A 3GN5B 5LXTE 4ANJA 4LMKA 2JRKA 2YMDA 2LSGA 4PJLA 5BR8T 4JBWF 1N34T 4GK0E 2V6YB 1W9RA 4G63A 4LFCT 2WN9A 3E0ZA 4YY3T 4EV6A 4YTNA 2MAWA 2VKDA 2BYNA 2L3LA 4ILBA 3SRZA 3ZDHA 5J5HA 1D0ZA 3S4UA 2CM0A 3ESLA 3JAFA 4X66T 4CN4A 4AKRB 5LGUB 1MNDA 5FJVA 4ZI3C 2IIUA 3WTLA 5IWAT 2Q9QA 4QHOA 1VCTA 2CRBA 1BR1A 1OEDA 3WTKA 1N32T 1I6ZA 3N5LA 4JI7T 5LMNT 5EK4A 5AFNA 1KNRA 2HPJA 5JREA 5JRCB 3UU6A 5FMNA 2XQ8A 4WYVA 3MK7C 2BVMA 4X1IE 3RKGA 1B7TA 2LKHA 4WZXA 1SUMB 5FXXA 3PJAJ 2IUBA 5JDFA 4EAHA 3O1IA 4IDOA 1XDPA 4H9RC 5LGTB 2V6YA 4BJMA 3SS1A 1CUNA 3NBXX 3P4RA 3C4XA 5TVCA 3OVUA 3VR9A 4B3TT 2BG9C 2VURA 4PNIA 3PUXF 4CQIA 2VASA 2E9XC 2JPFA 1HFAA 4QXHB 2CWYA 4ILCA 5AQUB 4UXNB 2XQ9A 5JR9A 4LF9T 3OJAA 1MMNA 4LMLA 5AQTB 4C90A 3AE3A 3RC3A 3ONXA 1LVKA 3AE4A 2WP9A 3IA3A 3ZN0B 1UK5A 5LNKA 2D2SA 2NTYA 2KNDA 3N2GE 5LG3A 2MBGA 2VVSA 2UXNB 4XHEA 2WB5A 4EYUA 2LHRA 4NUUA 4AXPA 3WTJA 3ZC0A 3N9LA 2Y54A 4OX9T 2WWUA 3NKZA 2RP4A 2XAFB 2LSJA 2JIWA 2DNXA 4FJOA 5LBMA 5BW2A 4OYKA 4A56A 4O4IE 2W66A 4DBRA 4BFQA 3VKGA 3ZMVB 2MPKA 2YDSA 2XNTA 4OYJA 2WU2A 1D0XA 5FXZA 4DV1T 2XUEA 4CN6A 2Y8DA 3ZCJA 3AECA 1FEWA 5GONE 1HF8A 2XTLA 4ZEYA 4EZHA 1D1AA 5FL1A 5JTGA 3Q5DA 5CJ5A 2LM2A 5HXHA 1XWMA 4H9SE 3LG7A 5JDGA 2CHNA 4TNVA 4F6RC 2Y58A 4HWHA 4ZK4A 4KX6A 1Z0PA 5M4YA 4JUYA 3TKLB 3AAEB 5J5FA 3MJXA 3IGQA 1HS7A 4NUVA 4YJ3E 5J5GA 3RRWA 3ANWB 2LJLA 4HFEA 3WTHA 3VU7H 5LMUT 4HWIB 3SFDA 3CWZB 4P1NA 2E8IA 1FMWA 4L9IA 3PUZF 4JI1T 2DL1A 3FZFB 5AQSB 3KINB 2WSSV 4UR9A 2A3DA 2XAJB 3EHZA 2VL0A 1T7SA 5J5IA 2YDQA 2NWBA 5DQWA 3N9OA 2Z6EA 2VWAA 2XQ3A 4ZZBA 4I50E 4U31A 3P7IA 2CPTA 4MLKA 1IBKT 4KHPT 2QA7A 3JC6C 3RPUA 4GYRA 3P4SA 2NR4A 4MBQA 3CIRA 1E1HB 3AAIA 3C98B 2AE9A 4Z90A 4LF7T 4CXXA 2E2AA 2I0MA 3H3AA 2B76A 2UZ6A 2ZM2A 2XAGB 4IE5A 5FVLA 3N9MA 5HEHA 4PJNA 2ZJVA 3MZKB 3AA1B 2WZIA 2SPCA 2OA5A 2YDRA 4DR7T 3T1YT 1NEKA 2WNCA 2K24A 4DUYT 2KZ7B 2WMNA 3RI5A 3B57A 2WDRA 2UUBT 1WLXA 2OV9A 4LF5T 2EHOB 4MHCA 5LB7B 2DLRA 4IDNA 3BK9A 4LFBT 3TLTA 5BP0A 5L3DB 3O1JA 3SOLA 3K3OA 3VRAA 4IE0A 3MXZA 2VVNA 3F57A 3ZMTB 2A9UA 1NWMX 1YKHB 2WDQA 3ZMSB 4X62T 2UXXB 4NXMT 4YHJA 4TV9E 3ABVA 4PW8A 4YJ2E 5HEGA 4ZI2D 2XM2A 4ZHQE 2LKGA 1MIYA 3QB5K 4MALA 5FKYA 2QRXA 3T4MA 2ZLYA 3N2KE 2JMHA 3NRYA 2JQHA 4YT0A 2Y48B 2UUAT 4ASKA 1J5WA 4GK5E 2KXPB 4WBOA 2ES0A 2VB6A 2X51A 1NAFA 3P50A 1YKEB 1FIOA 5L3FB 2YU1A 3A8YC 2ZMAA 1U4QA 4AKGA 3EVYA 3P4QA 3J9X1 3PURA 1VOMA 3AEDA 4DMVA 4EXTA 4HWCA 2KSRA 5LYJE 1ZHCA 3VRBA 5IUXA 2BYRA 5LOVE 2EHOA 1FJGT 4UM3P 2D0TA 3L3PA 3GMIA 3JAEA 1NENA 4YFSA 3RQWA 5FY0A 3AEAA 2V5CA 2LSYA 2W8FA 2J4GA 3OBVE 3CMLA 3AXJA 3LDQB 2LLYA 2L8KA 3UUMA 1KFYA 3P4WA 3Q5WA 2BG9A 4P0AA 1D1CA 4BQTA 4HWFA 4XAXB 3UUNA 4ZS3A 1Y64B 5KX5E 5KE4A 1D1BA 5AQQB 1KEYA 4E7ZA 3ZYKA 4B3RT 5F8PA 2V6XA 4CI2B 4GIWA 3ETVA 3PUQA 1WFDA 4KMCA 3HA4A 3LK2B 3IF8B 2RPAA 2QC1B 3NVOA 3ZN1B 3E08A 3RGLA 4DV0T 2NTXA 2Q9QB 3EABA 3GWHA 3LSVA 2UXBT 4G2AA 3KV9A 3SFEA 2LRLA 5C3JA 3MA9A 2NW8A 4XZCA 4COFA 1IBLT 2KLQA 5AQLB 2HN1A 4HFVA 4IIJE 3C4WA 4B3MT 2W61A 3PUGA 2XZ5A 3KVBA 4H9QC 4GKJT 3BQIA 2BBHA 1E2AA 3I9WA 2BKNA 3P8CD 3NWIA 2A72A 4U3CA 2BKPA 1T98A 2W67A 4X20E 4BJNA 1XNRT 4EIWA 4EYYR 2XYSA 1W0BA 3HKCE 5HXRA 2DHRA 4WV9A 4ERRA 3LK42 3SWHA 3LJCA 2Q9QD 3V5SA 2XQAA 2M67A 3RYFE 1JNRA 4HKAA 2FJAA 1AJ3A 2X9WA 4DVDA 3U78A 4UVAB 5JR9B 2XPKA 3EDVA 2XM1A 4HTEA 1XZYA 1H7CA 4IREA 2J62A 4JI3T 3RIUC 3ZYMA 1XDOA 2FBWA 2CWOA 4AIUA 3LBXA 5KZUA 4H9NC 2P9BA 4U2YA 2C5JA 1YQ3A 3C79A 3SH1A 4XBFB 4H9PC 3WAKA 3ZT5A 3OKQA 5KDMC 3ZC1A 4YSXA 4HFIA 3KV4A 4DV5T 2KINB 4PFOA 4QKNA 1HR0T 3F31A 3N9PA 2D9DA 2I59A 2XZ6A 4DR1T 1M7KA 5AINA 1G8XA 5TAOA 2FUPA 3EAMA 1SHZC 5L3GB 5HXCA 1J5ET 2WS3A 3CVRA 3PU8A 4PJMA 3WTNA 2W62A 4OHFA 1YQ4A 2CLYC 4QX8B 4JI2T 2CCQA 2XQ6A 5HXEA 2HN2A 4Z91A 4DR2T 3RRCA 3R6NA 2CEAA 2WMOA 3K3NA 2YINA 3CK6A 5HCJA 4DNDA 3VKHA 4AQFC 1UV6A 3KVAA 2CHOA 3KV5A 3RYIE 3PUAA 4PK6A 3FZMB 4JEUB 3RX6A 2BVLA 3EDUA 3HI2A 2G0UA 5L2LA 4CXYA 1WR0A 1HNXT 2JQ9A 4HFCA 5ABEA 4XK9A 4YXDA 4YHHT 3PJAA
chains in the Genus database with same CATH topology
2M6IA 5JMEA 2X00D 2X00A 2XNTA 3T4MA 3WTMA 3TLVA 5KZUA 2XQ5A 4D01A 4ILAA 2QC1B 2LKHA 2C9TA 3WIPA 3C79A 1UX2A 4IL4A 3SH1A 3RIFA 2PH9A 2BYQA 3ZKRA 2Y7YA 4HFDA 4HFHA 3UU3A 3LSVA 2LM2A 4A97A 4AFHA 4LMKA 4ZJTA 4HFIA 2XYTA 4TWFA 2BG9E 3SQ6A 2YOEA 4Z90A 2YMDA 3RQUA 4UXUA 1OEDE 2BG9B 4ZJSA 3P50A 5AFMA 4COFA 4TNVA 2UZ6A 3SQ9A 3JADA 4LMJA 4TNWA 3U8NA 2Y58A 5TVCA 2XQ4A 5AFJA 5L4HA 3EI0A 4UM1A 4UM3S 5HEHA 2BR7A 4ZK4A 4HFBA 4PIRA 3TLUA 2XZ6A 3U8JA 5HEOA 2ZJVA 2BG9C 5L4EA 5CO5A 4TWHA 1OEDC 3UU4A 2WN9A 5AINA 2WZYA 3WTOA 4UM3A 4X5TA 4QH1A 2XZ5A 2XQ7A 5HCMA 3EAMA 3WTIA 3U8MA 2KSRA 5J5FA 2BR8A 3UUBA 2WNCA 4F8HA 3TLSA 4ILCA 2W8GA 3WTNA 5LXBA 3IGQA 4ALXA 3UU5A 2MAWA 5IUXA 2BYNA 4QABA 5J5GA 2BYRA 3ZDGA 2XQ9A 5J0ZA 2BJ0A 3RI5A 4UM3P 4HQPA 3C84A 5BRXA 4LMLA 2XQ6A 4AFGA 4HFEA 3U8LA 3WTHA 4ILBA 2M6BA 2YMEA 2ZJUA 3ZDHA 4TWDA 4Z91A 2YKSA 3JAEA 3UU8A 5J5HA 3UQ7A 5AFMB 5SYOA 4QAAA 2XYSA 3RQWA 4ZRUA 4QACA 3JAFA 2PGZA 4EZ1A 2WNJA 4ZR6A 4WV9A 5HCJA 2Y57A 3TLTA 5BP0A 5LG3A 1I9BA 1UV6A 5AFHA 2W8FA 5FJVA 4B5DA 5HEJA 3WTLA 5HEUA 4XHEA 2LLYA 5L47A 3RHWA 3PMZA 2XQAA 4QH5A 3EHZA 2BYPA 4NZBA 3P4WA 3WTJA 2VL0A 2Y54A 4UY2A 4NPPA 4A98A 2BG9A 4IL9A 4QH4A 1OEDA 3GUAA 2XNUA 3WTKA 4BQTA 1UW6A 3U8KA 5J5IA 4FRRA 5KE4A 2YN6A 2WNLA 5CFBA 5BW2A 4ZK1A 4DBMA 5AFKA 5AFNA 2XNVA 4AFTA 3TLWA 4HFCA 5HEGA 2BYSA 4XK9A 2XQ3A 3RIAA 4BFQA 5AFLA 3UQ4A 2LKGA 3UU6A 4ZZBA 1OEDB 4IREA 4ZZCA 2Y56A 3PEOA 3SIOA 2XQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6I A;  5JME A;  2X00 D;  2X00 A;  2XNT A;  3T4M A;  3WTM A;  3TLV A;  5KZU A;  2XQ5 A;  4D01 A;  4ILA A;  2QC1 B;  2LKH A;  2C9T A;  3WIP A;  3C79 A;  1UX2 A;  4IL4 A;  3SH1 A;  3RIF A;  2PH9 A;  2BYQ A;  3ZKR A;  2Y7Y A;  4HFD A;  4HFH A;  3UU3 A;  3LSV A;  2LM2 A;  4A97 A;  4AFH A;  4LMK A;  4ZJT A;  4HFI A;  2XYT A;  4TWF A;  2BG9 E;  3SQ6 A;  2YOE A;  4Z90 A;  2YMD A;  3RQU A;  4UXU A;  1OED E;  2BG9 B;  4ZJS A;  3P50 A;  5AFM A;  4COF A;  4TNV A;  2UZ6 A;  3SQ9 A;  3JAD A;  4LMJ A;  4TNW A;  3U8N A;  2Y58 A;  5TVC A;  2XQ4 A;  5AFJ A;  5L4H A;  3EI0 A;  4UM1 A;  4UM3 S;  5HEH A;  2BR7 A;  4ZK4 A;  4HFB A;  4PIR A;  3TLU A;  2XZ6 A;  3U8J A;  5HEO A;  2ZJV A;  2BG9 C;  5L4E A;  5CO5 A;  4TWH A;  1OED C;  3UU4 A;  2WN9 A;  5AIN A;  2WZY A;  3WTO A;  4UM3 A;  4X5T A;  4QH1 A;  2XZ5 A;  2XQ7 A;  5HCM A;  3EAM A;  3WTI A;  3U8M A;  2KSR A;  5J5F A;  2BR8 A;  3UUB A;  2WNC A;  4F8H A;  3TLS A;  4ILC A;  2W8G A;  3WTN A;  5LXB A;  3IGQ A;  4ALX A;  3UU5 A;  2MAW A;  5IUX A;  2BYN A;  4QAB A;  5J5G A;  2BYR A;  3ZDG A;  2XQ9 A;  5J0Z A;  2BJ0 A;  3RI5 A;  4UM3 P;  4HQP A;  3C84 A;  5BRX A;  4LML A;  2XQ6 A;  4AFG A;  4HFE A;  3U8L A;  3WTH A;  4ILB A;  2M6B A;  2YME A;  2ZJU A;  3ZDH A;  4TWD A;  4Z91 A;  2YKS A;  3JAE A;  3UU8 A;  5J5H A;  3UQ7 A;  5AFM B;  5SYO A;  4QAA A;  2XYS A;  3RQW A;  4ZRU A;  4QAC A;  3JAF A;  2PGZ A;  4EZ1 A;  2WNJ A;  4ZR6 A;  4WV9 A;  5HCJ A;  2Y57 A;  3TLT A;  5BP0 A;  5LG3 A;  1I9B A;  1UV6 A;  5AFH A;  2W8F A;  5FJV A;  4B5D A;  5HEJ A;  3WTL A;  5HEU A;  4XHE A;  2LLY A;  5L47 A;  3RHW A;  3PMZ A;  2XQA A;  4QH5 A;  3EHZ A;  2BYP A;  4NZB A;  3P4W A;  3WTJ A;  2VL0 A;  2Y54 A;  4UY2 A;  4NPP A;  4A98 A;  2BG9 A;  4IL9 A;  4QH4 A;  1OED A;  3GUA A;  2XNU A;  3WTK A;  4BQT A;  1UW6 A;  3U8K A;  5J5I A;  4FRR A;  5KE4 A;  2YN6 A;  2WNL A;  5CFB A;  5BW2 A;  4ZK1 A;  4DBM A;  5AFK A;  5AFN A;  2XNV A;  4AFT A;  3TLW A;  4HFC A;  5HEG A;  2BYS A;  4XK9 A;  2XQ3 A;  3RIA A;  4BFQ A;  5AFL A;  3UQ4 A;  2LKG A;  3UU6 A;  4ZZB A;  1OED B;  4IRE A;  4ZZC A;  2Y56 A;  3PEO A;  3SIO A;  2XQ8 A; 
#chains in the Genus database with same CATH topology
 5AQV B;  2X00 A;  1CHU A;  3KBT A;  2BDE A;  3AB3 B;  1L0V A;  4EGW A;  2PH9 A;  2BYQ A;  2Y7Y A;  5HXS A;  4HFH A;  2YEV C;  1W09 A;  2LSK A;  5LGN B;  4UV9 B;  1ZKE A;  4ZJS A;  2WY2 A;  2ZM8 A;  3A7M A;  4JEH B;  4J2C A;  1MIW A;  1M62 A;  1G73 A;  5E0O A;  2QVA A;  2XJ7 A;  5FY1 A;  3UU4 A;  2D0U A;  4UM3 A;  4X5T A;  1BR0 A;  5ETW A;  2XQ7 A;  1WR6 A;  1HNZ T;  2DWG A;  1GQE A;  1N33 T;  5JDQ A;  4PK4 A;  3FXE B;  4HE8 A;  3TLS A;  3PUW F;  3MAC A;  5J0Z A;  2H89 A;  4AFG A;  2V26 A;  2J1D G;  4EB6 E;  3RYH E;  4MFR A;  3Q2M A;  3UU8 A;  2ODV A;  2BZB A;  5CB4 E;  3KDS E;  2Y57 A;  2WU5 A;  3ZMU B;  2LM9 A;  3FZL B;  4O2B E;  5H6R B;  3T1H T;  3K3Q C;  4QH4 A;  4YTM A;  2XNU A;  5FVK A;  1LVF A;  2QYW A;  3UFG A;  2NW9 A;  2X67 A;  1QSD A;  3PDY A;  4O4J E;  5AFK A;  4IE4 A;  2Y56 A;  2CBJ A;  4HWD A;  3C51 A;  1MNE A;  2HH7 A;  4KP3 C;  1UX2 A;  3CKD A;  3NRX A;  4JI5 T;  2J47 A;  5CA0 E;  4C91 A;  3AE9 A;  3BQL A;  3H3M A;  3ZJ1 A;  2NOX A;  4NIQ A;  5AFM A;  1ZEE A;  3N9Q A;  5AFJ A;  4UM1 A;  4QXC B;  2BS2 A;  4N78 D;  5J2T E;  2X9Y A;  5JDL A;  3DTO A;  2BR8 A;  2FJE A;  4DBQ A;  2R6G F;  4QXB B;  4AQY T;  4IST A;  2MYS A;  2IC6 A;  4O8S A;  3U8L A;  4U33 A;  2M6B A;  2ZJU A;  4CZZ B;  4YSZ A;  5ABG A;  5HWX A;  2CXL A;  5JDH A;  3PMZ A;  2CE7 A;  1Z8U A;  2JMK A;  3F2E A;  3WAJ A;  1HX8 A;  3QB5 A;  4PK5 A;  4YSY A;  3H37 A;  3QK6 A;  2PTF A;  3U8K A;  2YN6 A;  1YXR A;  4ZK1 A;  2XNV A;  3NZP A;  2BYS A;  4GOU A;  3WTM A;  2CMR A;  2I6H A;  5FXV A;  4V1A v;  1SE7 A;  2WM9 A;  2BS4 A;  2CBI A;  1R8I A;  5AQN B;  4JI0 T;  3AXJ B;  4IL4 A;  3RIF A;  3AE8 A;  3AE1 A;  4HGA A;  5C2T A;  4ZI3 D;  2BG9 B;  1XMO T;  3AEG A;  3EI0 A;  4UM3 S;  5JDM A;  2E9X B;  3U8J A;  3RH3 A;  5CO5 A;  5L4E A;  1T72 A;  2WZY A;  4UVC B;  3HKE E;  5HCM A;  3FZH B;  4ZS2 A;  2ODU A;  2HPL A;  2C5I T;  2H7V C;  4UEL A;  1I94 T;  2EHO D;  5FXW A;  3RIU A;  5HYA A;  1X79 A;  2BKO A;  2YME A;  4UIG A;  2MTQ A;  3CQC B;  3A5X A;  3B5M A;  5SYO A;  4AI6 A;  3UT5 E;  5L3C B;  1BR4 A;  4KUM B;  4Z8X A;  3C4Z A;  1BR2 A;  3C64 A;  3O9X A;  5HEJ A;  1ZP0 A;  2X0H A;  4OFZ A;  5HAX A;  4AKL A;  2UUC T;  1HG5 A;  4LF4 T;  3PE0 A;  4PAG A;  4NZB A;  3QUJ A;  4UY2 A;  1WYC A;  1WRD A;  1WCR A;  2VKH A;  3TLW A;  3AVR A;  2CA5 A;  3AA6 B;  2XQ5 A;  2JQQ A;  5AQR B;  4ZOL E;  3K8P C;  3IEE A;  2C9T A;  4BA9 A;  4TX5 A;  4QX7 B;  2V7J A;  5FP3 A;  1UX4 A;  3AEF A;  2W00 A;  2W0G A;  4A97 A;  2E9X A;  2VQE T;  3ZEF B;  3SQ6 A;  3RQU A;  4WW0 A;  1OED E;  4KHZ F;  4DUZ T;  5A1L A;  3CPZ A;  4UF0 B;  4PIR A;  2X0Y A;  1MIV A;  3Q5E A;  3FHN A;  4TWH A;  3PV0 F;  3AA0 B;  1QLB A;  4LF6 T;  3PU3 A;  3WTI A;  3LBX B;  2W8G A;  2BJ0 A;  2A2F X;  4HQP A;  5JDN A;  5LJN A;  3W15 B;  5LBQ B;  3UUX B;  1O3X A;  5DAB A;  4JYA T;  2WNJ A;  2WAU A;  2KMF A;  3I0Q A;  3Q9D A;  2ZM6 T;  3V5U A;  1IAP A;  3G06 A;  4FI5 A;  5FY7 A;  4B6X A;  3AA7 B;  4IL9 A;  1MMG A;  1FMV A;  2AXD S;  2FJB A;  4AIS A;  2WNL A;  4I0U A;  5CFB A;  5EZY E;  1E7P A;  5L3B B;  2RA1 A;  3ZJ2 A;  2QGS A;  3B13 A;  3RC8 A;  1T8B A;  4YLH A;  5AFL A;  3L8R A;  3SIO A;  4DV3 T;  4ISS A;  2B1E A;  1KF6 A;  2M6I A;  5ABF A;  4K0U A;  3PUV F;  5AQO B;  5AQM B;  4DMW A;  3Q5X A;  3KFW X;  3RF1 A;  4K0K T;  3IBP A;  2BBJ A;  4KBM B;  3ZKR A;  5DQV A;  3HKD E;  4QWN B;  4UF0 A;  5L3E B;  5AQG B;  1UUR A;  4UXU A;  3UTK A;  1DU2 A;  1W0A A;  5LHI B;  1MMA A;  1IJ6 A;  5AQH B;  4AKI A;  4HFB A;  3LFM A;  2WDV A;  2XAH B;  4U7I A;  3HKB E;  3WTO A;  2X0L B;  1HG2 A;  3U3I A;  3I9Y A;  3UUB A;  4F8H A;  4ZI2 C;  2CXD A;  2XAS B;  1S35 A;  2K9A A;  3C84 A;  4PFP A;  5BRX A;  3AVS A;  5IYZ E;  3JC6 D;  3FBZ A;  4TWD A;  3CQX C;  4X1K E;  2MOZ A;  4EZ1 A;  5LJM A;  2LHN A;  1JNZ A;  2EHO C;  5J2U E;  4QH5 A;  2XY8 B;  3GN5 A;  2JQK A;  2W63 A;  4NXN T;  4EZ4 A;  4A98 A;  5KMG P;  4KI0 F;  3FB2 A;  4I43 B;  4IE6 A;  2HHH T;  1ZV4 X;  1Y01 A;  4U74 A;  4P09 A;  3OPC A;  2WWV A;  5JH7 E;  4UV8 B;  1QUU A;  1LRZ A;  4DID B;  4LFA T;  5F5W A;  2X00 D;  5ADX L;  3CX6 B;  4X65 T;  3TLV A;  1D0Y A;  3OYZ A;  4D01 A;  4EED A;  1VRB A;  3VHL A;  3UU3 A;  1OXZ A;  4AFH A;  5FYM A;  2NW7 A;  2WZH A;  3ZMZ B;  1HX1 B;  4TNW A;  3RYC E;  3AE2 A;  3MKD A;  4IDQ A;  5F3J A;  3WI3 A;  5AQI B;  4I4T E;  2H7O A;  5KXJ A;  3AE5 A;  4ZI7 E;  4ZXL A;  5IHY A;  5AFU L;  4IE7 A;  4QAB A;  2F4V T;  3AAA B;  3I1A A;  3K1S A;  1OWA A;  2X9H A;  4U2Z A;  2X66 A;  4M1P A;  5JRC A;  2FJD A;  3D0T A;  5AFM B;  4JI4 T;  4QAC A;  3EUH A;  2K48 A;  4UVB B;  2WQY A;  4DR6 T;  2PG8 A;  3HR0 A;  1I9B A;  5JVD E;  3QC9 A;  2WCA A;  2LSI A;  2VK9 A;  2V8S V;  3ZYL A;  4DO0 A;  3AEE A;  1UX5 A;  4H9O C;  4GYS A;  2BS3 A;  5AQF B;  3O4X E;  3UUL A;  1UCU A;  2UXD T;  4FRR A;  2UXC T;  1XMQ T;  4IGU A;  3J7Y q;  4WNK A;  2K5B B;  3RIA A;  3PEO A;  4O4L E;  3DP7 A;  2C0S A;  4JLE A;  5LA6 E;  5JME A;  3C50 A;  5HWY A;  4AKH A;  1LKX A;  2JJ9 A;  4WBN E;  1UUS A;  2VQF T;  2X9X A;  3BQK A;  1V9D A;  2H88 A;  3QNU A;  3I0O A;  4IDZ A;  4A5X A;  2ACZ A;  3SQ9 A;  4IHJ E;  4LMJ A;  2Q9Q C;  4LF8 T;  4U7Y A;  3TLU A;  3OYX A;  2N1G A;  5LCY A;  2N9D A;  1OED C;  4GKK T;  1HTJ F;  2LT3 A;  5BMV E;  5C8Y E;  2NP9 A;  4OK0 A;  3ZT7 A;  3ZLI A;  5DJQ C;  3ZDG A;  2ACX A;  1S94 A;  4EEB A;  5AQP B;  4UEM A;  1EZ3 A;  2DI4 A;  2LEH A;  2CXF A;  4QAA A;  3ZT6 A;  4ZRU A;  3P4P A;  3L09 A;  1XNQ T;  1X9B A;  4CXW A;  4CN1 A;  5LHH B;  4TUY E;  5EK3 A;  4JI8 T;  2N2N A;  4B3S T;  3ZSS A;  4NPP A;  4DV4 T;  1IJ5 A;  4L5G A;  3QOF A;  2YU2 A;  3PUY F;  2H3R A;  4DV2 T;  4DR3 T;  4O4H E;  4AQG A;  3RLF F;  3ONL C;  3L39 A;  5JR9 C;  3ZST A;  1IZN B;  3CQG B;  2KT9 A;  4PJJ A;  2KWH A;  1KNP A;  1US7 B;  4JV5 T;  5H6Q B;  1MMD A;  2D5U A;  2LOP A;  5AQK B;  4E7S A;  2IDO B;  3ANW A;  4ILU A;  4YTP A;  3X1D A;  3GA8 A;  5EK2 A;  2DCF A;  4TWF A;  2BG9 E;  2WBL A;  2YOE A;  2V1D B;  3JCF A;  2VKJ A;  5FNV E;  3U8N A;  1SA0 E;  3FBL A;  4CI1 B;  3OTO T;  3FXD B;  2V7M A;  3N2O A;  4IDP A;  4BAY B;  4I55 E;  1WYB A;  1J1J A;  2CLY B;  4P0B A;  3CX7 B;  4O2A E;  5LP6 E;  2PBI A;  5LXB A;  3VR8 A;  2XZE A;  3FZK B;  3IHR A;  2IML A;  1ZOY A;  4H63 H;  3PTR B;  3DJB A;  1N36 T;  4X64 T;  2YKS A;  5ABH A;  2UU9 T;  2K3W A;  3AE7 A;  4HN9 A;  4B5D A;  1VCS A;  2X68 A;  5HEU A;  5L47 A;  5FL0 A;  3AE6 A;  1YW0 A;  2LE8 A;  3RKO A;  2ZM0 A;  4DR4 T;  1HNW T;  1UW6 A;  3ETU A;  5LG4 A;  5J1G A;  4ADZ A;  4DV6 T;  4AFT A;  4X1Y E;  4L0R A;  3R84 B;  1HCI A;  3UQ4 A;  4ZZC A;  1YD8 G;  3M3Z B;  2IW5 B;  2V7I A;  4ILA A;  3O1H A;  2XAQ B;  3WIP A;  2YK0 A;  5JQG E;  2PJQ A;  2OLT A;  4EOZ B;  2Y6X A;  2E9X D;  4ZJT A;  2XYT A;  2W4X A;  4H63 V;  3JAD A;  2GK9 A;  1U5P A;  2XQ4 A;  5L4H A;  2DWK A;  4TV8 E;  2BR7 A;  2W2U A;  2XQY A;  5HEO A;  4TN7 B;  5CGM A;  3UFE A;  4DV7 T;  3AEB A;  2IAK A;  4QH1 A;  3LK3 B;  4IT4 A;  5ABF B;  2VKO A;  3U8M A;  2V7K A;  2V7L A;  4AQF A;  5CA1 E;  3ZCI A;  2IC9 A;  2XHE B;  4Q25 A;  3T8O A;  3UU5 A;  4ALX A;  3CX8 B;  1IBM T;  2L9Q A;  2LRK A;  2LOS A;  3UQ7 A;  3KBU A;  2PGZ A;  3HL6 A;  4ZR6 A;  2V5D A;  2XSB A;  5AFH A;  3E22 E;  2IHR 1;  5AQJ B;  3RHW A;  3M65 A;  3ZPO A;  2BYP A;  2C5K T;  4TZ4 C;  5LHG B;  2E5V A;  4DR5 T;  3GUA A;  2E5L T;  4DBM A;  1UGO A;  2VL8 A;  3KV6 A;  2PFV A;  4U72 A;  4CI3 B;  1OED B;  2XSA A;  3PUS A;  2KWI B;  3N9N A;  4HEA A;  1KNZ A;  4JI6 T;  3ONJ A;  3NZQ A;  4HFD A;  1KK7 A;  3GN5 B;  5LXT E;  4ANJ A;  4LMK A;  2JRK A;  2YMD A;  2LSG A;  4PJL A;  5BR8 T;  4JBW F;  1N34 T;  4GK0 E;  2V6Y B;  1W9R A;  4G63 A;  4LFC T;  2WN9 A;  3E0Z A;  4YY3 T;  4EV6 A;  4YTN A;  2MAW A;  2VKD A;  2BYN A;  2L3L A;  4ILB A;  3SRZ A;  3ZDH A;  5J5H A;  1D0Z A;  3S4U A;  2CM0 A;  3ESL A;  3JAF A;  4X66 T;  4CN4 A;  4AKR B;  5LGU B;  1MND A;  5FJV A;  4ZI3 C;  2IIU A;  3WTL A;  5IWA T;  2Q9Q A;  4QHO A;  1VCT A;  2CRB A;  1BR1 A;  1OED A;  3WTK A;  1N32 T;  1I6Z A;  3N5L A;  4JI7 T;  5LMN T;  5EK4 A;  5AFN A;  1KNR A;  2HPJ A;  5JRE A;  5JRC B;  3UU6 A;  5FMN A;  2XQ8 A;  4WYV A;  3MK7 C;  2BVM A;  4X1I E;  3RKG A;  1B7T A;  2LKH A;  4WZX A;  1SUM B;  5FXX A;  3PJA J;  2IUB A;  5JDF A;  4EAH A;  3O1I A;  4IDO A;  1XDP A;  4H9R C;  5LGT B;  2V6Y A;  4BJM A;  3SS1 A;  1CUN A;  3NBX X;  3P4R A;  3C4X A;  5TVC A;  3OVU A;  3VR9 A;  4B3T T;  2BG9 C;  2VUR A;  4PNI A;  3PUX F;  4CQI A;  2VAS A;  2E9X C;  2JPF A;  1HFA A;  4QXH B;  2CWY A;  4ILC A;  5AQU B;  4UXN B;  2XQ9 A;  5JR9 A;  4LF9 T;  3OJA A;  1MMN A;  4LML A;  5AQT B;  4C90 A;  3AE3 A;  3RC3 A;  3ONX A;  1LVK A;  3AE4 A;  2WP9 A;  3IA3 A;  3ZN0 B;  1UK5 A;  5LNK A;  2D2S A;  2NTY A;  2KND A;  3N2G E;  5LG3 A;  2MBG A;  2VVS A;  2UXN B;  4XHE A;  2WB5 A;  4EYU A;  2LHR A;  4NUU A;  4AXP A;  3WTJ A;  3ZC0 A;  3N9L A;  2Y54 A;  4OX9 T;  2WWU A;  3NKZ A;  2RP4 A;  2XAF B;  2LSJ A;  2JIW A;  2DNX A;  4FJO A;  5LBM A;  5BW2 A;  4OYK A;  4A56 A;  4O4I E;  2W66 A;  4DBR A;  4BFQ A;  3VKG A;  3ZMV B;  2MPK A;  2YDS A;  2XNT A;  4OYJ A;  2WU2 A;  1D0X A;  5FXZ A;  4DV1 T;  2XUE A;  4CN6 A;  2Y8D A;  3ZCJ A;  3AEC A;  1FEW A;  5GON E;  1HF8 A;  2XTL A;  4ZEY A;  4EZH A;  1D1A A;  5FL1 A;  5JTG A;  3Q5D A;  5CJ5 A;  2LM2 A;  5HXH A;  1XWM A;  4H9S E;  3LG7 A;  5JDG A;  2CHN A;  4TNV A;  4F6R C;  2Y58 A;  4HWH A;  4ZK4 A;  4KX6 A;  1Z0P A;  5M4Y A;  4JUY A;  3TKL B;  3AAE B;  5J5F A;  3MJX A;  3IGQ A;  1HS7 A;  4NUV A;  4YJ3 E;  5J5G A;  3RRW A;  3ANW B;  2LJL A;  4HFE A;  3WTH A;  3VU7 H;  5LMU T;  4HWI B;  3SFD A;  3CWZ B;  4P1N A;  2E8I A;  1FMW A;  4L9I A;  3PUZ F;  4JI1 T;  2DL1 A;  3FZF B;  5AQS B;  3KIN B;  2WSS V;  4UR9 A;  2A3D A;  2XAJ B;  3EHZ A;  2VL0 A;  1T7S A;  5J5I A;  2YDQ A;  2NWB A;  5DQW A;  3N9O A;  2Z6E A;  2VWA A;  2XQ3 A;  4ZZB A;  4I50 E;  4U31 A;  3P7I A;  2CPT A;  4MLK A;  1IBK T;  4KHP T;  2QA7 A;  3JC6 C;  3RPU A;  4GYR A;  3P4S A;  2NR4 A;  4MBQ A;  3CIR A;  1E1H B;  3AAI A;  3C98 B;  2AE9 A;  4Z90 A;  4LF7 T;  4CXX A;  2E2A A;  2I0M A;  3H3A A;  2B76 A;  2UZ6 A;  2ZM2 A;  2XAG B;  4IE5 A;  5FVL A;  3N9M A;  5HEH A;  4PJN A;  2ZJV A;  3MZK B;  3AA1 B;  2WZI A;  2SPC A;  2OA5 A;  2YDR A;  4DR7 T;  3T1Y T;  1NEK A;  2WNC A;  2K24 A;  4DUY T;  2KZ7 B;  2WMN A;  3RI5 A;  3B57 A;  2WDR A;  2UUB T;  1WLX A;  2OV9 A;  4LF5 T;  2EHO B;  4MHC A;  5LB7 B;  2DLR A;  4IDN A;  3BK9 A;  4LFB T;  3TLT A;  5BP0 A;  5L3D B;  3O1J A;  3SOL A;  3K3O A;  3VRA A;  4IE0 A;  3MXZ A;  2VVN A;  3F57 A;  3ZMT B;  2A9U A;  1NWM X;  1YKH B;  2WDQ A;  3ZMS B;  4X62 T;  2UXX B;  4NXM T;  4YHJ A;  4TV9 E;  3ABV A;  4PW8 A;  4YJ2 E;  5HEG A;  4ZI2 D;  2XM2 A;  4ZHQ E;  2LKG A;  1MIY A;  3QB5 K;  4MAL A;  5FKY A;  2QRX A;  3T4M A;  2ZLY A;  3N2K E;  2JMH A;  3NRY A;  2JQH A;  4YT0 A;  2Y48 B;  2UUA T;  4ASK A;  1J5W A;  4GK5 E;  2KXP B;  4WBO A;  2ES0 A;  2VB6 A;  2X51 A;  1NAF A;  3P50 A;  1YKE B;  1FIO A;  5L3F B;  2YU1 A;  3A8Y C;  2ZMA A;  1U4Q A;  4AKG A;  3EVY A;  3P4Q A;  3J9X 1;  3PUR A;  1VOM A;  3AED A;  4DMV A;  4EXT A;  4HWC A;  2KSR A;  5LYJ E;  1ZHC A;  3VRB A;  5IUX A;  2BYR A;  5LOV E;  2EHO A;  1FJG T;  4UM3 P;  2D0T A;  3L3P A;  3GMI A;  3JAE A;  1NEN A;  4YFS A;  3RQW A;  5FY0 A;  3AEA A;  2V5C A;  2LSY A;  2W8F A;  2J4G A;  3OBV E;  3CML A;  3AXJ A;  3LDQ B;  2LLY A;  2L8K A;  3UUM A;  1KFY A;  3P4W A;  3Q5W A;  2BG9 A;  4P0A A;  1D1C A;  4BQT A;  4HWF A;  4XAX B;  3UUN A;  4ZS3 A;  1Y64 B;  5KX5 E;  5KE4 A;  1D1B A;  5AQQ B;  1KEY A;  4E7Z A;  3ZYK A;  4B3R T;  5F8P A;  2V6X A;  4CI2 B;  4GIW A;  3ETV A;  3PUQ A;  1WFD A;  4KMC A;  3HA4 A;  3LK2 B;  3IF8 B;  2RPA A;  2QC1 B;  3NVO A;  3ZN1 B;  3E08 A;  3RGL A;  4DV0 T;  2NTX A;  2Q9Q B;  3EAB A;  3GWH A;  3LSV A;  2UXB T;  4G2A A;  3KV9 A;  3SFE A;  2LRL A;  5C3J A;  3MA9 A;  2NW8 A;  4XZC A;  4COF A;  1IBL T;  2KLQ A;  5AQL B;  2HN1 A;  4HFV A;  4IIJ E;  3C4W A;  4B3M T;  2W61 A;  3PUG A;  2XZ5 A;  3KVB A;  4H9Q C;  4GKJ T;  3BQI A;  2BBH A;  1E2A A;  3I9W A;  2BKN A;  3P8C D;  3NWI A;  2A72 A;  4U3C A;  2BKP A;  1T98 A;  2W67 A;  4X20 E;  4BJN A;  1XNR T;  4EIW A;  4EYY R;  2XYS A;  1W0B A;  3HKC E;  5HXR A;  2DHR A;  4WV9 A;  4ERR A;  3LK4 2;  3SWH A;  3LJC A;  2Q9Q D;  3V5S A;  2XQA A;  2M67 A;  3RYF E;  1JNR A;  4HKA A;  2FJA A;  1AJ3 A;  2X9W A;  4DVD A;  3U78 A;  4UVA B;  5JR9 B;  2XPK A;  3EDV A;  2XM1 A;  4HTE A;  1XZY A;  1H7C A;  4IRE A;  2J62 A;  4JI3 T;  3RIU C;  3ZYM A;  1XDO A;  2FBW A;  2CWO A;  4AIU A;  3LBX A;  5KZU A;  4H9N C;  2P9B A;  4U2Y A;  2C5J A;  1YQ3 A;  3C79 A;  3SH1 A;  4XBF B;  4H9P C;  3WAK A;  3ZT5 A;  3OKQ A;  5KDM C;  3ZC1 A;  4YSX A;  4HFI A;  3KV4 A;  4DV5 T;  2KIN B;  4PFO A;  4QKN A;  1HR0 T;  3F31 A;  3N9P A;  2D9D A;  2I59 A;  2XZ6 A;  4DR1 T;  1M7K A;  5AIN A;  1G8X A;  5TAO A;  2FUP A;  3EAM A;  1SHZ C;  5L3G B;  5HXC A;  1J5E T;  2WS3 A;  3CVR A;  3PU8 A;  4PJM A;  3WTN A;  2W62 A;  4OHF A;  1YQ4 A;  2CLY C;  4QX8 B;  4JI2 T;  2CCQ A;  2XQ6 A;  5HXE A;  2HN2 A;  4Z91 A;  4DR2 T;  3RRC A;  3R6N A;  2CEA A;  2WMO A;  3K3N A;  2YIN A;  3CK6 A;  5HCJ A;  4DND A;  3VKH A;  4AQF C;  1UV6 A;  3KVA A;  2CHO A;  3KV5 A;  3RYI E;  3PUA A;  4PK6 A;  3FZM B;  4JEU B;  3RX6 A;  2BVL A;  3EDU A;  3HI2 A;  2G0U A;  5L2L A;  4CXY A;  1WR0 A;  1HNX T;  2JQ9 A;  4HFC A;  5ABE A;  4XK9 A;  4YXD A;  4YHH T;  3PJA A; 
#chains in the Genus database with same CATH homology
 2M6I A;  5JME A;  2X00 D;  2X00 A;  2XNT A;  3T4M A;  3WTM A;  3TLV A;  5KZU A;  2XQ5 A;  4D01 A;  4ILA A;  2QC1 B;  2LKH A;  2C9T A;  3WIP A;  3C79 A;  1UX2 A;  4IL4 A;  3SH1 A;  3RIF A;  2PH9 A;  2BYQ A;  3ZKR A;  2Y7Y A;  4HFD A;  4HFH A;  3UU3 A;  3LSV A;  2LM2 A;  4A97 A;  4AFH A;  4LMK A;  4ZJT A;  4HFI A;  2XYT A;  4TWF A;  2BG9 E;  3SQ6 A;  2YOE A;  4Z90 A;  2YMD A;  3RQU A;  4UXU A;  1OED E;  2BG9 B;  4ZJS A;  3P50 A;  5AFM A;  4COF A;  4TNV A;  2UZ6 A;  3SQ9 A;  3JAD A;  4LMJ A;  4TNW A;  3U8N A;  2Y58 A;  5TVC A;  2XQ4 A;  5AFJ A;  5L4H A;  3EI0 A;  4UM1 A;  4UM3 S;  5HEH A;  2BR7 A;  4ZK4 A;  4HFB A;  4PIR A;  3TLU A;  2XZ6 A;  3U8J A;  5HEO A;  2ZJV A;  2BG9 C;  5L4E A;  5CO5 A;  4TWH A;  1OED C;  3UU4 A;  2WN9 A;  5AIN A;  2WZY A;  3WTO A;  4UM3 A;  4X5T A;  4QH1 A;  2XZ5 A;  2XQ7 A;  5HCM A;  3EAM A;  3WTI A;  3U8M A;  2KSR A;  5J5F A;  2BR8 A;  3UUB A;  2WNC A;  4F8H A;  3TLS A;  4ILC A;  2W8G A;  3WTN A;  5LXB A;  3IGQ A;  4ALX A;  3UU5 A;  2MAW A;  5IUX A;  2BYN A;  4QAB A;  5J5G A;  2BYR A;  3ZDG A;  2XQ9 A;  5J0Z A;  2BJ0 A;  3RI5 A;  4UM3 P;  4HQP A;  3C84 A;  5BRX A;  4LML A;  2XQ6 A;  4AFG A;  4HFE A;  3U8L A;  3WTH A;  4ILB A;  2M6B A;  2YME A;  2ZJU A;  3ZDH A;  4TWD A;  4Z91 A;  2YKS A;  3JAE A;  3UU8 A;  5J5H A;  3UQ7 A;  5AFM B;  5SYO A;  4QAA A;  2XYS A;  3RQW A;  4ZRU A;  4QAC A;  3JAF A;  2PGZ A;  4EZ1 A;  2WNJ A;  4ZR6 A;  4WV9 A;  5HCJ A;  2Y57 A;  3TLT A;  5BP0 A;  5LG3 A;  1I9B A;  1UV6 A;  5AFH A;  2W8F A;  5FJV A;  4B5D A;  5HEJ A;  3WTL A;  5HEU A;  4XHE A;  2LLY A;  5L47 A;  3RHW A;  3PMZ A;  2XQA A;  4QH5 A;  3EHZ A;  2BYP A;  4NZB A;  3P4W A;  3WTJ A;  2VL0 A;  2Y54 A;  4UY2 A;  4NPP A;  4A98 A;  2BG9 A;  4IL9 A;  4QH4 A;  1OED A;  3GUA A;  2XNU A;  3WTK A;  4BQT A;  1UW6 A;  3U8K A;  5J5I A;  4FRR A;  5KE4 A;  2YN6 A;  2WNL A;  5CFB A;  5BW2 A;  4ZK1 A;  4DBM A;  5AFK A;  5AFN A;  2XNV A;  4AFT A;  3TLW A;  4HFC A;  5HEG A;  2BYS A;  4XK9 A;  2XQ3 A;  3RIA A;  4BFQ A;  5AFL A;  3UQ4 A;  2LKG A;  3UU6 A;  4ZZB A;  1OED B;  4IRE A;  4ZZC A;  2Y56 A;  3PEO A;  3SIO A;  2XQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...