3TLTA

The glic pentameric ligand-gated ion channel h11'f mutant in a locally-closed conformation (lc1 subtype)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAFIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tltA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tltA01
2M6BA 2WNJA 1UX2A 5L4HA 4IL9A 4AFHA 4A97A 5LXBA 2LLYA 4ALXA 3WTKA 4BFQA 1OEDB 5HEUA 3JADA 4TWDA 3C84A 4ILCA 5AINA 5FJVA 1OEDA 4ZZBA 1UV6A 4HFCA 5J5HA 4ZRUA 2Y58A 3SQ6A 2W8GA 4UM3A 5J5FA 2YOEA 3JAEA 2BJ0A 2ZJVA 4QH5A 3IGQA 3TLTA 3UU6A 3PEOA 3WTLA 5BP0A 2VL0A 4D01A 3T4MA 5HEGA 2YN6A 2W8FA 2BR8A 2X00A 4QACA 4AFTA 2ZJUA 3UU4A 2X00D 4X5TA 2XQ3A 4HFHA 3UUBA 4ZK1A 2BG9C 2XNVA 2XQ5A 3TLUA 3WTNA 4ZJTA 2BG9A 5AFMA 3ZKRA 2Y7YA 3RQUA 4ZJSA 5IUXA 2XQ9A 5JMEA 5LG3A 5HEJA 3JAFA 4HFEA 4TWFA 4UXUA 5BRXA 2LM2A 4HQPA 2WNLA 5KE4A 3RI5A 3RHWA 4EZ1A 2XQ4A 4ZR6A 2LKGA 4UY2A 3U8LA 2BG9E 3SIOA 4DBMA 5AFHA 3RIAA 2M6IA 2MAWA 2YKSA 3ZDHA 2LKHA 4NPPA 2XQAA 2C9TA 4XK9A 5J0ZA 2PGZA 3U8MA 5L47A 1I9BA 3WTJA 3P50A 4UM3P 3TLSA 5TVCA 2YMDA 2BYSA 3PMZA 4NZBA 4QABA 5J5GA 4HFDA 2XNTA 3SQ9A 3WTOA 3ZDGA 4HFBA 3UQ7A 2XZ5A 4F8HA 3UU5A 4PIRA 3P4WA 3UQ4A 4WV9A 5BW2A 2Y56A 4FRRA 3TLWA 2BYRA 1OEDC 3RIFA 4HFIA 4ILBA 5HEHA 2KSRA 2BYQA 2PH9A 3WIPA 4ZK4A 4Z91A 4ZZCA 4A98A 3EHZA 3WTIA 4ILAA 1UW6A 2WNCA 5AFKA 5AFJA 2XQ8A 2XYSA 5HCMA 2BG9B 2QC1B 3UU8A 5SYOA 2WN9A 2XNUA 2XQ6A 5AFLA 3U8JA 5AFNA 4Z90A 3C79A 4COFA 2YMEA 4UM3S 4LMLA 4TNWA 4XHEA 5CO5A 5KZUA 3UU3A 5L4EA 2XQ7A 4AFGA 4BQTA 2BYNA 3WTHA 3WTMA 3GUAA 3U8NA 2Y57A 3EI0A 4LMJA 4QH1A 3TLVA 2Y54A 4IL4A 5AFMB 2XYTA 5J5IA 4UM1A 4QH4A 4IREA 3RQWA 2UZ6A 4TNVA 2XZ6A 2WZYA 3U8KA 4B5DA 2BR7A 4LMKA 3LSVA 5HEOA 3SH1A 3EAMA 5HCJA 4QAAA 2BYPA 4TWHA 5CFBA 1OEDE
chains in the Genus database with same CATH superfamily
3DTOA 3KDSE 2VURA 2ODVA 3CMLA 4UF0B 1OEDA 4HFCA 5J5HA 5AQRB 2WZHA 3UU4A 4HFHA 5BR8T 2WDQA 2WMOA 4DO0A 4ZJTA 2UXXB 5LGUB 2H7OA 4QHOA 4YSXA 4XZCA 2IUBA 1HG2A 1YQ3A 5EK2A 2X68A 4YXDA 5HAXA 1XDPA 4ZI7E 1T8BA 5FY1A 5AFHA 2QRXA 2BKOA 2C9TA 4P09A 1M7KA 3UUXB 4ASKA 3OTOT 4E7ZA 4I55E 2V7JA 1HG5A 2HN2A 2V5DA 3RPUA 2E9XC 4A98A 2ZM8A 3PE0A 4U2YA 5AFKA 1D0XA 3ZCIA 3AE1A 3FZKB 4ADZA 2IAKA 4ZXLA 3C4WA 4C91A 2MPKA 2ODUA 4BJMA 3AA1B 4I50E 4DV2T 3RIUC 5ETWA 4PK4A 3ZSTA 4AQGA 4EZ4A 4WBNE 2KLQA 2CRBA 4L9IA 5FP3A 5L3GB 2X0HA 2LLYA 3N2GE 3AXJB 3PJAA 5ADXL 2IIUA 4CI1B 3QUJA 1LVFA 2WAUA 5C3JA 4P1NA 2WDVA 1WLXA 2XASB 4EOZB 2H7VC 2BDEA 2ZJUA 3UUBA 5JREA 4X1IE 4NXNT 5LG3A 2LSYA 5HXEA 1Z8UA 2XY8B 2QGSA 4EB6E 3PURA 4PK5A 5L3DB 2ZLYA 1B7TA 4NPPA 4NUUA 3VRAA 2C5IT 2NTYA 2VVNA 3HKEE 5JVDE 2I0MA 5FXXA 4EIWA 2OV9A 3IHRA 3B13A 3X1DA 4F8HA 4H9OC 4IT4A 1OEDC 3GWHA 4ZZCA 3FZMB 3PUAA 3ZJ1A 4WZXA 3OYXA 3J7Yq 2XYSA 2ZM0A 4H63V 2LHNA 2Y48B 1SA0E 4MLKA 5M4YA 4CQIA 2JPFA 3AE9A 4C90A 4H63H 4CXYA 3ZC1A 2X67A 1IJ5A 2AE9A 2XQ7A 3QK6A 2LJLA 4DBQA 3KV4A 2XM2A 3RC8A 2LE8A 4CXWA 5JRCB 4X65T 3HL6A 3AEGA 3ONLC 3N9MA 5HCJA 2WNJA 2M6BA 5LJMA 3ANWA 1OXZA 3KV9A 2DI4A 4A97A 3LG7A 4ALXA 3NVOA 4DV6T 2CMRA 4ILCA 2V7LA 5EK4A 2A2FX 5E0OA 3J9X1 2ES0A 3AEFA 5J5FA 5LMUT 3CQCB 5JR9A 3KV6A 2WU2A 2PG8A 2W4XA 2XNVA 4O2AE 3ZKRA 1VCTA 5HWXA 3NKZA 2UXBT 2XQ4A 3L8RA 1J5WA 3HA4A 4A56A 4EYYR 4ZR6A 2VWAA 3VHLA 3ETUA 2N9DA 3NRXA 3ZSSA 1I9BA 5AQJB 3TLSA 3IF8B 2LM9A 1CHUA 3PMZA 3MJXA 3P4RA 3RF1A 5JR9C 4CI2B 3JC6C 4X1YE 2BKPA 1IBMT 4LF4T 1KNRA 3VU7H 4B3MT 3UUMA 3C4ZA 5JR9B 2XQYA 4OHFA 3HI2A 3AE5A 2BVLA 2KXPB 2WWVA 5LG4A 4YSYA 3KINB 3SFDA 4G2AA 5AQTB 3UULA 2MOZA 3ZYMA 4L0RA 3U8KA 2LSIA 2PBIA 3V5UA 4K0KT 4GK5E 4YTMA 2BVMA 1FJGT 1FEWA 5L4HA 2CXFA 4HKAA 5HEUA 2VKJA 4PK6A 2Y58A 3CX6B 2D9DA 2HPJA 3MKDA 3PEOA 2VL0A 2YDQA 4AFTA 5IWAT 2XQ3A 4OYKA 3FBZA 2LT3A 1KNZA 1KEYA 3ZMVB 2XQ9A 3UFGA 1UK5A 2EHOD 3RHWA 3RGLA 2LKGA 2WCAA 4OFZA 2BG9E 2IC9A 3Q9DA 2CCQA 3W15B 4N78D 4YY3T 4K0UA 1HS7A 2WBLA 3QB5A 4NZBA 4MFRA 4UV8B 2XZ5A 1LRZA 3EABA 2Y56A 4FRRA 3LK2B 4DR5T 3CX8B 1KNPA 4Z91A 4OX9T 3N5LA 3K3QC 2DCFA 1XDOA 3P4QA 1MMGA 4JUYA 3N2OA 5C2TA 2W66A 4BAYB 4X1KE 4AIUA 4DIDB 4GKKT 2BYNA 4DMVA 3QNUA 2KWIB 3C50A 3CVRA 4GIWA 2BS2A 3K1SA 5FKYA 2WY2A 1J1JA 3H3AA 3RRCA 1V9DA 1FMWA 5JDQA 2VQFT 3T1YT 1LKXA 4AI6A 3AXJA 3ZC0A 4DUZT 3CX7B 4YHHT 3PUZF 3PUWF 5H6RB 4ZHQE 3SQ6A 4UM3A 3O1IA 2BR8A 4QACA 4DV7T 3AECA 2H88A 3SFEA 3O1HA 3TLUA 2LEHA 3ZT6A 5F5WA 4ZI3C 1WRDA 4HQPA 4HFVA 1NENA 2VL8A 2RP4A 4YJ3E 3P7IA 2H3RA 2YK0A 4BJNA 2WM9A 3AE6A 1HX1B 2Q9QD 5LBMA 1U5PA 2BBJA 5CB4E 3UQ7A 3ONXA 4JLEA 1UX5A 1T72A 4O4JE 5AQKB 4KHZF 4U3CA 5L3BB 3WTIA 4ZI2D 3JCFA 2WNCA 1YW0A 4EYUA 3FBLA 4LMLA 4TNWA 5KDMC 4H9RC 3AAAB 4LFAT 4AFGA 3U8NA 4QWNB 3FHNA 2E9XB 4PAGA 3O1JA 2V7MA 4MBQA 5J2TE 4QXCB 3L3PA 5JRCA 4IE6A 5EZYE 2YU2A 3RKOA 3FB2A 4IE4A 2CM0A 4KX6A 4ZS3A 5LHIB 3ANWB 3AE8A 1N32T 1WCRA 4ZRUA 2J47A 5IHYA 3PV0F 1N33T 3WTLA 4O4HE 2W0GA 2YN6A 2XZEA 3NWIA 3C4XA 2YEVC 2JRKA 3Q5WA 4IE7A 3RYFE 4EAHA 2XQ5A 3I9WA 3NBXX 2WP9A 4HFEA 4I4TE 3FXEB 4PFPA 2HH7A 3UFEA 4IDNA 3C64A 4U7IA 2C5KT 2HPLA 2W2UA 4EXTA 3G06A 2XQAA 1MIWA 1O3XA 3WTOA 4CI3B 2HHHT 2LRKA 5FYMA 1W9RA 4X66T 3ONJA 1MMDA 1EZ3A 4HFIA 4ILBA 3AEEA 2XQ8A 3R84B 3O4XE 2EHOB 5ABEA 5CO5A 1HTJF 4GKJT 4U33A 4IL4A 3PDYA 4QH4A 2UZ6A 2D2SA 5LNKA 4UELA 3I9YA 2UXNB 3UT5E 4B5DA 2BR7A 3RLFF 1S35A 5FY0A 1IBLT 1D0YA 1HCIA 4MHCA 5HXHA 1ZKEA 1UX2A 4EEBA 3ZMSB 5KXJA 1IZNB 1KFYA 3KFWX 4TWDA 5L2LA 2V7KA 5LMNT 1X79A 1UURA 3VRBA 4HTEA 4H9QC 4HGAA 1UGOA 4EZHA 4EEDA 1G8XA 1SUMB 1MNEA 1E7PA 5BRXA 3GMIA 5J1GA 3P4PA 5KE4A 2X51A 1QUUA 4KHPT 3U8LA 2NW9A 1E2AA 2JQQA 4A5XA 4KP3C 2E5LT 5JDGA 3WAJA 3ZT5A 2LSGA 4QX8B 4HFDA 2PJQA 5DQVA 4UVCB 3Q5XA 3UU5A 4PIRA 2VVSA 4Z8XA 5JQGE 2FUPA 3ZN0B 3LK42 1UW6A 4ANJA 4X64T 2PTFA 3UU8A 2XNUA 5J2UE 2XAGB 4JI0T 1N34T 2FJEA 4COFA 3AE4A 2DWKA 1WYBA 4XHEA 2X0LB 2KT9A 2KZ7B 3TLVA 2VKOA 3NZQA 3L39A 2VQET 3ABVA 4TZ4C 4DR1T 3I0QA 4IGUA 1D0ZA 2C5JA 5LGNB 4WW0A 5LHHB 4X20E 2E8IA 4PJLA 5DABA 4AFHA 3AE2A 2AXDS 4XBFB 2V8SV 4ZZBA 4DR6T 2K3WA 5AQHB 1E1HB 3CKDA 3CQXC 3ZT7A 5LJNA 3OJAA 1XNQT 4LF5T 5FL0A 4B3RT 2KNDA 3K8PC 3RQUA 2X9XA 3RI5A 3P8CD 3R6NA 3ZLIA 3SIOA 2M6IA 2Q9QC 4P0BA 3CIRA 1YD8G 3CQGB 2UUCT 3AEAA 4JI2T 4AKLA 1IJ6A 3HR0A 4P0AA 4HFBA 2X0YA 3KVBA 2IW5B 4CN6A 3AAIA 5HEHA 2DWGA 5ABHA 4CN1A 2K24A 3E0ZA 2BG9B 2QC1B 1VCSA 3PJAJ 4Z90A 2E2AA 3PUVF 3AAEB 5KZUA 2LRLA 3LDQB 3WTMA 2Y57A 3N2KE 4LMJA 4QH1A 2WDRA 2Y54A 2X9HA 4EGWA 3ZPOA 2E9XA 2K9AA 3CK6A 5AQPB 3EAMA 1XWMA 5JH7E 2HN1A 3C98B 4HEAA 3BQLA 4JEHB 2W00A 4UVBB 3C84A 5H6QB 1YXRA 1G73A 2VKDA 4O8SA 3TLTA 4DR7T 4U74A 2XUEA 1FMVA 4JI7T 4X5TA 1MMAA 3EVYA 3N9OA 4B3ST 1Y64B 2BG9A 2FJDA 3ZEFB 2Y7YA 3O9XA 5IUXA 3MXZA 2G0UA 3M65A 2X66A 5HEJA 4IE5A 2WNLA 5AQQB 2XPKA 2OA5A 1IAPA 2Z6EA 2YU1A 3U8MA 2WWUA 3WTJA 5CJ5A 2QYWA 3K3NA 4F6RC 3OKQA 5LGTB 1FIOA 4BA9A 3TLWA 2YINA 4ZK4A 1HNXT 4J2CA 1W0BA 3SWHA 5HCMA 5AFNA 3D0TA 3C79A 4IDPA 4QKNA 2EHOA 2BS3A 1NWMX 5L3EB 4DNDA 5L3FB 2WQYA 4JI4T 2JJ9A 2J62A 2WB5A 5FNVE 4PFOA 3PUXF 3VR8A 2BYPA 1KK7A 4H9PC 2N1GA 4AQFA 5KX5E 2Q9QA 2N2NA 2FJAA 1UX4A 2XHEB 3JAEA 4JI8T 4UR9A 2ZM6T 3ETVA 4PW8A 4ZK1A 4ERRA 2BKNA 5C8YE 2JMKA 4G63A 5LB7B 4TWFA 3E08A 2CLYC 4EZ1A 4UY2A 4ILUA 4LF6T 5FVKA 5L3CB 2YKSA 2L9QA 3QB5K 5J0ZA 4AISA 5L47A 4LF7T 2V26A 1HR0T 3ZDGA 5BMVE 2CLYB 2RPAA 2XM1A 3ZJ2A 2KSRA 2PH9A 2RA1A 2IDOB 3EHZA 3Q5EA 4ILAA 2BS4A 1BR4A 4HE8A 3FZLB 2CHNA 1DU2A 2W67A 1I6ZA 3A5XA 4TV9E 1WR6A 2XYTA 4YTPA 3KBUA 4TNVA 3WAKA 4DR2T 2UU9T 5HEOA 5ABFA 5A1LA 2JMHA 1IBKT 2UXCT 2E5VA 2DLRA 4IL9A 2QVAA 4U2ZA 5AINA 3DJBA 2XAFB 5HYAA 4LFBT 4ZI3D 2YOEA 5LCYA 2V5CA 4DVDA 4D01A 2WSSV 4ZEYA 1I94T 2X00D 2CA5A 1X9BA 4FI5A 3H3MA 4E7SA 1XMOT 4ZJSA 1SE7A 3MK7C 5AQGB 5JMEA 3AE7A 1MIYA 2H89A 5LHGB 3LJCA 4UIGA 2W61A 3Q5DA 5FY7A 4YTNA 4DR3T 5JDHA 1QLBA 2CWOA 2D5UA 3P50A 2W62A 4QXBB 2LOPA 3F31A 1UUSA 5FXWA 4B6XA 4KI0F 3HKCE 4YT0A 5CA1E 2XNTA 3RYHE 2D0UA 3KV5A 1H7CA 5BW2A 4UEMA 4TUYE 3RIFA 3BK9A 2BYQA 1QSDA 4KUMB 2P9BA 3BQIA 3KBTA 4ISTA 1ZEEA 2CHOA 3DP7A 2V6YA 5SYOA 3M3ZB 2Y8DA 5AFLA 3ZCJA 2XSBA 2I6HA 1BR0A 2J1DG 5HXSA 1JNRA 2UUAT 3H37A 3ZMZB 3EDUA 1M62A 2MTQA 3RQWA 4PJMA 3EUHA 2V7IA 4LMKA 2CWYA 1JNZA 4CN4A 1KF6A 3B5MA 4GK0E 1T7SA 2OLTA 3T1HT 3RRWA 2I59A 2ACZA 2DNXA 2C0SA 1J5ET 3ZMTB 3WTKA 4DV0T 3A8YC 5KMGP 3JADA 2LHRA 1HNWT 4JI3T 4UXNB 3AB3B 1HFAA 2BJ0A 2ZJVA 3SRZA 3RX6A 2CPTA 2X00A 2NOXA 2NWBA 2KINB 1XNRT 5AQOB 2M67A 3SS1A 1US7B 4H9NC 5AFMA 3RYCE 4NIQA 2IHR1 4HWFA 4KMCA 1YQ4A 3T8OA 3ZMUB 4LF8T 2IMLA 2JQKA 3PUGA 3VR9A 2YMDA 3EDVA 2V6XA 3CWZB 4GYRA 2BYRA 5EK3A 3RC3A 3WI3A 2Y6XA 3OVUA 5JDMA 2K48A 2JQ9A 3UTKA 4WNKA 3FXDB 3F57A 2DHRA 2NW8A 5L4EA 2UUBT 4JV5T 2CE7A 2ZM2A 3EI0A 5AFMB 4AKIA 1CUNA 1WFDA 2DL1A 2SPCA 4TN7B 3RKGA 4YHJA 3FZFB 2ZMAA 3MA9A 4ISSA 3PUSA 2LSJA 3P4SA 2LOSA 4QXHB 4NXMT 5FJVA 1UV6A 2Q9QB 2W8GA 4QH5A 4TV8E 1MIVA 5AQIB 3T4MA 2BZBA 1BR2A 3PTRB 1ZOYA 4IDZA 4QX7B 3UUNA 3NZPA 3FZHB 3JAFA 4IIJE 2NP9A 1YKEB 4DR4T 5AFUL 3GA8A 1HF8A 5TVCA 5FL1A 3OBVE 5ABGA 3KVAA 3VKGA 3BQKA 4I43B 4PNIA 4WBOA 3N9NA 5AQNB 5HXCA 4TX5A 4U7YA 5AFJA 4GYSA 4Q25A 5FVLA 3QC9A 4DBRA 3AVRA 3U8JA 2XTLA 3N9LA 4DV5T 2XAHB 5AQVB 1AJ3A 3N9PA 2V1DB 4FJOA 3IA3A 4U72A 4JI6T 2R6GF 2W63A 3LBXA 1NAFA 4IREA 5TAOA 1VOMA 4DMWA 4MALA 1D1BA 2A3DA 2GK9A 4CZZB 3SH1A 1OWAA 3AVSA 4QAAA 3HKBE 5ABFB 2J4GA 5LXBA 3CPZA 1OEDB 4I0UA 4YLHA 2XSAA 4M1PA 2JIWA 1Z0PA 1R8IA 5BP0A 3MZKB 3OYZA 5HEGA 2W8FA 4H9SE 4AQYT 4YSZA 4DUYT 1VRBA 1T98A 4GOUA 1MNDA 1D1AA 3IBPA 3IEEA 3S4UA 3I1AA 2NR4A 2YDRA 3L09A 4UV9B 4UVAB 4O2BE 4AKRB 4JYAT 2K5BB 2WMNA 3PU3A 3RIUA 2YDSA 3LBXB 5AQFB 4ZS2A 3ZDHA 2LKHA 5DJQC 4AQFC 3VKHA 5J5GA 2VKHA 3SQ9A 2CBJA 4EV6A 5IYZE 3P4WA 4ZI2C 3B57A 3UQ4A 4WV9A 4DV4T 4OK0A 1U4QA 4PJNA 3N9QA 3WIPA 2IC6A 2VK9A 1YKHB 1L0VA 5AQLB 2V6YB 4LF9T 2YMEA 4DV1T 3ZN1B 4BQTA 3PUYF 3OPCA 5JDFA 2A9UA 4UM1A 4HN9A 3QOFA 2NW7A 3LK3B 3LSVA 4O4IE 3PUQA 3V5SA 4TWHA 5LYJE 5CFBA 3AEDA 1GQEA 4L5GA 3K3OA 4WYVA 3C51A 3IGQA 3UU6A 4IHJE 3SOLA 2FJBA 3Q2MA 2BG9C 2EHOC 2QA7A 3WTNA 1WYCA 4HWDA 4UXUA 1ZHCA 4NUVA 2LM2A 2NTXA 1N36T 1UCUA 3HKDE 4YFSA 2WS3A 4IDQA 4DBMA 5HXRA 1Y01A 2MAWA 4V1Av 3U3IA 1XZYA 1ZP0A 2E9XD 2PGZA 3AA7B 5AQUB 4DV3T 4UM3P 3AEBA 2BYSA 4CXXA 4QABA 4KBMB 4IE0A 4HWIB 5DQWA 4JI1T 4PJJA 4ZOLE 1HX8A 1W09A 5LP6E 5JDLA 3A7MA 2UXDT 3AA0B 3ESLA 5AQSB 4IDOA 4JBWF 4UM3S 2BBHA 2MYSA 3AE3A 4LFCT 2PFVA 4B3TT 1SHZC 2WZYA 2XZ6A 2X9YA 5CGMA 1OEDE 2CXLA 5LOVE 2B1EA 1ZV4X 5AQMB 1WR0A 3ZYKA 3I0OA 4BFQA 3GN5A 2WU5A 4XAXB 1MMNA 1NEKA 5FXZA 2VASA 4AKGA 4HWCA 2WZIA 5JDNA 2FBWA 4X62T 3RYIE 3ZYLA 2L8KA 2VB6A 5F8PA 2LSKA 4HWHA 3TKLB 3AA6B 3RIAA 5LBQB 5LXTE 1W0AA 2L3LA 2CXDA 1D1CA 4XK9A 3F2EA 5LA6E 2KMFA 4UF0A 2JQHA 2A72A 4AXPA 5FXVA 1XMQT 4AKHA 3NRYA 2XAQB 3E22E 4O4LE 5CA0E 5GONE 4JI5T 3JC6D 3GN5B 2B76A 2XAJB 4YJ2E 2D0TA 2X9WA 4JEUB 2WN9A 3PU8A 2XQ6A 1HNZT 3MACA 5JTGA 3RH3A 5F3JA 4U31A 2F4VT 2CEAA 3UU3A 3WTHA 3GUAA 3U78A 4OYJA 2XJ7A 5J5IA 3LFMA 2ACXA 2CBIA 2MBGA 1S94A 1LVKA 2KWHA 5FMNA 5HWYA 1BR1A
chains in the Genus database with same CATH topology
2M6BA 2WNJA 1UX2A 5L4HA 4IL9A 4AFHA 4A97A 5LXBA 2LLYA 4ALXA 3WTKA 4BFQA 1OEDB 5HEUA 3JADA 4TWDA 3C84A 4ILCA 5AINA 5FJVA 1OEDA 4ZZBA 1UV6A 4HFCA 5J5HA 4ZRUA 2Y58A 3SQ6A 2W8GA 4UM3A 5J5FA 2YOEA 3JAEA 2BJ0A 2ZJVA 4QH5A 3IGQA 3TLTA 3UU6A 3PEOA 3WTLA 5BP0A 2VL0A 4D01A 3T4MA 5HEGA 2YN6A 2W8FA 2BR8A 2X00A 4QACA 4AFTA 2ZJUA 3UU4A 2X00D 4X5TA 2XQ3A 4HFHA 3UUBA 4ZK1A 2BG9C 2XNVA 2XQ5A 3TLUA 3WTNA 4ZJTA 2BG9A 5AFMA 3ZKRA 2Y7YA 3RQUA 4ZJSA 5IUXA 2XQ9A 5JMEA 5LG3A 5HEJA 3JAFA 4HFEA 4TWFA 4UXUA 5BRXA 2LM2A 4HQPA 2WNLA 5KE4A 3RI5A 3RHWA 4EZ1A 2XQ4A 4ZR6A 2LKGA 4UY2A 3U8LA 2BG9E 3SIOA 4DBMA 5AFHA 3RIAA 2M6IA 2MAWA 2YKSA 3ZDHA 2LKHA 4NPPA 2XQAA 2C9TA 4XK9A 5J0ZA 2PGZA 3U8MA 5L47A 1I9BA 3WTJA 3P50A 4UM3P 3TLSA 5TVCA 2YMDA 2BYSA 3PMZA 4NZBA 4QABA 5J5GA 4HFDA 2XNTA 3SQ9A 3WTOA 3ZDGA 4HFBA 3UQ7A 2XZ5A 4F8HA 3UU5A 4PIRA 3P4WA 3UQ4A 4WV9A 5BW2A 2Y56A 4FRRA 3TLWA 2BYRA 1OEDC 3RIFA 4HFIA 4ILBA 5HEHA 2KSRA 2BYQA 2PH9A 3WIPA 4ZK4A 4Z91A 4ZZCA 4A98A 3EHZA 3WTIA 4ILAA 1UW6A 2WNCA 5AFKA 5AFJA 2XQ8A 2XYSA 5HCMA 2BG9B 2QC1B 3UU8A 5SYOA 2WN9A 2XNUA 2XQ6A 5AFLA 3U8JA 5AFNA 4Z90A 3C79A 4COFA 2YMEA 4UM3S 4LMLA 4TNWA 4XHEA 5CO5A 5KZUA 3UU3A 5L4EA 2XQ7A 4AFGA 4BQTA 2BYNA 3WTHA 3WTMA 3GUAA 3U8NA 2Y57A 3EI0A 4LMJA 4QH1A 3TLVA 2Y54A 4IL4A 5AFMB 2XYTA 5J5IA 4UM1A 4QH4A 4IREA 3RQWA 2UZ6A 4TNVA 2XZ6A 2WZYA 3U8KA 4B5DA 2BR7A 4LMKA 3LSVA 5HEOA 3SH1A 3EAMA 5HCJA 4QAAA 2BYPA 4TWHA 5CFBA 1OEDE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6B A;  2WNJ A;  1UX2 A;  5L4H A;  4IL9 A;  4AFH A;  4A97 A;  5LXB A;  2LLY A;  4ALX A;  3WTK A;  4BFQ A;  1OED B;  5HEU A;  3JAD A;  4TWD A;  3C84 A;  4ILC A;  5AIN A;  5FJV A;  1OED A;  4ZZB A;  1UV6 A;  4HFC A;  5J5H A;  4ZRU A;  2Y58 A;  3SQ6 A;  2W8G A;  4UM3 A;  5J5F A;  2YOE A;  3JAE A;  2BJ0 A;  2ZJV A;  4QH5 A;  3IGQ A;  3TLT A;  3UU6 A;  3PEO A;  3WTL A;  5BP0 A;  2VL0 A;  4D01 A;  3T4M A;  5HEG A;  2YN6 A;  2W8F A;  2BR8 A;  2X00 A;  4QAC A;  4AFT A;  2ZJU A;  3UU4 A;  2X00 D;  4X5T A;  2XQ3 A;  4HFH A;  3UUB A;  4ZK1 A;  2BG9 C;  2XNV A;  2XQ5 A;  3TLU A;  3WTN A;  4ZJT A;  2BG9 A;  5AFM A;  3ZKR A;  2Y7Y A;  3RQU A;  4ZJS A;  5IUX A;  2XQ9 A;  5JME A;  5LG3 A;  5HEJ A;  3JAF A;  4HFE A;  4TWF A;  4UXU A;  5BRX A;  2LM2 A;  4HQP A;  2WNL A;  5KE4 A;  3RI5 A;  3RHW A;  4EZ1 A;  2XQ4 A;  4ZR6 A;  2LKG A;  4UY2 A;  3U8L A;  2BG9 E;  3SIO A;  4DBM A;  5AFH A;  3RIA A;  2M6I A;  2MAW A;  2YKS A;  3ZDH A;  2LKH A;  4NPP A;  2XQA A;  2C9T A;  4XK9 A;  5J0Z A;  2PGZ A;  3U8M A;  5L47 A;  1I9B A;  3WTJ A;  3P50 A;  4UM3 P;  3TLS A;  5TVC A;  2YMD A;  2BYS A;  3PMZ A;  4NZB A;  4QAB A;  5J5G A;  4HFD A;  2XNT A;  3SQ9 A;  3WTO A;  3ZDG A;  4HFB A;  3UQ7 A;  2XZ5 A;  4F8H A;  3UU5 A;  4PIR A;  3P4W A;  3UQ4 A;  4WV9 A;  5BW2 A;  2Y56 A;  4FRR A;  3TLW A;  2BYR A;  1OED C;  3RIF A;  4HFI A;  4ILB A;  5HEH A;  2KSR A;  2BYQ A;  2PH9 A;  3WIP A;  4ZK4 A;  4Z91 A;  4ZZC A;  4A98 A;  3EHZ A;  3WTI A;  4ILA A;  1UW6 A;  2WNC A;  5AFK A;  5AFJ A;  2XQ8 A;  2XYS A;  5HCM A;  2BG9 B;  2QC1 B;  3UU8 A;  5SYO A;  2WN9 A;  2XNU A;  2XQ6 A;  5AFL A;  3U8J A;  5AFN A;  4Z90 A;  3C79 A;  4COF A;  2YME A;  4UM3 S;  4LML A;  4TNW A;  4XHE A;  5CO5 A;  5KZU A;  3UU3 A;  5L4E A;  2XQ7 A;  4AFG A;  4BQT A;  2BYN A;  3WTH A;  3WTM A;  3GUA A;  3U8N A;  2Y57 A;  3EI0 A;  4LMJ A;  4QH1 A;  3TLV A;  2Y54 A;  4IL4 A;  5AFM B;  2XYT A;  5J5I A;  4UM1 A;  4QH4 A;  4IRE A;  3RQW A;  2UZ6 A;  4TNV A;  2XZ6 A;  2WZY A;  3U8K A;  4B5D A;  2BR7 A;  4LMK A;  3LSV A;  5HEO A;  3SH1 A;  3EAM A;  5HCJ A;  4QAA A;  2BYP A;  4TWH A;  5CFB A;  1OED E; 
#chains in the Genus database with same CATH topology
 3DTO A;  3KDS E;  2VUR A;  2ODV A;  3CML A;  4UF0 B;  1OED A;  4HFC A;  5J5H A;  5AQR B;  2WZH A;  3UU4 A;  4HFH A;  5BR8 T;  2WDQ A;  2WMO A;  4DO0 A;  4ZJT A;  2UXX B;  5LGU B;  2H7O A;  4QHO A;  4YSX A;  4XZC A;  2IUB A;  1HG2 A;  1YQ3 A;  5EK2 A;  2X68 A;  4YXD A;  5HAX A;  1XDP A;  4ZI7 E;  1T8B A;  5FY1 A;  5AFH A;  2QRX A;  2BKO A;  2C9T A;  4P09 A;  1M7K A;  3UUX B;  4ASK A;  3OTO T;  4E7Z A;  4I55 E;  2V7J A;  1HG5 A;  2HN2 A;  2V5D A;  3RPU A;  2E9X C;  4A98 A;  2ZM8 A;  3PE0 A;  4U2Y A;  5AFK A;  1D0X A;  3ZCI A;  3AE1 A;  3FZK B;  4ADZ A;  2IAK A;  4ZXL A;  3C4W A;  4C91 A;  2MPK A;  2ODU A;  4BJM A;  3AA1 B;  4I50 E;  4DV2 T;  3RIU C;  5ETW A;  4PK4 A;  3ZST A;  4AQG A;  4EZ4 A;  4WBN E;  2KLQ A;  2CRB A;  4L9I A;  5FP3 A;  5L3G B;  2X0H A;  2LLY A;  3N2G E;  3AXJ B;  3PJA A;  5ADX L;  2IIU A;  4CI1 B;  3QUJ A;  1LVF A;  2WAU A;  5C3J A;  4P1N A;  2WDV A;  1WLX A;  2XAS B;  4EOZ B;  2H7V C;  2BDE A;  2ZJU A;  3UUB A;  5JRE A;  4X1I E;  4NXN T;  5LG3 A;  2LSY A;  5HXE A;  1Z8U A;  2XY8 B;  2QGS A;  4EB6 E;  3PUR A;  4PK5 A;  5L3D B;  2ZLY A;  1B7T A;  4NPP A;  4NUU A;  3VRA A;  2C5I T;  2NTY A;  2VVN A;  3HKE E;  5JVD E;  2I0M A;  5FXX A;  4EIW A;  2OV9 A;  3IHR A;  3B13 A;  3X1D A;  4F8H A;  4H9O C;  4IT4 A;  1OED C;  3GWH A;  4ZZC A;  3FZM B;  3PUA A;  3ZJ1 A;  4WZX A;  3OYX A;  3J7Y q;  2XYS A;  2ZM0 A;  4H63 V;  2LHN A;  2Y48 B;  1SA0 E;  4MLK A;  5M4Y A;  4CQI A;  2JPF A;  3AE9 A;  4C90 A;  4H63 H;  4CXY A;  3ZC1 A;  2X67 A;  1IJ5 A;  2AE9 A;  2XQ7 A;  3QK6 A;  2LJL A;  4DBQ A;  3KV4 A;  2XM2 A;  3RC8 A;  2LE8 A;  4CXW A;  5JRC B;  4X65 T;  3HL6 A;  3AEG A;  3ONL C;  3N9M A;  5HCJ A;  2WNJ A;  2M6B A;  5LJM A;  3ANW A;  1OXZ A;  3KV9 A;  2DI4 A;  4A97 A;  3LG7 A;  4ALX A;  3NVO A;  4DV6 T;  2CMR A;  4ILC A;  2V7L A;  5EK4 A;  2A2F X;  5E0O A;  3J9X 1;  2ES0 A;  3AEF A;  5J5F A;  5LMU T;  3CQC B;  5JR9 A;  3KV6 A;  2WU2 A;  2PG8 A;  2W4X A;  2XNV A;  4O2A E;  3ZKR A;  1VCT A;  5HWX A;  3NKZ A;  2UXB T;  2XQ4 A;  3L8R A;  1J5W A;  3HA4 A;  4A56 A;  4EYY R;  4ZR6 A;  2VWA A;  3VHL A;  3ETU A;  2N9D A;  3NRX A;  3ZSS A;  1I9B A;  5AQJ B;  3TLS A;  3IF8 B;  2LM9 A;  1CHU A;  3PMZ A;  3MJX A;  3P4R A;  3RF1 A;  5JR9 C;  4CI2 B;  3JC6 C;  4X1Y E;  2BKP A;  1IBM T;  4LF4 T;  1KNR A;  3VU7 H;  4B3M T;  3UUM A;  3C4Z A;  5JR9 B;  2XQY A;  4OHF A;  3HI2 A;  3AE5 A;  2BVL A;  2KXP B;  2WWV A;  5LG4 A;  4YSY A;  3KIN B;  3SFD A;  4G2A A;  5AQT B;  3UUL A;  2MOZ A;  3ZYM A;  4L0R A;  3U8K A;  2LSI A;  2PBI A;  3V5U A;  4K0K T;  4GK5 E;  4YTM A;  2BVM A;  1FJG T;  1FEW A;  5L4H A;  2CXF A;  4HKA A;  5HEU A;  2VKJ A;  4PK6 A;  2Y58 A;  3CX6 B;  2D9D A;  2HPJ A;  3MKD A;  3PEO A;  2VL0 A;  2YDQ A;  4AFT A;  5IWA T;  2XQ3 A;  4OYK A;  3FBZ A;  2LT3 A;  1KNZ A;  1KEY A;  3ZMV B;  2XQ9 A;  3UFG A;  1UK5 A;  2EHO D;  3RHW A;  3RGL A;  2LKG A;  2WCA A;  4OFZ A;  2BG9 E;  2IC9 A;  3Q9D A;  2CCQ A;  3W15 B;  4N78 D;  4YY3 T;  4K0U A;  1HS7 A;  2WBL A;  3QB5 A;  4NZB A;  4MFR A;  4UV8 B;  2XZ5 A;  1LRZ A;  3EAB A;  2Y56 A;  4FRR A;  3LK2 B;  4DR5 T;  3CX8 B;  1KNP A;  4Z91 A;  4OX9 T;  3N5L A;  3K3Q C;  2DCF A;  1XDO A;  3P4Q A;  1MMG A;  4JUY A;  3N2O A;  5C2T A;  2W66 A;  4BAY B;  4X1K E;  4AIU A;  4DID B;  4GKK T;  2BYN A;  4DMV A;  3QNU A;  2KWI B;  3C50 A;  3CVR A;  4GIW A;  2BS2 A;  3K1S A;  5FKY A;  2WY2 A;  1J1J A;  3H3A A;  3RRC A;  1V9D A;  1FMW A;  5JDQ A;  2VQF T;  3T1Y T;  1LKX A;  4AI6 A;  3AXJ A;  3ZC0 A;  4DUZ T;  3CX7 B;  4YHH T;  3PUZ F;  3PUW F;  5H6R B;  4ZHQ E;  3SQ6 A;  4UM3 A;  3O1I A;  2BR8 A;  4QAC A;  4DV7 T;  3AEC A;  2H88 A;  3SFE A;  3O1H A;  3TLU A;  2LEH A;  3ZT6 A;  5F5W A;  4ZI3 C;  1WRD A;  4HQP A;  4HFV A;  1NEN A;  2VL8 A;  2RP4 A;  4YJ3 E;  3P7I A;  2H3R A;  2YK0 A;  4BJN A;  2WM9 A;  3AE6 A;  1HX1 B;  2Q9Q D;  5LBM A;  1U5P A;  2BBJ A;  5CB4 E;  3UQ7 A;  3ONX A;  4JLE A;  1UX5 A;  1T72 A;  4O4J E;  5AQK B;  4KHZ F;  4U3C A;  5L3B B;  3WTI A;  4ZI2 D;  3JCF A;  2WNC A;  1YW0 A;  4EYU A;  3FBL A;  4LML A;  4TNW A;  5KDM C;  4H9R C;  3AAA B;  4LFA T;  4AFG A;  3U8N A;  4QWN B;  3FHN A;  2E9X B;  4PAG A;  3O1J A;  2V7M A;  4MBQ A;  5J2T E;  4QXC B;  3L3P A;  5JRC A;  4IE6 A;  5EZY E;  2YU2 A;  3RKO A;  3FB2 A;  4IE4 A;  2CM0 A;  4KX6 A;  4ZS3 A;  5LHI B;  3ANW B;  3AE8 A;  1N32 T;  1WCR A;  4ZRU A;  2J47 A;  5IHY A;  3PV0 F;  1N33 T;  3WTL A;  4O4H E;  2W0G A;  2YN6 A;  2XZE A;  3NWI A;  3C4X A;  2YEV C;  2JRK A;  3Q5W A;  4IE7 A;  3RYF E;  4EAH A;  2XQ5 A;  3I9W A;  3NBX X;  2WP9 A;  4HFE A;  4I4T E;  3FXE B;  4PFP A;  2HH7 A;  3UFE A;  4IDN A;  3C64 A;  4U7I A;  2C5K T;  2HPL A;  2W2U A;  4EXT A;  3G06 A;  2XQA A;  1MIW A;  1O3X A;  3WTO A;  4CI3 B;  2HHH T;  2LRK A;  5FYM A;  1W9R A;  4X66 T;  3ONJ A;  1MMD A;  1EZ3 A;  4HFI A;  4ILB A;  3AEE A;  2XQ8 A;  3R84 B;  3O4X E;  2EHO B;  5ABE A;  5CO5 A;  1HTJ F;  4GKJ T;  4U33 A;  4IL4 A;  3PDY A;  4QH4 A;  2UZ6 A;  2D2S A;  5LNK A;  4UEL A;  3I9Y A;  2UXN B;  3UT5 E;  4B5D A;  2BR7 A;  3RLF F;  1S35 A;  5FY0 A;  1IBL T;  1D0Y A;  1HCI A;  4MHC A;  5HXH A;  1ZKE A;  1UX2 A;  4EEB A;  3ZMS B;  5KXJ A;  1IZN B;  1KFY A;  3KFW X;  4TWD A;  5L2L A;  2V7K A;  5LMN T;  1X79 A;  1UUR A;  3VRB A;  4HTE A;  4H9Q C;  4HGA A;  1UGO A;  4EZH A;  4EED A;  1G8X A;  1SUM B;  1MNE A;  1E7P A;  5BRX A;  3GMI A;  5J1G A;  3P4P A;  5KE4 A;  2X51 A;  1QUU A;  4KHP T;  3U8L A;  2NW9 A;  1E2A A;  2JQQ A;  4A5X A;  4KP3 C;  2E5L T;  5JDG A;  3WAJ A;  3ZT5 A;  2LSG A;  4QX8 B;  4HFD A;  2PJQ A;  5DQV A;  4UVC B;  3Q5X A;  3UU5 A;  4PIR A;  2VVS A;  4Z8X A;  5JQG E;  2FUP A;  3ZN0 B;  3LK4 2;  1UW6 A;  4ANJ A;  4X64 T;  2PTF A;  3UU8 A;  2XNU A;  5J2U E;  2XAG B;  4JI0 T;  1N34 T;  2FJE A;  4COF A;  3AE4 A;  2DWK A;  1WYB A;  4XHE A;  2X0L B;  2KT9 A;  2KZ7 B;  3TLV A;  2VKO A;  3NZQ A;  3L39 A;  2VQE T;  3ABV A;  4TZ4 C;  4DR1 T;  3I0Q A;  4IGU A;  1D0Z A;  2C5J A;  5LGN B;  4WW0 A;  5LHH B;  4X20 E;  2E8I A;  4PJL A;  5DAB A;  4AFH A;  3AE2 A;  2AXD S;  4XBF B;  2V8S V;  4ZZB A;  4DR6 T;  2K3W A;  5AQH B;  1E1H B;  3CKD A;  3CQX C;  3ZT7 A;  5LJN A;  3OJA A;  1XNQ T;  4LF5 T;  5FL0 A;  4B3R T;  2KND A;  3K8P C;  3RQU A;  2X9X A;  3RI5 A;  3P8C D;  3R6N A;  3ZLI A;  3SIO A;  2M6I A;  2Q9Q C;  4P0B A;  3CIR A;  1YD8 G;  3CQG B;  2UUC T;  3AEA A;  4JI2 T;  4AKL A;  1IJ6 A;  3HR0 A;  4P0A A;  4HFB A;  2X0Y A;  3KVB A;  2IW5 B;  4CN6 A;  3AAI A;  5HEH A;  2DWG A;  5ABH A;  4CN1 A;  2K24 A;  3E0Z A;  2BG9 B;  2QC1 B;  1VCS A;  3PJA J;  4Z90 A;  2E2A A;  3PUV F;  3AAE B;  5KZU A;  2LRL A;  3LDQ B;  3WTM A;  2Y57 A;  3N2K E;  4LMJ A;  4QH1 A;  2WDR A;  2Y54 A;  2X9H A;  4EGW A;  3ZPO A;  2E9X A;  2K9A A;  3CK6 A;  5AQP B;  3EAM A;  1XWM A;  5JH7 E;  2HN1 A;  3C98 B;  4HEA A;  3BQL A;  4JEH B;  2W00 A;  4UVB B;  3C84 A;  5H6Q B;  1YXR A;  1G73 A;  2VKD A;  4O8S A;  3TLT A;  4DR7 T;  4U74 A;  2XUE A;  1FMV A;  4JI7 T;  4X5T A;  1MMA A;  3EVY A;  3N9O A;  4B3S T;  1Y64 B;  2BG9 A;  2FJD A;  3ZEF B;  2Y7Y A;  3O9X A;  5IUX A;  3MXZ A;  2G0U A;  3M65 A;  2X66 A;  5HEJ A;  4IE5 A;  2WNL A;  5AQQ B;  2XPK A;  2OA5 A;  1IAP A;  2Z6E A;  2YU1 A;  3U8M A;  2WWU A;  3WTJ A;  5CJ5 A;  2QYW A;  3K3N A;  4F6R C;  3OKQ A;  5LGT B;  1FIO A;  4BA9 A;  3TLW A;  2YIN A;  4ZK4 A;  1HNX T;  4J2C A;  1W0B A;  3SWH A;  5HCM A;  5AFN A;  3D0T A;  3C79 A;  4IDP A;  4QKN A;  2EHO A;  2BS3 A;  1NWM X;  5L3E B;  4DND A;  5L3F B;  2WQY A;  4JI4 T;  2JJ9 A;  2J62 A;  2WB5 A;  5FNV E;  4PFO A;  3PUX F;  3VR8 A;  2BYP A;  1KK7 A;  4H9P C;  2N1G A;  4AQF A;  5KX5 E;  2Q9Q A;  2N2N A;  2FJA A;  1UX4 A;  2XHE B;  3JAE A;  4JI8 T;  4UR9 A;  2ZM6 T;  3ETV A;  4PW8 A;  4ZK1 A;  4ERR A;  2BKN A;  5C8Y E;  2JMK A;  4G63 A;  5LB7 B;  4TWF A;  3E08 A;  2CLY C;  4EZ1 A;  4UY2 A;  4ILU A;  4LF6 T;  5FVK A;  5L3C B;  2YKS A;  2L9Q A;  3QB5 K;  5J0Z A;  4AIS A;  5L47 A;  4LF7 T;  2V26 A;  1HR0 T;  3ZDG A;  5BMV E;  2CLY B;  2RPA A;  2XM1 A;  3ZJ2 A;  2KSR A;  2PH9 A;  2RA1 A;  2IDO B;  3EHZ A;  3Q5E A;  4ILA A;  2BS4 A;  1BR4 A;  4HE8 A;  3FZL B;  2CHN A;  1DU2 A;  2W67 A;  1I6Z A;  3A5X A;  4TV9 E;  1WR6 A;  2XYT A;  4YTP A;  3KBU A;  4TNV A;  3WAK A;  4DR2 T;  2UU9 T;  5HEO A;  5ABF A;  5A1L A;  2JMH A;  1IBK T;  2UXC T;  2E5V A;  2DLR A;  4IL9 A;  2QVA A;  4U2Z A;  5AIN A;  3DJB A;  2XAF B;  5HYA A;  4LFB T;  4ZI3 D;  2YOE A;  5LCY A;  2V5C A;  4DVD A;  4D01 A;  2WSS V;  4ZEY A;  1I94 T;  2X00 D;  2CA5 A;  1X9B A;  4FI5 A;  3H3M A;  4E7S A;  1XMO T;  4ZJS A;  1SE7 A;  3MK7 C;  5AQG B;  5JME A;  3AE7 A;  1MIY A;  2H89 A;  5LHG B;  3LJC A;  4UIG A;  2W61 A;  3Q5D A;  5FY7 A;  4YTN A;  4DR3 T;  5JDH A;  1QLB A;  2CWO A;  2D5U A;  3P50 A;  2W62 A;  4QXB B;  2LOP A;  3F31 A;  1UUS A;  5FXW A;  4B6X A;  4KI0 F;  3HKC E;  4YT0 A;  5CA1 E;  2XNT A;  3RYH E;  2D0U A;  3KV5 A;  1H7C A;  5BW2 A;  4UEM A;  4TUY E;  3RIF A;  3BK9 A;  2BYQ A;  1QSD A;  4KUM B;  2P9B A;  3BQI A;  3KBT A;  4IST A;  1ZEE A;  2CHO A;  3DP7 A;  2V6Y A;  5SYO A;  3M3Z B;  2Y8D A;  5AFL A;  3ZCJ A;  2XSB A;  2I6H A;  1BR0 A;  2J1D G;  5HXS A;  1JNR A;  2UUA T;  3H37 A;  3ZMZ B;  3EDU A;  1M62 A;  2MTQ A;  3RQW A;  4PJM A;  3EUH A;  2V7I A;  4LMK A;  2CWY A;  1JNZ A;  4CN4 A;  1KF6 A;  3B5M A;  4GK0 E;  1T7S A;  2OLT A;  3T1H T;  3RRW A;  2I59 A;  2ACZ A;  2DNX A;  2C0S A;  1J5E T;  3ZMT B;  3WTK A;  4DV0 T;  3A8Y C;  5KMG P;  3JAD A;  2LHR A;  1HNW T;  4JI3 T;  4UXN B;  3AB3 B;  1HFA A;  2BJ0 A;  2ZJV A;  3SRZ A;  3RX6 A;  2CPT A;  2X00 A;  2NOX A;  2NWB A;  2KIN B;  1XNR T;  5AQO B;  2M67 A;  3SS1 A;  1US7 B;  4H9N C;  5AFM A;  3RYC E;  4NIQ A;  2IHR 1;  4HWF A;  4KMC A;  1YQ4 A;  3T8O A;  3ZMU B;  4LF8 T;  2IML A;  2JQK A;  3PUG A;  3VR9 A;  2YMD A;  3EDV A;  2V6X A;  3CWZ B;  4GYR A;  2BYR A;  5EK3 A;  3RC3 A;  3WI3 A;  2Y6X A;  3OVU A;  5JDM A;  2K48 A;  2JQ9 A;  3UTK A;  4WNK A;  3FXD B;  3F57 A;  2DHR A;  2NW8 A;  5L4E A;  2UUB T;  4JV5 T;  2CE7 A;  2ZM2 A;  3EI0 A;  5AFM B;  4AKI A;  1CUN A;  1WFD A;  2DL1 A;  2SPC A;  4TN7 B;  3RKG A;  4YHJ A;  3FZF B;  2ZMA A;  3MA9 A;  4ISS A;  3PUS A;  2LSJ A;  3P4S A;  2LOS A;  4QXH B;  4NXM T;  5FJV A;  1UV6 A;  2Q9Q B;  2W8G A;  4QH5 A;  4TV8 E;  1MIV A;  5AQI B;  3T4M A;  2BZB A;  1BR2 A;  3PTR B;  1ZOY A;  4IDZ A;  4QX7 B;  3UUN A;  3NZP A;  3FZH B;  3JAF A;  4IIJ E;  2NP9 A;  1YKE B;  4DR4 T;  5AFU L;  3GA8 A;  1HF8 A;  5TVC A;  5FL1 A;  3OBV E;  5ABG A;  3KVA A;  3VKG A;  3BQK A;  4I43 B;  4PNI A;  4WBO A;  3N9N A;  5AQN B;  5HXC A;  4TX5 A;  4U7Y A;  5AFJ A;  4GYS A;  4Q25 A;  5FVL A;  3QC9 A;  4DBR A;  3AVR A;  3U8J A;  2XTL A;  3N9L A;  4DV5 T;  2XAH B;  5AQV B;  1AJ3 A;  3N9P A;  2V1D B;  4FJO A;  3IA3 A;  4U72 A;  4JI6 T;  2R6G F;  2W63 A;  3LBX A;  1NAF A;  4IRE A;  5TAO A;  1VOM A;  4DMW A;  4MAL A;  1D1B A;  2A3D A;  2GK9 A;  4CZZ B;  3SH1 A;  1OWA A;  3AVS A;  4QAA A;  3HKB E;  5ABF B;  2J4G A;  5LXB A;  3CPZ A;  1OED B;  4I0U A;  4YLH A;  2XSA A;  4M1P A;  2JIW A;  1Z0P A;  1R8I A;  5BP0 A;  3MZK B;  3OYZ A;  5HEG A;  2W8F A;  4H9S E;  4AQY T;  4YSZ A;  4DUY T;  1VRB A;  1T98 A;  4GOU A;  1MND A;  1D1A A;  3IBP A;  3IEE A;  3S4U A;  3I1A A;  2NR4 A;  2YDR A;  3L09 A;  4UV9 B;  4UVA B;  4O2B E;  4AKR B;  4JYA T;  2K5B B;  2WMN A;  3PU3 A;  3RIU A;  2YDS A;  3LBX B;  5AQF B;  4ZS2 A;  3ZDH A;  2LKH A;  5DJQ C;  4AQF C;  3VKH A;  5J5G A;  2VKH A;  3SQ9 A;  2CBJ A;  4EV6 A;  5IYZ E;  3P4W A;  4ZI2 C;  3B57 A;  3UQ4 A;  4WV9 A;  4DV4 T;  4OK0 A;  1U4Q A;  4PJN A;  3N9Q A;  3WIP A;  2IC6 A;  2VK9 A;  1YKH B;  1L0V A;  5AQL B;  2V6Y B;  4LF9 T;  2YME A;  4DV1 T;  3ZN1 B;  4BQT A;  3PUY F;  3OPC A;  5JDF A;  2A9U A;  4UM1 A;  4HN9 A;  3QOF A;  2NW7 A;  3LK3 B;  3LSV A;  4O4I E;  3PUQ A;  3V5S A;  4TWH A;  5LYJ E;  5CFB A;  3AED A;  1GQE A;  4L5G A;  3K3O A;  4WYV A;  3C51 A;  3IGQ A;  3UU6 A;  4IHJ E;  3SOL A;  2FJB A;  3Q2M A;  2BG9 C;  2EHO C;  2QA7 A;  3WTN A;  1WYC A;  4HWD A;  4UXU A;  1ZHC A;  4NUV A;  2LM2 A;  2NTX A;  1N36 T;  1UCU A;  3HKD E;  4YFS A;  2WS3 A;  4IDQ A;  4DBM A;  5HXR A;  1Y01 A;  2MAW A;  4V1A v;  3U3I A;  1XZY A;  1ZP0 A;  2E9X D;  2PGZ A;  3AA7 B;  5AQU B;  4DV3 T;  4UM3 P;  3AEB A;  2BYS A;  4CXX A;  4QAB A;  4KBM B;  4IE0 A;  4HWI B;  5DQW A;  4JI1 T;  4PJJ A;  4ZOL E;  1HX8 A;  1W09 A;  5LP6 E;  5JDL A;  3A7M A;  2UXD T;  3AA0 B;  3ESL A;  5AQS B;  4IDO A;  4JBW F;  4UM3 S;  2BBH A;  2MYS A;  3AE3 A;  4LFC T;  2PFV A;  4B3T T;  1SHZ C;  2WZY A;  2XZ6 A;  2X9Y A;  5CGM A;  1OED E;  2CXL A;  5LOV E;  2B1E A;  1ZV4 X;  5AQM B;  1WR0 A;  3ZYK A;  3I0O A;  4BFQ A;  3GN5 A;  2WU5 A;  4XAX B;  1MMN A;  1NEK A;  5FXZ A;  2VAS A;  4AKG A;  4HWC A;  2WZI A;  5JDN A;  2FBW A;  4X62 T;  3RYI E;  3ZYL A;  2L8K A;  2VB6 A;  5F8P A;  2LSK A;  4HWH A;  3TKL B;  3AA6 B;  3RIA A;  5LBQ B;  5LXT E;  1W0A A;  2L3L A;  2CXD A;  1D1C A;  4XK9 A;  3F2E A;  5LA6 E;  2KMF A;  4UF0 A;  2JQH A;  2A72 A;  4AXP A;  5FXV A;  1XMQ T;  4AKH A;  3NRY A;  2XAQ B;  3E22 E;  4O4L E;  5CA0 E;  5GON E;  4JI5 T;  3JC6 D;  3GN5 B;  2B76 A;  2XAJ B;  4YJ2 E;  2D0T A;  2X9W A;  4JEU B;  2WN9 A;  3PU8 A;  2XQ6 A;  1HNZ T;  3MAC A;  5JTG A;  3RH3 A;  5F3J A;  4U31 A;  2F4V T;  2CEA A;  3UU3 A;  3WTH A;  3GUA A;  3U78 A;  4OYJ A;  2XJ7 A;  5J5I A;  3LFM A;  2ACX A;  2CBI A;  2MBG A;  1S94 A;  1LVK A;  2KWH A;  5FMN A;  5HWY A;  1BR1 A; 
#chains in the Genus database with same CATH homology
 2M6B A;  2WNJ A;  1UX2 A;  5L4H A;  4IL9 A;  4AFH A;  4A97 A;  5LXB A;  2LLY A;  4ALX A;  3WTK A;  4BFQ A;  1OED B;  5HEU A;  3JAD A;  4TWD A;  3C84 A;  4ILC A;  5AIN A;  5FJV A;  1OED A;  4ZZB A;  1UV6 A;  4HFC A;  5J5H A;  4ZRU A;  2Y58 A;  3SQ6 A;  2W8G A;  4UM3 A;  5J5F A;  2YOE A;  3JAE A;  2BJ0 A;  2ZJV A;  4QH5 A;  3IGQ A;  3TLT A;  3UU6 A;  3PEO A;  3WTL A;  5BP0 A;  2VL0 A;  4D01 A;  3T4M A;  5HEG A;  2YN6 A;  2W8F A;  2BR8 A;  2X00 A;  4QAC A;  4AFT A;  2ZJU A;  3UU4 A;  2X00 D;  4X5T A;  2XQ3 A;  4HFH A;  3UUB A;  4ZK1 A;  2BG9 C;  2XNV A;  2XQ5 A;  3TLU A;  3WTN A;  4ZJT A;  2BG9 A;  5AFM A;  3ZKR A;  2Y7Y A;  3RQU A;  4ZJS A;  5IUX A;  2XQ9 A;  5JME A;  5LG3 A;  5HEJ A;  3JAF A;  4HFE A;  4TWF A;  4UXU A;  5BRX A;  2LM2 A;  4HQP A;  2WNL A;  5KE4 A;  3RI5 A;  3RHW A;  4EZ1 A;  2XQ4 A;  4ZR6 A;  2LKG A;  4UY2 A;  3U8L A;  2BG9 E;  3SIO A;  4DBM A;  5AFH A;  3RIA A;  2M6I A;  2MAW A;  2YKS A;  3ZDH A;  2LKH A;  4NPP A;  2XQA A;  2C9T A;  4XK9 A;  5J0Z A;  2PGZ A;  3U8M A;  5L47 A;  1I9B A;  3WTJ A;  3P50 A;  4UM3 P;  3TLS A;  5TVC A;  2YMD A;  2BYS A;  3PMZ A;  4NZB A;  4QAB A;  5J5G A;  4HFD A;  2XNT A;  3SQ9 A;  3WTO A;  3ZDG A;  4HFB A;  3UQ7 A;  2XZ5 A;  4F8H A;  3UU5 A;  4PIR A;  3P4W A;  3UQ4 A;  4WV9 A;  5BW2 A;  2Y56 A;  4FRR A;  3TLW A;  2BYR A;  1OED C;  3RIF A;  4HFI A;  4ILB A;  5HEH A;  2KSR A;  2BYQ A;  2PH9 A;  3WIP A;  4ZK4 A;  4Z91 A;  4ZZC A;  4A98 A;  3EHZ A;  3WTI A;  4ILA A;  1UW6 A;  2WNC A;  5AFK A;  5AFJ A;  2XQ8 A;  2XYS A;  5HCM A;  2BG9 B;  2QC1 B;  3UU8 A;  5SYO A;  2WN9 A;  2XNU A;  2XQ6 A;  5AFL A;  3U8J A;  5AFN A;  4Z90 A;  3C79 A;  4COF A;  2YME A;  4UM3 S;  4LML A;  4TNW A;  4XHE A;  5CO5 A;  5KZU A;  3UU3 A;  5L4E A;  2XQ7 A;  4AFG A;  4BQT A;  2BYN A;  3WTH A;  3WTM A;  3GUA A;  3U8N A;  2Y57 A;  3EI0 A;  4LMJ A;  4QH1 A;  3TLV A;  2Y54 A;  4IL4 A;  5AFM B;  2XYT A;  5J5I A;  4UM1 A;  4QH4 A;  4IRE A;  3RQW A;  2UZ6 A;  4TNV A;  2XZ6 A;  2WZY A;  3U8K A;  4B5D A;  2BR7 A;  4LMK A;  3LSV A;  5HEO A;  3SH1 A;  3EAM A;  5HCJ A;  4QAA A;  2BYP A;  4TWH A;  5CFB A;  1OED E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...