4HFBA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant (apo)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfbA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfbA01
5BRXA 3TLSA 5KE4A 2LLYA 2WN9A 1UW6A 2WNCA 4QABA 5FJVA 3U8KA 5L47A 2X00D 3RQUA 3C79A 5BW2A 2ZJVA 4QH1A 3WIPA 5L4HA 4Z90A 3UU8A 4A97A 4ZZBA 3LSVA 5HEOA 3TLTA 2BJ0A 4X5TA 3UU4A 5LXBA 1OEDE 4HFEA 3PMZA 4AFHA 4UM3P 2XQ6A 3JADA 4TNVA 4LMLA 5CFBA 2XNTA 2Y54A 4ILAA 1UX2A 4XHEA 5HEUA 4TWFA 5AFJA 3UUBA 5AINA 1OEDB 2WNLA 3WTIA 2MAWA 2Y57A 2W8GA 5J0ZA 4AFGA 3RIAA 5J5IA 3TLVA 4ILCA 2BR7A 2ZJUA 3GUAA 4ZJTA 4ILBA 4BFQA 4HFIA 4HFHA 2M6IA 4A98A 4B5DA 4IL4A 1OEDA 5HEJA 2XZ5A 4UXUA 5LG3A 3WTOA 3WTNA 2W8FA 5AFLA 2LM2A 2BYSA 5HCJA 1OEDC 4TNWA 3RHWA 4WV9A 4HQPA 3U8MA 4DBMA 2BG9B 5HCMA 4ZJSA 3JAEA 2QC1B 4TWDA 3UU3A 2Y58A 2YMEA 3SQ6A 3WTMA 2YN6A 3SIOA 3WTLA 3TLUA 3P4WA 4ALXA 2C9TA 2VL0A 4TWHA 3TLWA 2KSRA 3EAMA 4ZK4A 3IGQA 5HEHA 3U8LA 4HFDA 2BG9A 1UV6A 2PH9A 4NPPA 4ZK1A 2LKGA 4UM3S 2XQ5A 2Y56A 5J5FA 3ZDHA 2XQ4A 3T4MA 2LKHA 4ZRUA 2XNUA 2XNVA 2XQ8A 2BG9E 2XQ7A 4ZR6A 5AFKA 4FRRA 2X00A 4UM3A 3RQWA 2UZ6A 3WTKA 1I9BA 3C84A 5AFHA 2M6BA 5SYOA 3WTHA 2BR8A 4PIRA 4F8HA 2WZYA 3SH1A 5L4EA 3UQ7A 2YMDA 4AFTA 3WTJA 4EZ1A 2Y7YA 3UU6A 4NZBA 2XYSA 4QAAA 3EI0A 2BYQA 3U8NA 2XYTA 2XQ3A 4HFBA 5HEGA 2WNJA 5J5HA 4ZZCA 4QACA 2BYRA 5KZUA 4IL9A 2PGZA 2XZ6A 4UY2A 5CO5A 4LMKA 2BG9C 4COFA 5J5GA 3ZKRA 3EHZA 3RIFA 3UU5A 5BP0A 2BYPA 4UM1A 5AFNA 4HFCA 4QH4A 3SQ9A 5TVCA 4LMJA 2YKSA 4Z91A 5AFMB 4BQTA 2YOEA 3UQ4A 5JMEA 2XQ9A 3ZDGA 4XK9A 4D01A 3PEOA 3RI5A 2BYNA 3U8JA 3JAFA 4QH5A 3P50A 5IUXA 2XQAA 5AFMA 4IREA
chains in the Genus database with same CATH superfamily
1US7B 5F3JA 5AQGB 1ZP0A 1D0YA 3ETUA 3C51A 1HX1B 2YDSA 1HNXT 5L3DB 4OYKA 3NWIA 4O8SA 2ACZA 4GIWA 3C4ZA 2DL1A 2VL8A 3NRYA 4JUYA 2W63A 4TWFA 3L09A 3UUBA 5JDHA 2MAWA 4ILCA 2H89A 3FXEB 4AKIA 2N9DA 1O3XA 1SHZC 1YXRA 4I0UA 3WTNA 4KMCA 4PK4A 4MLKA 2BG9B 5HCMA 5KX5E 4UVAB 3AE6A 2YN6A 4JI4T 3SFDA 2Q9QB 3TLWA 4L0RA 4NPPA 1T98A 3ANWA 4TX5A 2BG9E 5L2LA 3D0TA 5AQFB 5AFHA 2IIUA 4PIRA 4JBWF 3AECA 4O2AE 2JJ9A 5FY0A 5H6RB 2J62A 4DV2T 5AFMB 2N2NA 2RPAA 1U4QA 5JRCA 1KNRA 4HWIB 1N33T 4ZXLA 4YTPA 4UF0B 2ES0A 5FL0A 3PUWF 4QABA 1DU2A 4DV6T 4A56A 3UUXB 2KZ7B 2FBWA 5LNKA 1W0AA 3ZT5A 3QUJA 3AAIA 4X5TA 5LXBA 2NW9A 4UR9A 3A5XA 2WZIA 2D2SA 3SS1A 1GQEA 3L8RA 2BS4A 3GUAA 5TAOA 4ZJTA 5GONE 3ZCJA 4OFZA 2LM2A 4KBMB 3VRAA 3Q5WA 5M4YA 4WV9A 1BR4A 1NENA 1LVFA 4GK5E 4PJLA 3K3OA 5CGMA 3JC6D 4H63H 5JR9B 4N78D 5JDLA 1HG2A 2BKOA 4MFRA 5JQGE 2L9QA 4UXNB 2YU2A 3MK7C 2XQ7A 2WBLA 4I50E 4ZHQE 5JR9C 1FJGT 3UQ7A 3WTJA 1X79A 5LYJE 3RYIE 1WYBA 4C90A 3M3ZB 4UY2A 2VKOA 2UXXB 2W4XA 1I6ZA 2BYPA 2WDQA 2XM2A 4X65T 2VKDA 4DV7T 2YOEA 1CUNA 5FXVA 2QA7A 4D01A 4FI5A 4QH5A 3QK6A 5H6QB 2LSYA 5J2TE 2Y48B 3VU7H 5JH7E 2LLYA 3H37A 4CXXA 4DV5T 3CQGB 3EDVA 4B3ST 5FJVA 1QSDA 2E9XC 2J4GA 1S94A 5DJQC 3MZKB 5IYZE 4AFHA 2ZM0A 3T8OA 2LJLA 3DP7A 3ZSSA 2ZLYA 2WNLA 1M62A 3BQLA 1ZEEA 4L5GA 3ZEFB 4H9RC 4EV6A 2YEVC 2YDRA 1BR1A 1OWAA 2VKJA 3PUSA 5AQTB 3U78A 4YSYA 3HA4A 2KSRA 4X20E 2IMLA 4ZK1A 2LKGA 4KUMB 4PFPA 2VQET 2XQ4A 2Y8DA 4I4TE 3ZYKA 3M65A 3I9WA 3SOLA 4EEBA 1Z0PA 5SYOA 4U7YA 4B3MT 3PV0F 2CEAA 2XZ6A 5AQSB 2EHOB 3ZMSB 5KDMC 3ZKRA 4DO0A 3CMLA 2W61A 2YKSA 3I9YA 3PUGA 1MIVA 3ZJ2A 2PG8A 3BQIA 2X68A 1JNZA 3AEBA 4ZK4A 5L3CB 5BRXA 2XUEA 2WN9A 2W0GA 4I55E 4JI8T 1VOMA 4CN6A 3ZCIA 1XNQT 3N9MA 3ZJ1A 2F4VT 2XJ7A 5FL1A 3AE2A 3PMZA 4JEUB 3KFWX 2XQ6A 5AQHB 2VQFT 4GYRA 5J0ZA 3C50A 1J5WA 3E08A 1MNEA 4O4IE 3ZC0A 2LOPA 2QC1B 3UT5E 2VL0A 4TWHA 1HNZT 4IDZA 1W9RA 2BG9A 3BQKA 2LRLA 2Q9QA 4DMWA 4CI1B 2VWAA 1WCRA 3EUHA 1UK5A 4F8HA 2WZYA 4IE6A 4DR7T 3UU6A 2BS2A 1IAPA 3KBUA 3GWHA 4PJJA 4ZZCA 2DCFA 5L3BB 3GN5B 2RA1A 5HXHA 2V1DB 4LF8T 1KFYA 3OPCA 2DLRA 3E0ZA 3JAFA 2DHRA 2X66A 5AQNB 5DQWA 2LE8A 2X0LB 5AFMA 5FVLA 5CJ5A 2ODVA 1IBLT 5JREA 2X9WA 4ILUA 2X00D 3RQUA 4UF0A 2XAFB 1MIWA 2MTQA 4A97A 1MMGA 3S4UA 3PTRB 3AA6B 4LF5T 5AQVB 4ASKA 4HFEA 4EB6E 3K3NA 2XNTA 3UFEA 4IDOA 5ABHA 4YHJA 2WCAA 3OTOT 2BR7A 3MA9A 5LBQB 1R8IA 4YSXA 2V7JA 3FB2A 4EGWA 3RHWA 3FBLA 4ZJSA 3MXZA 1UUSA 3N9PA 3P4SA 2C9TA 4O2BE 4YLHA 5C8YE 3QOFA 2V5CA 3RC8A 3B5MA 2Y56A 3CVRA 5KXJA 4ZRUA 2XASB 2CBJA 3OBVE 2AXDS 2XQ8A 1BR0A 4XAXB 2JMKA 4QHOA 2BS3A 1WFDA 2OLTA 4A5XA 4IT4A 3EI0A 3H3AA 3U8NA 2WWUA 5DQVA 3KVAA 2WWVA 3RKOA 3AE1A 3OYXA 4EOZB 2NP9A 4YFSA 4Z91A 4U31A 4ZI2C 3ETVA 3P4QA 2HPLA 5AQMB 3SFEA 3MKDA 1G73A 5FKYA 1T8BA 3RPUA 4UVCB 2ACXA 2V6XA 2ZJVA 3FBZA 2WSSV 3DJBA 3NZQA 2UXDT 2WDRA 2W66A 2C5IT 3GA8A 5LA6E 3O9XA 2BJ0A 1OEDE 3K8PC 4QKNA 5KMGP 2X0YA 3HKDE 4ILAA 5HWXA 5L3EB 1MIYA 4MHCA 2W8GA 5FYMA 3ZSTA 4PJNA 2XM1A 4H63V 3AE5A 2XZEA 4HQPA 2XAGB 1X9BA 3UULA 4IDNA 5JDGA 3WTMA 3MACA 3ZMVB 3K1SA 4HFVA 3U8LA 1JNRA 3CX8B 4GK0E 4H9NC 4HWCA 4ADZA 5HXRA 2M67A 3N9LA 4CN4A 1YQ3A 1KK7A 4IE5A 3AB3B 3C98B 5AFKA 1XNRT 1WR0A 4LF6T 3KV9A 1UGOA 3PUZF 3RF1A 2V5DA 2CXFA 5FVKA 4IDQA 3VHLA 5HXCA 4QAAA 4WYVA 3QB5A 3AXJB 3NRXA 2IC6A 4UVBB 4DR1T 2BG9C 2I6HA 3AE7A 4PK6A 3SQ9A 2OV9A 4CI2B 2Q9QC 2QVAA 3O1HA 5JMEA 5F8PA 2EHOA 5LMNT 4X64T 5IUXA 2XQAA 1BR2A 3FZHB 5AQJB 3OJAA 2C5KT 3I0OA 3PURA 3C79A 2VB6A 2LSKA 4IIJE 4UV8B 5LMUT 2W62A 1YKEB 2CWOA 5CA0E 3IF8B 2XHEB 1N34T 1T7SA 4HEAA 4DV0T 1XMQT 1IBKT 1QLBA 1SA0E 4ZI3C 4FJOA 3Q5EA 4DR6T 4B5DA 4U2ZA 1N32T 4DV1T 2D0TA 1UX5A 2LSIA 2IDOB 3LJCA 4QWNB 4O4HE 5AQLB 3ONJA 2KT9A 3LFMA 2K5BB 1B7TA 2ZM6T 4HGAA 3A7MA 3RKGA 5J5FA 1WLXA 3T4MA 2LKHA 2CHOA 1E1HB 5E0OA 3PUQA 4UM3A 2VKHA 4QXCB 1XDPA 3IHRA 3Q5XA 4YY3T 5A1LA 3RYHE 2NR4A 2XYTA 3CX7B 1MMAA 2V26A 4HE8A 2NW8A 4YTNA 3V5UA 5AFNA 5AQPB 5TVCA 4LMJA 3KV4A 2BKPA 2XQYA 3PEOA 1IZNB 1YW0A 3GN5A 2VURA 4ISTA 4LFCT 1WYCA 4AQFC 2X9YA 3WAKA 2CA5A 2CBIA 5BW2A 5JDQA 4Z90A 4DMVA 1AJ3A 4LFAT 3ZYMA 2CMRA 2AE9A 3P4PA 3CKDA 2H88A 3PUAA 4YJ2E 4NUUA 4CQIA 2IW5B 2A9UA 4AKHA 2XSBA 4WBOA 3N9QA 3B13A 4HFHA 4TUYE 4A98A 3U3IA 2UUAT 4U33A 4CXWA 3ZPOA 4IGUA 3KV6A 2WDVA 3ZMTB 3T1YT 2B76A 3SQ6A 4ALXA 4PFOA 3CIRA 4KP3C 4AQGA 2K3WA 3RLFF 4ANJA 4UM3S 2XQ5A 2XAHB 2L8KA 2V7LA 2FJEA 2PBIA 4AXPA 2WB5A 1SUMB 4IE7A 2BDEA 3CPZA 3FHNA 5L3GB 2YMDA 4AFTA 2YINA 4JEHB 2Y7YA 4NXNT 4NZBA 5EK4A 4ISSA 3HL6A 4P1NA 3F57A 1CHUA 1XWMA 3ZT7A 2NW7A 4LMKA 4UIGA 4QH4A 4ZEYA 4BQTA 2CLYB 5DABA 2A3DA 3PE0A 3RI5A 3PUYF 3ZC1A 2CCQA 4ERRA 5HWYA 2WNCA 3V5SA 2V7KA 2LT3A 3SRZA 3UU8A 3R84B 3ONXA 2IUBA 2WY2A 3LBXB 4LMLA 2EHOC 3AEEA 5AINA 1LKXA 4YXDA 3AAAB 2D5UA 4X1KE 4HFIA 2KXPB 2WMOA 1Y01A 4U2YA 3WTOA 4EZ4A 1HCIA 2NTYA 4U7IA 4HTEA 4JLEA 4TWDA 2YMEA 4HWDA 3WTLA 3TLUA 3P4WA 4YJ3E 1ZOYA 4ZI7E 4PAGA 4K0KT 4MALA 2JQ9A 2JMHA 1Z8UA 2N1GA 3PDYA 4L9IA 1U5PA 2QRXA 5LXTE 1ZKEA 2XNUA 2XNVA 3PU8A 5HAXA 4QXBB 1LRZA 2XTLA 2UZ6A 2C5JA 5LG4A 2MYSA 4TV8E 2H7OA 4X1IE 3SH1A 1WRDA 3PUXF 4KX6A 5FXWA 2ODUA 1Y64B 4QACA 2V7IA 3N5LA 3VKHA 5J5GA 2PFVA 3AEDA 1J1JA 3AXJA 1V9DA 3ZDGA 4XK9A 5AQKB 3U8JA 4O4JE 1MMDA 3HR0A 4DNDA 3WAJA 4DVDA 2W2UA 4YHHT 5KE4A 2OA5A 1UW6A 2HN1A 2V8SV 5L4HA 5FNVE 3AAEB 3P8CD 3C4XA 1FEWA 2E9XD 3JADA 2KLQA 1UX2A 5AFJA 2MBGA 2CXLA 5FXZA 5HXSA 3N2OA 1W0BA 3VR8A 4IL4A 3T1HT 3C64A 4OX9T 2XZ5A 4UELA 2E8IA 5HCJA 1W09A 5HYAA 3N9OA 4GKJT 3AEGA 5JTGA 1KNPA 2IAKA 3EAMA 1KF6A 1D1CA 2DWKA 4AI6A 4I43B 3Q9DA 4X1YE 3PU3A 4B3TT 3LK3B 1NWMX 3J9X1 2M6BA 3WTHA 2MPKA 2DNXA 4HWHA 5LJMA 4EZ1A 3AE3A 2A2FX 4ZS3A 3FZLB 3ZT6A 4IL9A 5CO5A 5BP0A 3W15B 3RGLA 4IHJE 2XQ9A 2VK9A 2BZBA 3P4RA 3E22E 4NUVA 4AQYT 4JI3T 4AQFA 2WZHA 2UXCT 4EEDA 4JI2T 4C91A 3EDUA 2BBHA 2NOXA 2V6YB 5AQOB 3QNUA 2WP9A 4JI1T 3RIUA 2EHOD 2BVLA 4H9SE 3N2GE 1ZHCA 3VKGA 3KINB 2C0SA 2XY8B 5EK3A 4WNKA 4V1Av 1OEDB 3WTIA 5J5IA 3ZN0B 3C4WA 4JI5T 5LOVE 5LG3A 2DI4A 3JC6C 5J2UE 2HN2A 1OEDC 1VCTA 5AQUB 5EZYE 3RRCA 4DV3T 1L0VA 3L39A 1HR0T 4ZR6A 4FRRA 4MBQA 2X00A 1HFAA 2BVMA 5LJNA 1I9BA 3I1AA 4YT0A 2XYSA 2LSJA 1M7KA 1E2AA 3P7IA 3KBTA 2K9AA 4H9QC 4CZZB 2IC9A 1XZYA 2PTFA 3RYCE 4KI0F 4AISA 2LSGA 3TLSA 4B3RT 3VRBA 3WI3A 1SE7A 4B6XA 1NEKA 3IBPA 1S35A 4OHFA 4U74A 1YQ4A 3O1IA 2A72A 4PW8A 2KNDA 2KWHA 3OYZA 2KMFA 2L3LA 4QX8B 1E7PA 2PJQA 4AFGA 3N9NA 3R6NA 4HWFA 3LBXA 2JRKA 3LK42 4UXUA 3ZYLA 2E2AA 5FXXA 1UX4A 2Y58A 5ABEA 3IGQA 5HEHA 2X9XA 3CK6A 4J2CA 1UV6A 2WU2A 4KHZF 4M1PA 5BR8T 4JYAT 4HKAA 3EABA 3UUNA 4H9PC 2BBJA 2D0UA 3WTKA 3HI2A 4AIUA 4LF4T 2I0MA 3RC3A 3B57A 4NXMT 2BYQA 4Q25A 3AA0B 5KZUA 2PGZA 4P0AA 4KHPT 2E5LT 5F5WA 4UM1A 1IJ6A 3AE4A 4G2AA 4E7ZA 4ZOLE 3L3PA 2Y6XA 4BJNA 2P9BA 3P50A 3RYFE 2X0HA 1HX8A 3RX6A 4ZI2D 5JDFA 4HN9A 2JIWA 3ONLC 2JQQA 3NKZA 1N36T 2QYWA 3LDQB 3TLTA 2CWYA 3CQCB 4TNVA 3CQXC 5CFBA 1HF8A 2ZJUA 3IA3A 1MNDA 5HEJA 4BJMA 3FZFB 3DTOA 2XAQB 2HPJA 4TNWA 3RIUC 3F31A 4YTMA 2ZM8A 3SIOA 5AQQB 4IDPA 3J7Yq 2XSAA 3NBXX 3QC9A 4JI0T 3FZMB 5ABFA 4DR3T 3AE9A 4DBRA 2CE7A 5BMVE 1HTJF 3AEFA 2VVSA 3HKEE 2J47A 3LG7A 3RQWA 4WZXA 2E9XB 1EZ3A 2WMNA 3ZN1B 5IWAT 2BR8A 4NIQA 5LP6E 4PK5A 5LCYA 3RRWA 3KVBA 5HEGA 5J5HA 2BYRA 3PUVF 3UFGA 4JV5T 3EHZA 2K24A 2JPFA 3UQ4A 4DIDB 2UU9T 2CRBA 3OVUA 4IREA 3LK2B 2WS3A 4CI3B 2Q9QD 1XMOT 5LB7B 3GMIA 3AVSA 5L47A 4CXYA 4QH1A 3HKBE 4DUYT 1VCSA 3ABVA 4UEMA 1XDOA 4ZZBA 2V6YA 5HEOA 5LBMA 4DR2T 2ZMAA 2YU1A 1H7CA 1G8XA 1YKHB 2HHHT 4YSZA 4F6RC 2UUBT 1FMVA 3N2KE 2CLYC 1UURA 1OEDA 1YD8G 2W8FA 4DBQA 4JI6T 2HH7A 4DBMA 4QXHB 4ZI3D 3ANWB 3CX6B 3O4XE 2X51A 1HS7A 4X66T 4WW0A 1OXZA 3UTKA 1HNWT 4WBNE 4P0BA 5EK2A 1ZV4X 1UCUA 3ZDHA 3Q5DA 1HG5A 3PJAA 4XBFB 3C84A 2XPKA 5FP3A 5C2TA 4PJMA 2WM9A 5L4EA 4X62T 3TKLB 4IE4A 5IHYA 4CN1A 4HFBA 2WNJA 2LHNA 5AQRB 5JRCB 4U72A 3I0QA 4LFBT 2G0UA 3HKCE 4H9OC 1J5ET 2LEHA 2BYNA 1IJ5A 2CM0A 2CHNA 3AE8A 4QX7B 1VRBA 5ABGA 4TV9E 2FJDA 4ZS2A 1NAFA 2ZM2A 5AQIB 2WAUA 4OK0A 2DWGA 3ZMUB 5LGUB 3ZMZB 5LHGB 4K0UA 3Q2MA 3UU4A 4AKGA 3BK9A 3K3QC 3H3MA 2SPCA 3RIAA 1QUUA 2UXNB 4OYJA 5LHHB 4DR5T 4ILBA 2NTXA 2M6IA 2LHRA 3KDSE 4G63A 3NZPA 1LVKA 2NWBA 3F2EA 2FJBA 5AFLA 5ETWA 2LOSA 2QGSA 3JAEA 3MJXA 4UV9B 5ADXL 4EXTA 1IBMT 4XZCA 4P09A 2LRKA 4HFDA 5AFUL 2BKNA 4TZ4C 5FY1A 2J1DG 5FMNA 4BAYB 1D1BA 3AVRA 5CA1E 3G06A 2CXDA 5FY7A 4EAHA 4E7SA 1FIOA 4O4LE 3FZKB 2YK0A 5ABFB 2KINB 1D1AA 4GKKT 5LGTB 3SWHA 2XQ3A 3JCFA 3A8YC 4DR4T 2D9DA 4EYYR 5JDNA 2LM9A 3AEAA 2FUPA 4COFA 2VVNA 3RIFA 1WR6A 2WU5A 4HFCA 4DV4T 2MOZA 4AKRB 4TN7B 2H7VC 2JQKA 4GOUA 1FMWA 2UXBT 2W00A 4AKLA 5JVDE 2UUCT 3AA7B 3U8KA 5L3FB 4U3CA 1MMNA 4Z8XA 3IEEA 3WIPA 2XAJB 2H3RA 2B1EA 3OKQA 2CPTA 2WQYA 3LSVA 2X67A 4EIWA 1KEYA 4UM3P 3O1JA 2Y54A 4XHEA 5HEUA 3VR9A 3QB5K 3X1DA 2X9HA 2Y57A 2JQHA 5LGNB 3TLVA 1T72A 4DUZT 4BFQA 4LF9T 4EYUA 5HXEA 1KNZA 2K48A 3NVOA 5JR9A 2BYSA 3U8MA 3RH3A 2GK9A 3UU3A 5C3JA 3PJAJ 2W67A 4JI7T 2RP4A 2PH9A 2V7MA 2FJAA 5LHIB 3ESLA 4LF7T 5CB4E 1D0XA 4EZHA 4PNIA 2IHR1 3CWZB 2I59A 2Z6EA 2E9XA 1D0ZA 2KWIB 5J1GA 3KV5A 3FXDB 3EVYA 2YDQA 4IE0A 3UU5A 1I94T 2E5VA 3ZLIA 3UUMA 2VASA 4GYSA 4BA9A 3AA1B 5JDMA 2R6GF
chains in the Genus database with same CATH topology
5BRXA 3TLSA 5KE4A 2LLYA 2WN9A 1UW6A 2WNCA 4QABA 5FJVA 3U8KA 5L47A 2X00D 3RQUA 3C79A 5BW2A 2ZJVA 4QH1A 3WIPA 5L4HA 4Z90A 3UU8A 4A97A 4ZZBA 3LSVA 5HEOA 3TLTA 2BJ0A 4X5TA 3UU4A 5LXBA 1OEDE 4HFEA 3PMZA 4AFHA 4UM3P 2XQ6A 3JADA 4TNVA 4LMLA 5CFBA 2XNTA 2Y54A 4ILAA 1UX2A 4XHEA 5HEUA 4TWFA 5AFJA 3UUBA 5AINA 1OEDB 2WNLA 3WTIA 2MAWA 2Y57A 2W8GA 5J0ZA 4AFGA 3RIAA 5J5IA 3TLVA 4ILCA 2BR7A 2ZJUA 3GUAA 4ZJTA 4ILBA 4BFQA 4HFIA 4HFHA 2M6IA 4A98A 4B5DA 4IL4A 1OEDA 5HEJA 2XZ5A 4UXUA 5LG3A 3WTOA 3WTNA 2W8FA 5AFLA 2LM2A 2BYSA 5HCJA 1OEDC 4TNWA 3RHWA 4WV9A 4HQPA 3U8MA 4DBMA 2BG9B 5HCMA 4ZJSA 3JAEA 2QC1B 4TWDA 3UU3A 2Y58A 2YMEA 3SQ6A 3WTMA 2YN6A 3SIOA 3WTLA 3TLUA 3P4WA 4ALXA 2C9TA 2VL0A 4TWHA 3TLWA 2KSRA 3EAMA 4ZK4A 3IGQA 5HEHA 3U8LA 4HFDA 2BG9A 1UV6A 2PH9A 4NPPA 4ZK1A 2LKGA 4UM3S 2XQ5A 2Y56A 5J5FA 3ZDHA 2XQ4A 3T4MA 2LKHA 4ZRUA 2XNUA 2XNVA 2XQ8A 2BG9E 2XQ7A 4ZR6A 5AFKA 4FRRA 2X00A 4UM3A 3RQWA 2UZ6A 3WTKA 1I9BA 3C84A 5AFHA 2M6BA 5SYOA 3WTHA 2BR8A 4PIRA 4F8HA 2WZYA 3SH1A 5L4EA 3UQ7A 2YMDA 4AFTA 3WTJA 4EZ1A 2Y7YA 3UU6A 4NZBA 2XYSA 4QAAA 3EI0A 2BYQA 3U8NA 2XYTA 2XQ3A 4HFBA 5HEGA 2WNJA 5J5HA 4ZZCA 4QACA 2BYRA 5KZUA 4IL9A 2PGZA 2XZ6A 4UY2A 5CO5A 4LMKA 2BG9C 4COFA 5J5GA 3ZKRA 3EHZA 3RIFA 3UU5A 5BP0A 2BYPA 4UM1A 5AFNA 4HFCA 4QH4A 3SQ9A 5TVCA 4LMJA 2YKSA 4Z91A 5AFMB 4BQTA 2YOEA 3UQ4A 5JMEA 2XQ9A 3ZDGA 4XK9A 4D01A 3PEOA 3RI5A 2BYNA 3U8JA 3JAFA 4QH5A 3P50A 5IUXA 2XQAA 5AFMA 4IREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BRX A;  3TLS A;  5KE4 A;  2LLY A;  2WN9 A;  1UW6 A;  2WNC A;  4QAB A;  5FJV A;  3U8K A;  5L47 A;  2X00 D;  3RQU A;  3C79 A;  5BW2 A;  2ZJV A;  4QH1 A;  3WIP A;  5L4H A;  4Z90 A;  3UU8 A;  4A97 A;  4ZZB A;  3LSV A;  5HEO A;  3TLT A;  2BJ0 A;  4X5T A;  3UU4 A;  5LXB A;  1OED E;  4HFE A;  3PMZ A;  4AFH A;  4UM3 P;  2XQ6 A;  3JAD A;  4TNV A;  4LML A;  5CFB A;  2XNT A;  2Y54 A;  4ILA A;  1UX2 A;  4XHE A;  5HEU A;  4TWF A;  5AFJ A;  3UUB A;  5AIN A;  1OED B;  2WNL A;  3WTI A;  2MAW A;  2Y57 A;  2W8G A;  5J0Z A;  4AFG A;  3RIA A;  5J5I A;  3TLV A;  4ILC A;  2BR7 A;  2ZJU A;  3GUA A;  4ZJT A;  4ILB A;  4BFQ A;  4HFI A;  4HFH A;  2M6I A;  4A98 A;  4B5D A;  4IL4 A;  1OED A;  5HEJ A;  2XZ5 A;  4UXU A;  5LG3 A;  3WTO A;  3WTN A;  2W8F A;  5AFL A;  2LM2 A;  2BYS A;  5HCJ A;  1OED C;  4TNW A;  3RHW A;  4WV9 A;  4HQP A;  3U8M A;  4DBM A;  2BG9 B;  5HCM A;  4ZJS A;  3JAE A;  2QC1 B;  4TWD A;  3UU3 A;  2Y58 A;  2YME A;  3SQ6 A;  3WTM A;  2YN6 A;  3SIO A;  3WTL A;  3TLU A;  3P4W A;  4ALX A;  2C9T A;  2VL0 A;  4TWH A;  3TLW A;  2KSR A;  3EAM A;  4ZK4 A;  3IGQ A;  5HEH A;  3U8L A;  4HFD A;  2BG9 A;  1UV6 A;  2PH9 A;  4NPP A;  4ZK1 A;  2LKG A;  4UM3 S;  2XQ5 A;  2Y56 A;  5J5F A;  3ZDH A;  2XQ4 A;  3T4M A;  2LKH A;  4ZRU A;  2XNU A;  2XNV A;  2XQ8 A;  2BG9 E;  2XQ7 A;  4ZR6 A;  5AFK A;  4FRR A;  2X00 A;  4UM3 A;  3RQW A;  2UZ6 A;  3WTK A;  1I9B A;  3C84 A;  5AFH A;  2M6B A;  5SYO A;  3WTH A;  2BR8 A;  4PIR A;  4F8H A;  2WZY A;  3SH1 A;  5L4E A;  3UQ7 A;  2YMD A;  4AFT A;  3WTJ A;  4EZ1 A;  2Y7Y A;  3UU6 A;  4NZB A;  2XYS A;  4QAA A;  3EI0 A;  2BYQ A;  3U8N A;  2XYT A;  2XQ3 A;  4HFB A;  5HEG A;  2WNJ A;  5J5H A;  4ZZC A;  4QAC A;  2BYR A;  5KZU A;  4IL9 A;  2PGZ A;  2XZ6 A;  4UY2 A;  5CO5 A;  4LMK A;  2BG9 C;  4COF A;  5J5G A;  3ZKR A;  3EHZ A;  3RIF A;  3UU5 A;  5BP0 A;  2BYP A;  4UM1 A;  5AFN A;  4HFC A;  4QH4 A;  3SQ9 A;  5TVC A;  4LMJ A;  2YKS A;  4Z91 A;  5AFM B;  4BQT A;  2YOE A;  3UQ4 A;  5JME A;  2XQ9 A;  3ZDG A;  4XK9 A;  4D01 A;  3PEO A;  3RI5 A;  2BYN A;  3U8J A;  3JAF A;  4QH5 A;  3P50 A;  5IUX A;  2XQA A;  5AFM A;  4IRE A; 
#chains in the Genus database with same CATH topology
 1US7 B;  5F3J A;  5AQG B;  1ZP0 A;  1D0Y A;  3ETU A;  3C51 A;  1HX1 B;  2YDS A;  1HNX T;  5L3D B;  4OYK A;  3NWI A;  4O8S A;  2ACZ A;  4GIW A;  3C4Z A;  2DL1 A;  2VL8 A;  3NRY A;  4JUY A;  2W63 A;  4TWF A;  3L09 A;  3UUB A;  5JDH A;  2MAW A;  4ILC A;  2H89 A;  3FXE B;  4AKI A;  2N9D A;  1O3X A;  1SHZ C;  1YXR A;  4I0U A;  3WTN A;  4KMC A;  4PK4 A;  4MLK A;  2BG9 B;  5HCM A;  5KX5 E;  4UVA B;  3AE6 A;  2YN6 A;  4JI4 T;  3SFD A;  2Q9Q B;  3TLW A;  4L0R A;  4NPP A;  1T98 A;  3ANW A;  4TX5 A;  2BG9 E;  5L2L A;  3D0T A;  5AQF B;  5AFH A;  2IIU A;  4PIR A;  4JBW F;  3AEC A;  4O2A E;  2JJ9 A;  5FY0 A;  5H6R B;  2J62 A;  4DV2 T;  5AFM B;  2N2N A;  2RPA A;  1U4Q A;  5JRC A;  1KNR A;  4HWI B;  1N33 T;  4ZXL A;  4YTP A;  4UF0 B;  2ES0 A;  5FL0 A;  3PUW F;  4QAB A;  1DU2 A;  4DV6 T;  4A56 A;  3UUX B;  2KZ7 B;  2FBW A;  5LNK A;  1W0A A;  3ZT5 A;  3QUJ A;  3AAI A;  4X5T A;  5LXB A;  2NW9 A;  4UR9 A;  3A5X A;  2WZI A;  2D2S A;  3SS1 A;  1GQE A;  3L8R A;  2BS4 A;  3GUA A;  5TAO A;  4ZJT A;  5GON E;  3ZCJ A;  4OFZ A;  2LM2 A;  4KBM B;  3VRA A;  3Q5W A;  5M4Y A;  4WV9 A;  1BR4 A;  1NEN A;  1LVF A;  4GK5 E;  4PJL A;  3K3O A;  5CGM A;  3JC6 D;  4H63 H;  5JR9 B;  4N78 D;  5JDL A;  1HG2 A;  2BKO A;  4MFR A;  5JQG E;  2L9Q A;  4UXN B;  2YU2 A;  3MK7 C;  2XQ7 A;  2WBL A;  4I50 E;  4ZHQ E;  5JR9 C;  1FJG T;  3UQ7 A;  3WTJ A;  1X79 A;  5LYJ E;  3RYI E;  1WYB A;  4C90 A;  3M3Z B;  4UY2 A;  2VKO A;  2UXX B;  2W4X A;  1I6Z A;  2BYP A;  2WDQ A;  2XM2 A;  4X65 T;  2VKD A;  4DV7 T;  2YOE A;  1CUN A;  5FXV A;  2QA7 A;  4D01 A;  4FI5 A;  4QH5 A;  3QK6 A;  5H6Q B;  2LSY A;  5J2T E;  2Y48 B;  3VU7 H;  5JH7 E;  2LLY A;  3H37 A;  4CXX A;  4DV5 T;  3CQG B;  3EDV A;  4B3S T;  5FJV A;  1QSD A;  2E9X C;  2J4G A;  1S94 A;  5DJQ C;  3MZK B;  5IYZ E;  4AFH A;  2ZM0 A;  3T8O A;  2LJL A;  3DP7 A;  3ZSS A;  2ZLY A;  2WNL A;  1M62 A;  3BQL A;  1ZEE A;  4L5G A;  3ZEF B;  4H9R C;  4EV6 A;  2YEV C;  2YDR A;  1BR1 A;  1OWA A;  2VKJ A;  3PUS A;  5AQT B;  3U78 A;  4YSY A;  3HA4 A;  2KSR A;  4X20 E;  2IML A;  4ZK1 A;  2LKG A;  4KUM B;  4PFP A;  2VQE T;  2XQ4 A;  2Y8D A;  4I4T E;  3ZYK A;  3M65 A;  3I9W A;  3SOL A;  4EEB A;  1Z0P A;  5SYO A;  4U7Y A;  4B3M T;  3PV0 F;  2CEA A;  2XZ6 A;  5AQS B;  2EHO B;  3ZMS B;  5KDM C;  3ZKR A;  4DO0 A;  3CML A;  2W61 A;  2YKS A;  3I9Y A;  3PUG A;  1MIV A;  3ZJ2 A;  2PG8 A;  3BQI A;  2X68 A;  1JNZ A;  3AEB A;  4ZK4 A;  5L3C B;  5BRX A;  2XUE A;  2WN9 A;  2W0G A;  4I55 E;  4JI8 T;  1VOM A;  4CN6 A;  3ZCI A;  1XNQ T;  3N9M A;  3ZJ1 A;  2F4V T;  2XJ7 A;  5FL1 A;  3AE2 A;  3PMZ A;  4JEU B;  3KFW X;  2XQ6 A;  5AQH B;  2VQF T;  4GYR A;  5J0Z A;  3C50 A;  1J5W A;  3E08 A;  1MNE A;  4O4I E;  3ZC0 A;  2LOP A;  2QC1 B;  3UT5 E;  2VL0 A;  4TWH A;  1HNZ T;  4IDZ A;  1W9R A;  2BG9 A;  3BQK A;  2LRL A;  2Q9Q A;  4DMW A;  4CI1 B;  2VWA A;  1WCR A;  3EUH A;  1UK5 A;  4F8H A;  2WZY A;  4IE6 A;  4DR7 T;  3UU6 A;  2BS2 A;  1IAP A;  3KBU A;  3GWH A;  4PJJ A;  4ZZC A;  2DCF A;  5L3B B;  3GN5 B;  2RA1 A;  5HXH A;  2V1D B;  4LF8 T;  1KFY A;  3OPC A;  2DLR A;  3E0Z A;  3JAF A;  2DHR A;  2X66 A;  5AQN B;  5DQW A;  2LE8 A;  2X0L B;  5AFM A;  5FVL A;  5CJ5 A;  2ODV A;  1IBL T;  5JRE A;  2X9W A;  4ILU A;  2X00 D;  3RQU A;  4UF0 A;  2XAF B;  1MIW A;  2MTQ A;  4A97 A;  1MMG A;  3S4U A;  3PTR B;  3AA6 B;  4LF5 T;  5AQV B;  4ASK A;  4HFE A;  4EB6 E;  3K3N A;  2XNT A;  3UFE A;  4IDO A;  5ABH A;  4YHJ A;  2WCA A;  3OTO T;  2BR7 A;  3MA9 A;  5LBQ B;  1R8I A;  4YSX A;  2V7J A;  3FB2 A;  4EGW A;  3RHW A;  3FBL A;  4ZJS A;  3MXZ A;  1UUS A;  3N9P A;  3P4S A;  2C9T A;  4O2B E;  4YLH A;  5C8Y E;  3QOF A;  2V5C A;  3RC8 A;  3B5M A;  2Y56 A;  3CVR A;  5KXJ A;  4ZRU A;  2XAS B;  2CBJ A;  3OBV E;  2AXD S;  2XQ8 A;  1BR0 A;  4XAX B;  2JMK A;  4QHO A;  2BS3 A;  1WFD A;  2OLT A;  4A5X A;  4IT4 A;  3EI0 A;  3H3A A;  3U8N A;  2WWU A;  5DQV A;  3KVA A;  2WWV A;  3RKO A;  3AE1 A;  3OYX A;  4EOZ B;  2NP9 A;  4YFS A;  4Z91 A;  4U31 A;  4ZI2 C;  3ETV A;  3P4Q A;  2HPL A;  5AQM B;  3SFE A;  3MKD A;  1G73 A;  5FKY A;  1T8B A;  3RPU A;  4UVC B;  2ACX A;  2V6X A;  2ZJV A;  3FBZ A;  2WSS V;  3DJB A;  3NZQ A;  2UXD T;  2WDR A;  2W66 A;  2C5I T;  3GA8 A;  5LA6 E;  3O9X A;  2BJ0 A;  1OED E;  3K8P C;  4QKN A;  5KMG P;  2X0Y A;  3HKD E;  4ILA A;  5HWX A;  5L3E B;  1MIY A;  4MHC A;  2W8G A;  5FYM A;  3ZST A;  4PJN A;  2XM1 A;  4H63 V;  3AE5 A;  2XZE A;  4HQP A;  2XAG B;  1X9B A;  3UUL A;  4IDN A;  5JDG A;  3WTM A;  3MAC A;  3ZMV B;  3K1S A;  4HFV A;  3U8L A;  1JNR A;  3CX8 B;  4GK0 E;  4H9N C;  4HWC A;  4ADZ A;  5HXR A;  2M67 A;  3N9L A;  4CN4 A;  1YQ3 A;  1KK7 A;  4IE5 A;  3AB3 B;  3C98 B;  5AFK A;  1XNR T;  1WR0 A;  4LF6 T;  3KV9 A;  1UGO A;  3PUZ F;  3RF1 A;  2V5D A;  2CXF A;  5FVK A;  4IDQ A;  3VHL A;  5HXC A;  4QAA A;  4WYV A;  3QB5 A;  3AXJ B;  3NRX A;  2IC6 A;  4UVB B;  4DR1 T;  2BG9 C;  2I6H A;  3AE7 A;  4PK6 A;  3SQ9 A;  2OV9 A;  4CI2 B;  2Q9Q C;  2QVA A;  3O1H A;  5JME A;  5F8P A;  2EHO A;  5LMN T;  4X64 T;  5IUX A;  2XQA A;  1BR2 A;  3FZH B;  5AQJ B;  3OJA A;  2C5K T;  3I0O A;  3PUR A;  3C79 A;  2VB6 A;  2LSK A;  4IIJ E;  4UV8 B;  5LMU T;  2W62 A;  1YKE B;  2CWO A;  5CA0 E;  3IF8 B;  2XHE B;  1N34 T;  1T7S A;  4HEA A;  4DV0 T;  1XMQ T;  1IBK T;  1QLB A;  1SA0 E;  4ZI3 C;  4FJO A;  3Q5E A;  4DR6 T;  4B5D A;  4U2Z A;  1N32 T;  4DV1 T;  2D0T A;  1UX5 A;  2LSI A;  2IDO B;  3LJC A;  4QWN B;  4O4H E;  5AQL B;  3ONJ A;  2KT9 A;  3LFM A;  2K5B B;  1B7T A;  2ZM6 T;  4HGA A;  3A7M A;  3RKG A;  5J5F A;  1WLX A;  3T4M A;  2LKH A;  2CHO A;  1E1H B;  5E0O A;  3PUQ A;  4UM3 A;  2VKH A;  4QXC B;  1XDP A;  3IHR A;  3Q5X A;  4YY3 T;  5A1L A;  3RYH E;  2NR4 A;  2XYT A;  3CX7 B;  1MMA A;  2V26 A;  4HE8 A;  2NW8 A;  4YTN A;  3V5U A;  5AFN A;  5AQP B;  5TVC A;  4LMJ A;  3KV4 A;  2BKP A;  2XQY A;  3PEO A;  1IZN B;  1YW0 A;  3GN5 A;  2VUR A;  4IST A;  4LFC T;  1WYC A;  4AQF C;  2X9Y A;  3WAK A;  2CA5 A;  2CBI A;  5BW2 A;  5JDQ A;  4Z90 A;  4DMV A;  1AJ3 A;  4LFA T;  3ZYM A;  2CMR A;  2AE9 A;  3P4P A;  3CKD A;  2H88 A;  3PUA A;  4YJ2 E;  4NUU A;  4CQI A;  2IW5 B;  2A9U A;  4AKH A;  2XSB A;  4WBO A;  3N9Q A;  3B13 A;  4HFH A;  4TUY E;  4A98 A;  3U3I A;  2UUA T;  4U33 A;  4CXW A;  3ZPO A;  4IGU A;  3KV6 A;  2WDV A;  3ZMT B;  3T1Y T;  2B76 A;  3SQ6 A;  4ALX A;  4PFO A;  3CIR A;  4KP3 C;  4AQG A;  2K3W A;  3RLF F;  4ANJ A;  4UM3 S;  2XQ5 A;  2XAH B;  2L8K A;  2V7L A;  2FJE A;  2PBI A;  4AXP A;  2WB5 A;  1SUM B;  4IE7 A;  2BDE A;  3CPZ A;  3FHN A;  5L3G B;  2YMD A;  4AFT A;  2YIN A;  4JEH B;  2Y7Y A;  4NXN T;  4NZB A;  5EK4 A;  4ISS A;  3HL6 A;  4P1N A;  3F57 A;  1CHU A;  1XWM A;  3ZT7 A;  2NW7 A;  4LMK A;  4UIG A;  4QH4 A;  4ZEY A;  4BQT A;  2CLY B;  5DAB A;  2A3D A;  3PE0 A;  3RI5 A;  3PUY F;  3ZC1 A;  2CCQ A;  4ERR A;  5HWY A;  2WNC A;  3V5S A;  2V7K A;  2LT3 A;  3SRZ A;  3UU8 A;  3R84 B;  3ONX A;  2IUB A;  2WY2 A;  3LBX B;  4LML A;  2EHO C;  3AEE A;  5AIN A;  1LKX A;  4YXD A;  3AAA B;  2D5U A;  4X1K E;  4HFI A;  2KXP B;  2WMO A;  1Y01 A;  4U2Y A;  3WTO A;  4EZ4 A;  1HCI A;  2NTY A;  4U7I A;  4HTE A;  4JLE A;  4TWD A;  2YME A;  4HWD A;  3WTL A;  3TLU A;  3P4W A;  4YJ3 E;  1ZOY A;  4ZI7 E;  4PAG A;  4K0K T;  4MAL A;  2JQ9 A;  2JMH A;  1Z8U A;  2N1G A;  3PDY A;  4L9I A;  1U5P A;  2QRX A;  5LXT E;  1ZKE A;  2XNU A;  2XNV A;  3PU8 A;  5HAX A;  4QXB B;  1LRZ A;  2XTL A;  2UZ6 A;  2C5J A;  5LG4 A;  2MYS A;  4TV8 E;  2H7O A;  4X1I E;  3SH1 A;  1WRD A;  3PUX F;  4KX6 A;  5FXW A;  2ODU A;  1Y64 B;  4QAC A;  2V7I A;  3N5L A;  3VKH A;  5J5G A;  2PFV A;  3AED A;  1J1J A;  3AXJ A;  1V9D A;  3ZDG A;  4XK9 A;  5AQK B;  3U8J A;  4O4J E;  1MMD A;  3HR0 A;  4DND A;  3WAJ A;  4DVD A;  2W2U A;  4YHH T;  5KE4 A;  2OA5 A;  1UW6 A;  2HN1 A;  2V8S V;  5L4H A;  5FNV E;  3AAE B;  3P8C D;  3C4X A;  1FEW A;  2E9X D;  3JAD A;  2KLQ A;  1UX2 A;  5AFJ A;  2MBG A;  2CXL A;  5FXZ A;  5HXS A;  3N2O A;  1W0B A;  3VR8 A;  4IL4 A;  3T1H T;  3C64 A;  4OX9 T;  2XZ5 A;  4UEL A;  2E8I A;  5HCJ A;  1W09 A;  5HYA A;  3N9O A;  4GKJ T;  3AEG A;  5JTG A;  1KNP A;  2IAK A;  3EAM A;  1KF6 A;  1D1C A;  2DWK A;  4AI6 A;  4I43 B;  3Q9D A;  4X1Y E;  3PU3 A;  4B3T T;  3LK3 B;  1NWM X;  3J9X 1;  2M6B A;  3WTH A;  2MPK A;  2DNX A;  4HWH A;  5LJM A;  4EZ1 A;  3AE3 A;  2A2F X;  4ZS3 A;  3FZL B;  3ZT6 A;  4IL9 A;  5CO5 A;  5BP0 A;  3W15 B;  3RGL A;  4IHJ E;  2XQ9 A;  2VK9 A;  2BZB A;  3P4R A;  3E22 E;  4NUV A;  4AQY T;  4JI3 T;  4AQF A;  2WZH A;  2UXC T;  4EED A;  4JI2 T;  4C91 A;  3EDU A;  2BBH A;  2NOX A;  2V6Y B;  5AQO B;  3QNU A;  2WP9 A;  4JI1 T;  3RIU A;  2EHO D;  2BVL A;  4H9S E;  3N2G E;  1ZHC A;  3VKG A;  3KIN B;  2C0S A;  2XY8 B;  5EK3 A;  4WNK A;  4V1A v;  1OED B;  3WTI A;  5J5I A;  3ZN0 B;  3C4W A;  4JI5 T;  5LOV E;  5LG3 A;  2DI4 A;  3JC6 C;  5J2U E;  2HN2 A;  1OED C;  1VCT A;  5AQU B;  5EZY E;  3RRC A;  4DV3 T;  1L0V A;  3L39 A;  1HR0 T;  4ZR6 A;  4FRR A;  4MBQ A;  2X00 A;  1HFA A;  2BVM A;  5LJN A;  1I9B A;  3I1A A;  4YT0 A;  2XYS A;  2LSJ A;  1M7K A;  1E2A A;  3P7I A;  3KBT A;  2K9A A;  4H9Q C;  4CZZ B;  2IC9 A;  1XZY A;  2PTF A;  3RYC E;  4KI0 F;  4AIS A;  2LSG A;  3TLS A;  4B3R T;  3VRB A;  3WI3 A;  1SE7 A;  4B6X A;  1NEK A;  3IBP A;  1S35 A;  4OHF A;  4U74 A;  1YQ4 A;  3O1I A;  2A72 A;  4PW8 A;  2KND A;  2KWH A;  3OYZ A;  2KMF A;  2L3L A;  4QX8 B;  1E7P A;  2PJQ A;  4AFG A;  3N9N A;  3R6N A;  4HWF A;  3LBX A;  2JRK A;  3LK4 2;  4UXU A;  3ZYL A;  2E2A A;  5FXX A;  1UX4 A;  2Y58 A;  5ABE A;  3IGQ A;  5HEH A;  2X9X A;  3CK6 A;  4J2C A;  1UV6 A;  2WU2 A;  4KHZ F;  4M1P A;  5BR8 T;  4JYA T;  4HKA A;  3EAB A;  3UUN A;  4H9P C;  2BBJ A;  2D0U A;  3WTK A;  3HI2 A;  4AIU A;  4LF4 T;  2I0M A;  3RC3 A;  3B57 A;  4NXM T;  2BYQ A;  4Q25 A;  3AA0 B;  5KZU A;  2PGZ A;  4P0A A;  4KHP T;  2E5L T;  5F5W A;  4UM1 A;  1IJ6 A;  3AE4 A;  4G2A A;  4E7Z A;  4ZOL E;  3L3P A;  2Y6X A;  4BJN A;  2P9B A;  3P50 A;  3RYF E;  2X0H A;  1HX8 A;  3RX6 A;  4ZI2 D;  5JDF A;  4HN9 A;  2JIW A;  3ONL C;  2JQQ A;  3NKZ A;  1N36 T;  2QYW A;  3LDQ B;  3TLT A;  2CWY A;  3CQC B;  4TNV A;  3CQX C;  5CFB A;  1HF8 A;  2ZJU A;  3IA3 A;  1MND A;  5HEJ A;  4BJM A;  3FZF B;  3DTO A;  2XAQ B;  2HPJ A;  4TNW A;  3RIU C;  3F31 A;  4YTM A;  2ZM8 A;  3SIO A;  5AQQ B;  4IDP A;  3J7Y q;  2XSA A;  3NBX X;  3QC9 A;  4JI0 T;  3FZM B;  5ABF A;  4DR3 T;  3AE9 A;  4DBR A;  2CE7 A;  5BMV E;  1HTJ F;  3AEF A;  2VVS A;  3HKE E;  2J47 A;  3LG7 A;  3RQW A;  4WZX A;  2E9X B;  1EZ3 A;  2WMN A;  3ZN1 B;  5IWA T;  2BR8 A;  4NIQ A;  5LP6 E;  4PK5 A;  5LCY A;  3RRW A;  3KVB A;  5HEG A;  5J5H A;  2BYR A;  3PUV F;  3UFG A;  4JV5 T;  3EHZ A;  2K24 A;  2JPF A;  3UQ4 A;  4DID B;  2UU9 T;  2CRB A;  3OVU A;  4IRE A;  3LK2 B;  2WS3 A;  4CI3 B;  2Q9Q D;  1XMO T;  5LB7 B;  3GMI A;  3AVS A;  5L47 A;  4CXY A;  4QH1 A;  3HKB E;  4DUY T;  1VCS A;  3ABV A;  4UEM A;  1XDO A;  4ZZB A;  2V6Y A;  5HEO A;  5LBM A;  4DR2 T;  2ZMA A;  2YU1 A;  1H7C A;  1G8X A;  1YKH B;  2HHH T;  4YSZ A;  4F6R C;  2UUB T;  1FMV A;  3N2K E;  2CLY C;  1UUR A;  1OED A;  1YD8 G;  2W8F A;  4DBQ A;  4JI6 T;  2HH7 A;  4DBM A;  4QXH B;  4ZI3 D;  3ANW B;  3CX6 B;  3O4X E;  2X51 A;  1HS7 A;  4X66 T;  4WW0 A;  1OXZ A;  3UTK A;  1HNW T;  4WBN E;  4P0B A;  5EK2 A;  1ZV4 X;  1UCU A;  3ZDH A;  3Q5D A;  1HG5 A;  3PJA A;  4XBF B;  3C84 A;  2XPK A;  5FP3 A;  5C2T A;  4PJM A;  2WM9 A;  5L4E A;  4X62 T;  3TKL B;  4IE4 A;  5IHY A;  4CN1 A;  4HFB A;  2WNJ A;  2LHN A;  5AQR B;  5JRC B;  4U72 A;  3I0Q A;  4LFB T;  2G0U A;  3HKC E;  4H9O C;  1J5E T;  2LEH A;  2BYN A;  1IJ5 A;  2CM0 A;  2CHN A;  3AE8 A;  4QX7 B;  1VRB A;  5ABG A;  4TV9 E;  2FJD A;  4ZS2 A;  1NAF A;  2ZM2 A;  5AQI B;  2WAU A;  4OK0 A;  2DWG A;  3ZMU B;  5LGU B;  3ZMZ B;  5LHG B;  4K0U A;  3Q2M A;  3UU4 A;  4AKG A;  3BK9 A;  3K3Q C;  3H3M A;  2SPC A;  3RIA A;  1QUU A;  2UXN B;  4OYJ A;  5LHH B;  4DR5 T;  4ILB A;  2NTX A;  2M6I A;  2LHR A;  3KDS E;  4G63 A;  3NZP A;  1LVK A;  2NWB A;  3F2E A;  2FJB A;  5AFL A;  5ETW A;  2LOS A;  2QGS A;  3JAE A;  3MJX A;  4UV9 B;  5ADX L;  4EXT A;  1IBM T;  4XZC A;  4P09 A;  2LRK A;  4HFD A;  5AFU L;  2BKN A;  4TZ4 C;  5FY1 A;  2J1D G;  5FMN A;  4BAY B;  1D1B A;  3AVR A;  5CA1 E;  3G06 A;  2CXD A;  5FY7 A;  4EAH A;  4E7S A;  1FIO A;  4O4L E;  3FZK B;  2YK0 A;  5ABF B;  2KIN B;  1D1A A;  4GKK T;  5LGT B;  3SWH A;  2XQ3 A;  3JCF A;  3A8Y C;  4DR4 T;  2D9D A;  4EYY R;  5JDN A;  2LM9 A;  3AEA A;  2FUP A;  4COF A;  2VVN A;  3RIF A;  1WR6 A;  2WU5 A;  4HFC A;  4DV4 T;  2MOZ A;  4AKR B;  4TN7 B;  2H7V C;  2JQK A;  4GOU A;  1FMW A;  2UXB T;  2W00 A;  4AKL A;  5JVD E;  2UUC T;  3AA7 B;  3U8K A;  5L3F B;  4U3C A;  1MMN A;  4Z8X A;  3IEE A;  3WIP A;  2XAJ B;  2H3R A;  2B1E A;  3OKQ A;  2CPT A;  2WQY A;  3LSV A;  2X67 A;  4EIW A;  1KEY A;  4UM3 P;  3O1J A;  2Y54 A;  4XHE A;  5HEU A;  3VR9 A;  3QB5 K;  3X1D A;  2X9H A;  2Y57 A;  2JQH A;  5LGN B;  3TLV A;  1T72 A;  4DUZ T;  4BFQ A;  4LF9 T;  4EYU A;  5HXE A;  1KNZ A;  2K48 A;  3NVO A;  5JR9 A;  2BYS A;  3U8M A;  3RH3 A;  2GK9 A;  3UU3 A;  5C3J A;  3PJA J;  2W67 A;  4JI7 T;  2RP4 A;  2PH9 A;  2V7M A;  2FJA A;  5LHI B;  3ESL A;  4LF7 T;  5CB4 E;  1D0X A;  4EZH A;  4PNI A;  2IHR 1;  3CWZ B;  2I59 A;  2Z6E A;  2E9X A;  1D0Z A;  2KWI B;  5J1G A;  3KV5 A;  3FXD B;  3EVY A;  2YDQ A;  4IE0 A;  3UU5 A;  1I94 T;  2E5V A;  3ZLI A;  3UUM A;  2VAS A;  4GYS A;  4BA9 A;  3AA1 B;  5JDM A;  2R6G F; 
#chains in the Genus database with same CATH homology
 5BRX A;  3TLS A;  5KE4 A;  2LLY A;  2WN9 A;  1UW6 A;  2WNC A;  4QAB A;  5FJV A;  3U8K A;  5L47 A;  2X00 D;  3RQU A;  3C79 A;  5BW2 A;  2ZJV A;  4QH1 A;  3WIP A;  5L4H A;  4Z90 A;  3UU8 A;  4A97 A;  4ZZB A;  3LSV A;  5HEO A;  3TLT A;  2BJ0 A;  4X5T A;  3UU4 A;  5LXB A;  1OED E;  4HFE A;  3PMZ A;  4AFH A;  4UM3 P;  2XQ6 A;  3JAD A;  4TNV A;  4LML A;  5CFB A;  2XNT A;  2Y54 A;  4ILA A;  1UX2 A;  4XHE A;  5HEU A;  4TWF A;  5AFJ A;  3UUB A;  5AIN A;  1OED B;  2WNL A;  3WTI A;  2MAW A;  2Y57 A;  2W8G A;  5J0Z A;  4AFG A;  3RIA A;  5J5I A;  3TLV A;  4ILC A;  2BR7 A;  2ZJU A;  3GUA A;  4ZJT A;  4ILB A;  4BFQ A;  4HFI A;  4HFH A;  2M6I A;  4A98 A;  4B5D A;  4IL4 A;  1OED A;  5HEJ A;  2XZ5 A;  4UXU A;  5LG3 A;  3WTO A;  3WTN A;  2W8F A;  5AFL A;  2LM2 A;  2BYS A;  5HCJ A;  1OED C;  4TNW A;  3RHW A;  4WV9 A;  4HQP A;  3U8M A;  4DBM A;  2BG9 B;  5HCM A;  4ZJS A;  3JAE A;  2QC1 B;  4TWD A;  3UU3 A;  2Y58 A;  2YME A;  3SQ6 A;  3WTM A;  2YN6 A;  3SIO A;  3WTL A;  3TLU A;  3P4W A;  4ALX A;  2C9T A;  2VL0 A;  4TWH A;  3TLW A;  2KSR A;  3EAM A;  4ZK4 A;  3IGQ A;  5HEH A;  3U8L A;  4HFD A;  2BG9 A;  1UV6 A;  2PH9 A;  4NPP A;  4ZK1 A;  2LKG A;  4UM3 S;  2XQ5 A;  2Y56 A;  5J5F A;  3ZDH A;  2XQ4 A;  3T4M A;  2LKH A;  4ZRU A;  2XNU A;  2XNV A;  2XQ8 A;  2BG9 E;  2XQ7 A;  4ZR6 A;  5AFK A;  4FRR A;  2X00 A;  4UM3 A;  3RQW A;  2UZ6 A;  3WTK A;  1I9B A;  3C84 A;  5AFH A;  2M6B A;  5SYO A;  3WTH A;  2BR8 A;  4PIR A;  4F8H A;  2WZY A;  3SH1 A;  5L4E A;  3UQ7 A;  2YMD A;  4AFT A;  3WTJ A;  4EZ1 A;  2Y7Y A;  3UU6 A;  4NZB A;  2XYS A;  4QAA A;  3EI0 A;  2BYQ A;  3U8N A;  2XYT A;  2XQ3 A;  4HFB A;  5HEG A;  2WNJ A;  5J5H A;  4ZZC A;  4QAC A;  2BYR A;  5KZU A;  4IL9 A;  2PGZ A;  2XZ6 A;  4UY2 A;  5CO5 A;  4LMK A;  2BG9 C;  4COF A;  5J5G A;  3ZKR A;  3EHZ A;  3RIF A;  3UU5 A;  5BP0 A;  2BYP A;  4UM1 A;  5AFN A;  4HFC A;  4QH4 A;  3SQ9 A;  5TVC A;  4LMJ A;  2YKS A;  4Z91 A;  5AFM B;  4BQT A;  2YOE A;  3UQ4 A;  5JME A;  2XQ9 A;  3ZDG A;  4XK9 A;  4D01 A;  3PEO A;  3RI5 A;  2BYN A;  3U8J A;  3JAF A;  4QH5 A;  3P50 A;  5IUX A;  2XQA A;  5AFM A;  4IRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...