4HFBA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant (apo)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfbA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfbA01
4HFIA 4IREA 5FJVA 2WZYA 3RQWA 5CO5A 4ILBA 3SH1A 3TLWA 4UY2A 4IL4A 4IL9A 2KSRA 5HEHA 5IUXA 4ZR6A 1OEDC 3IGQA 4TNVA 2XQ6A 4UM3S 5L4HA 2BG9A 5AFKA 2MAWA 3RIFA 2BYPA 3JADA 3LSVA 4ZK4A 3TLSA 3TLVA 2LKGA 5HEGA 3UU3A 4Z90A 3UQ7A 1UW6A 4AFTA 4F8HA 2WNJA 1I9BA 3JAFA 2VL0A 2W8FA 4ALXA 5CFBA 2BJ0A 3UU4A 4AFHA 3EAMA 5HEJA 4QH4A 3U8MA 2BG9C 2XNVA 4HFCA 4TNWA 3JAEA 4HFBA 4ZJTA 4QH1A 2BYSA 3EHZA 4HFEA 2PGZA 5HCJA 4DBMA 2XQ5A 4ZZBA 2WNLA 3EI0A 3P4WA 4TWHA 5AFNA 4ZZCA 3RHWA 3GUAA 2YMDA 2PH9A 4ILCA 2XZ5A 2ZJVA 4ZRUA 3TLTA 4B5DA 4UXUA 2XQ3A 4D01A 5BW2A 2X00A 5AFJA 5J5FA 5SYOA 1OEDB 3TLUA 5L47A 3U8NA 5J5HA 2YMEA 4A97A 4FRRA 4XK9A 2Y57A 3WTOA 2W8GA 3ZDHA 3WTLA 5AFMB 5AFLA 4X5TA 3U8LA 5J5IA 2LKHA 2XQ9A 2BYQA 3SQ6A 4ZK1A 5KE4A 3C79A 2XQ8A 3RIAA 5HEOA 4NZBA 5BP0A 2LM2A 2Y7YA 4QACA 3PMZA 3T4MA 2XYSA 4COFA 4PIRA 4A98A 4UM3A 3ZKRA 3RI5A 3UU8A 2XQ7A 4UM1A 4NPPA 5TVCA 3P50A 2Y54A 3ZDGA 4HFHA 2C9TA 3UUBA 4LMKA 5AINA 1UX2A 4AFGA 4HFDA 5J0ZA 2BG9E 3RQUA 4ILAA 2YKSA 5HCMA 4QAAA 5AFMA 3WTJA 4BQTA 2M6BA 4TWFA 2QC1B 5L4EA 5JMEA 2BG9B 3UU5A 3UU6A 4LMJA 2Y58A 2XQAA 2YOEA 5J5GA 2BR8A 1OEDA 2XQ4A 3WTMA 4QABA 4UM3P 2Y56A 4EZ1A 1OEDE 5HEUA 3SQ9A 5BRXA 4WV9A 3PEOA 5AFHA 1UV6A 5KZUA 2BYNA 3UQ4A 4BFQA 4TWDA 2XNTA 2LLYA 3SIOA 2WNCA 3WTKA 2BYRA 2ZJUA 2BR7A 3C84A 3U8JA 3WTNA 2YN6A 2M6IA 2X00D 4XHEA 3U8KA 3WIPA 4LMLA 3WTHA 2XYTA 2XZ6A 3WTIA 4QH5A 4HQPA 5LXBA 4ZJSA 2UZ6A 4Z91A 2XNUA 2WN9A 5LG3A
chains in the Genus database with same CATH superfamily
3W15B 1J5ET 3ETUA 1YD8G 4YHHT 4NXNT 2LEHA 4KUMB 1KEYA 2XQ6A 3E22E 5FXXA 2D0UA 2MAWA 3ZYMA 4AIUA 4CN1A 3EDVA 3P4SA 3VRAA 3UU3A 3RRCA 3GWHA 4B3ST 5CFBA 5LA6E 4JUYA 3EAMA 3IHRA 4PNIA 1YW0A 4KX6A 3KV6A 1WYCA 4ZS2A 2K9AA 5LYJE 4QWNB 2VVNA 5AQUB 2LHRA 2VB6A 5HXEA 3ABVA 5JQGE 3U8LA 2LKHA 3PU3A 3C79A 4UF0A 4QKNA 2VKJA 5DQWA 2E9XD 2WWUA 4PAGA 2V6XA 2CLYC 4PJJA 3I9WA 1Y01A 3SFEA 5AFMA 2V7MA 2M6BA 4HWFA 5L4EA 4JEUB 4X20E 2Y58A 2XQAA 3M65A 5L3EB 2W2UA 2Q9QC 3FHNA 5IWAT 4DR1T 3BK9A 1J5WA 3F57A 3RKGA 3UULA 4YSYA 3AEEA 1UGOA 2WNCA 2XQYA 2BYRA 3HL6A 2V6YA 2WS3A 4CXYA 3WIPA 4ILUA 2WDVA 5JRCB 3AE3A 3KDSE 4WZXA 1D1AA 2J4GA 2CBIA 3OKQA 3L3PA 2D5UA 2NW8A 5J2TE 2W8FA 2QVAA 1ZEEA 5HCJA 2L9QA 5KX5E 1XDOA 2C0SA 4ZZCA 2J62A 3G06A 4ZEYA 2ZJVA 4D01A 4CN4A 4YTPA 5DABA 5AQSB 1NWMX 2WCAA 3UFEA 5L3BB 2JMKA 2H88A 1KK7A 4LF8T 4BAYB 3VR9A 3PUZF 5JREA 2W0GA 3AAIA 3Q2MA 4MFRA 2Y6XA 4JI8T 4HFDA 2WMNA 2YKSA 5JVDE 3B5MA 2J1DG 3WTJA 4H63V 4EZ4A 3N9MA 1FIOA 2I59A 1X9BA 1MMNA 3L8RA 2BKNA 3C64A 2WP9A 3FBZA 2CWYA 4KBMB 4J2CA 2QRXA 2E5VA 5ABEA 1HG2A 2H7VC 3P4RA 3OTOT 2YU1A 2XNUA 4WBOA 3RC3A 4AQGA 3HKDE 4ILBA 1UCUA 2KSRA 4GIWA 2UUCT 5HEHA 2LSIA 4GOUA 4IGUA 2MOZA 2XAJB 1U5PA 2V8SV 2WZHA 1HNXT 4OHFA 4AFTA 1G8XA 4GYSA 4F8HA 1XMOT 5LBQB 4O2BE 4KHZF 3MACA 3VKGA 5AQLB 4TNWA 3JAEA 3A8YC 2BYSA 5LGUB 2Y48B 1HF8A 5AFNA 2LE8A 1CHUA 4DV2T 1Y64B 1IBMT 4ILCA 4QHOA 2UUAT 4AKLA 3PJAJ 3ZMSB 1D0YA 2FJEA 5ABGA 5J5IA 2IHR1 4DR2T 2XY8B 3C50A 3LFMA 2LM2A 2Y7YA 2OLTA 1FEWA 4UM3A 3P4QA 4DVDA 4UM1A 2Y54A 3GA8A 4YJ2E 3RQUA 3QB5A 2ES0A 2I0MA 3ONXA 5CB4E 4L0RA 3RIUC 2YOEA 3PJAA 4QX7B 2BR8A 3QB5K 5AQPB 4H9PC 3A7MA 2KMFA 5HEUA 5BRXA 4AQFA 4U2YA 3FZLB 2QGSA 3IA3A 2XNTA 4DV1T 2XAHB 3ZT7A 4TV8E 3ZMVB 3AVRA 1D0XA 4AKIA 5LGTB 2XZ6A 1WRDA 2YK0A 4QH5A 2C5IT 3AA7B 4EV6A 4I43B 1US7B 4Q25A 4OYJA 3SH1A 4ZI7E 4YSXA 1UK5A 4AQFC 2IUBA 3PUGA 2E9XB 1MMGA 2H89A 5FNVE 3HI2A 2K24A 4DR3T 2WNJA 4KMCA 4QXBB 5HWXA 4X1KE 1YKHB 5DQVA 3VU7H 3AECA 2X0HA 2IMLA 1ZKEA 5AQVB 2VK9A 2HN2A 4BA9A 4YJ3E 4ZI3D 5C2TA 5LP6E 4PJNA 1X79A 3ZMZB 2KXPB 3SQ6A 3RYFE 1SHZC 3H3MA 2C5KT 1JNZA 4A98A 4MBQA 3JCFA 4ILAA 4PK6A 5CA0E 4QAAA 3WAJA 1OXZA 1E1HB 4I50E 5JDNA 5FXVA 3I0OA 5AQRB 4TUYE 2LM9A 2A3DA 3SWHA 3N9NA 3NRXA 2A72A 3CX7B 2ODUA 4BJMA 4IE0A 1WCRA 3OPCA 4IE5A 5LHGB 3U8KA 2XM2A 3ZPOA 3AE1A 4IREA 3UUMA 3CIRA 2XSAA 3RQWA 1KNZA 4TN7B 4B6XA 2NW7A 3KINB 3UTKA 3KVBA 1W09A 2N9DA 3D0TA 3LSVA 4ZK4A 2L8KA 3JAFA 1YXRA 4ZXLA 4DR5T 5JR9A 4JI6T 4HFCA 3MA9A 4GKJT 4DV6T 2WNLA 2VKDA 2PTFA 4FI5A 3RKOA 3O1IA 5JDQA 1OEDB 1T98A 2RP4A 5TAOA 1WR6A 2DHRA 3WTLA 2LSJA 1EZ3A 1QSDA 4X1IE 4NXMT 5F3JA 1XZYA 3SFDA 4H9QC 1GQEA 5JDMA 2CHOA 3F31A 3RIAA 3UUXB 4OFZA 3LBXB 2L3LA 2VQFT 2XQ7A 2JPFA 4CI1B 3ZDGA 2MBGA 4LMKA 5KMGP 1MIYA 3N9QA 4DR7T 1I6ZA 2XTLA 2BG9B 3LG7A 4HGAA 3KV5A 3ZYKA 2W63A 2LRLA 3AEAA 2N2NA 2BKPA 1E2AA 1HX8A 4EZ1A 4G2AA 5IHYA 3AAAB 2XPKA 2X67A 2YN6A 4QXCB 3FZMB 2IC9A 2RA1A 5FVLA 4UR9A 5FJVA 3GMIA 2D0TA 3C4XA 5FL1A 5JH7E 2W61A 3AEBA 3PV0F 4JI5T 3RC8A 4C91A 2RPAA 4HEAA 2E8IA 3DP7A 1W0AA 3N5LA 1UW6A 2H3RA 2PBIA 2V7KA 3OBVE 1XNRT 4FJOA 4CQIA 1NEKA 5LMNT 4QH4A 3CQCB 4IE6A 3K1SA 2XNVA 4DR4T 3RYIE 3K3NA 3RGLA 3AB3B 2ZMAA 5AQOB 2FUPA 5F5WA 1UUSA 2XZ5A 4DV5T 2B1EA 2DLRA 2YMEA 3O4XE 5H6RB 1BR2A 2D9DA 2IDOB 1FMWA 5JDFA 5CA1E 4DBRA 4ASKA 2YEVC 2WAUA 2WDRA 5JTGA 1MIWA 5ABFB 3AE4A 3PDYA 4PIRA 4ZS3A 3ANWB 3P50A 2UXDT 4DV0T 4AFGA 5AQTB 3NZPA 1HX1B 2NP9A 4LFAT 5BR8T 2V6YB 5E0OA 4TWFA 4EEBA 2PG8A 3RPUA 3UFGA 5AQJB 3DTOA 1UV6A 2VURA 4TWDA 4UELA 3U8JA 4YY3T 2X9YA 2CEAA 4DIDB 4JI4T 4JI7T 2CHNA 3ANWA 4HFIA 3PU8A 4NIQA 3CX8B 4IL9A 4PK4A 4PFOA 5LJNA 4LFCT 5EK2A 3VRBA 3JADA 2LHNA 3AEFA 3AAEB 4AI6A 1HNWT 2B76A 3UU4A 2WBLA 4ISTA 4OX9T 4HKAA 2YU2A 4IIJE 2W00A 5H6QB 3Q5DA 3R6NA 2PH9A 4B5DA 3LJCA 5LB7B 2X00A 5AFJA 4U31A 3U8NA 1D1CA 3QNUA 4P1NA 3HKCE 4E7SA 3ETVA 3OJAA 3E08A 3PE0A 5HAXA 4DUZT 4LF5T 1ZOYA 3AA6B 1YQ4A 5FY0A 3J7Yq 3KV9A 2ODVA 5HXSA 3CQGB 1N36T 5BMVE 4DMVA 4BQTA 4HFVA 2X9WA 3UU6A 2LSYA 4UXNB 2XQ4A 3ONJA 4UM3P 4X62T 3SQ9A 3C98B 1IJ6A 3AA0B 5LCYA 1HR0T 2VASA 5IYZE 2VL8A 3C84A 5ABFA 5HXCA 4XHEA 2ACXA 3AA1B 5JDLA 2NWBA 3IF8B 5AQHB 5ETWA 3PUWF 1D0ZA 4UY2A 4IL4A 2CXDA 2DNXA 3IGQA 5AQQB 2CBJA 1XNQT 4YHJA 3RIFA 4IDQA 3TKLB 2HPLA 5AQNB 2LT3A 3H37A 3HKEE 1L0VA 5HEJA 4HFBA 2XASB 1MNDA 3O9XA 3B57A 3NZQA 3RHWA 2A9UA 4IE4A 4N78D 4XZCA 2WMOA 2VWAA 4I55E 4IHJE 5HEOA 2WU2A 4NZBA 2QA7A 3X1DA 4ISSA 4JI3T 2I6HA 3RYCE 3LK3B 5LHIB 4JYAT 3QC9A 4EIWA 2WM9A 4HTEA 3AE9A 4E7ZA 4HWIB 4PK5A 3SS1A 2BS4A 3T1YT 2BVLA 5JMEA 3UU5A 4DV4T 4V1Av 1XDPA 2AE9A 4U74A 1ZP0A 1YQ3A 3ESLA 3AE8A 1BR1A 3MXZA 3Q5WA 1AJ3A 3ZYLA 3K3OA 2NR4A 4LFBT 3ZEFB 5GONE 1ZV4X 5EZYE 3EDUA 5LG4A 4YTMA 4I0UA 3M3ZB 2X9HA 3N9PA 4IE7A 4OYKA 2XZEA 5L3CB 4AISA 1KF6A 4TNVA 2KT9A 4B3MT 2BYPA 4X64T 2V7LA 3WAKA 3RF1A 4Z90A 4LF7T 3CK6A 4DR6T 4X65T 1DU2A 4QX8B 1QUUA 1WFDA 5LNKA 2OA5A 4EYYR 3TLUA 2X0YA 4TZ4C 5FXWA 3FXDB 1KNPA 1B7TA 2W8GA 3JC6C 3ZSSA 4X5TA 3PUXF 5KE4A 5ABHA 3PUSA 1HTJF 3JC6D 3CWZB 2V7JA 2FJDA 1UX2A 3OVUA 1J1JA 4UVCB 5LHHB 2LOSA 3U3IA 2Q9QD 2EHOD 3SRZA 4YFSA 3HR0A 1MMDA 2UUBT 4DV7T 4KI0F 4WV9A 4CI3B 4XBFB 1HNZT 2N1GA 5HYAA 3S4UA 2D2SA 4HQPA 2BS2A 2VVSA 4JV5T 4DNDA 3VKHA 2DL1A 1LRZA 3O1JA 3KVAA 2P9BA 3QUJA 2LKGA 3UQ7A 1I9BA 3N2KE 2V26A 3PUYF 5CGMA 1W9RA 3U8MA 3OYZA 2R6GF 2X51A 1S35A 2EHOA 3P4WA 4JLEA 5AQGB 1FJGT 4YTNA 3P8CD 2WSSV 3Q5XA 4FRRA 3WTOA 2BBJA 1LVKA 5L2LA 3ZDHA 4DBQA 4CXWA 2XQ9A 3C51A 4EOZB 2E9XA 3U78A 4QACA 2KZ7B 1UX4A 4U7IA 4P0BA 3Q9DA 3FZKB 3RI5A 2HPJA 4HFHA 4PW8A 4I4TE 3RLFF 2XHEB 2ZM6T 2CMRA 4WW0A 2CLYB 1V9DA 2X0LB 4B3RT 2W4XA 2KLQA 3ZJ2A 4O8SA 2UU9T 5AFUL 5FYMA 1UURA 1O3XA 3PEOA 5LBMA 2BBHA 2LRKA 4P0AA 1MNEA 2CXLA 5LOVE 2M6IA 3ONLC 5LXBA 2XYTA 2H7OA 3ZN1B 4ZJSA 4Z91A 2BDEA 3N2GE 4JI0T 5JDHA 1HFAA 3KV4A 4HN9A 5CO5A 4GYRA 5IUXA 3PTRB 2V1DB 4MALA 4CXXA 3K3QC 3TLVA 3CQXC 3NVOA 3GN5A 2VL0A 3ZT5A 2ACZA 1CUNA 3RIUA 1HCIA 2BG9C 5FP3A 2XAQB 4HFEA 4DBMA 3RYHE 5L3GB 4TWHA 2BVMA 2CXFA 2MPKA 4ZRUA 3TLTA 5BW2A 5J5FA 5L47A 2BZBA 2JQQA 4XK9A 3F2EA 5J2UE 5AFMB 4IDPA 5AFLA 1D1BA 4KHPT 1N33T 4HWDA 1IAPA 2NTXA 4HWCA 3RRWA 3T4MA 4COFA 3O1HA 4DV3T 2HHHT 2UXNB 1JNRA 3Q5EA 1IBLT 2X68A 5JR9B 5J0ZA 1IBKT 4JI1T 4KP3C 5HCMA 2X66A 1NENA 2EHOB 5ADXL 2KNDA 3CVRA 4IDNA 2C5JA 1OEDA 4QABA 4O4LE 2XSBA 2V5DA 3AEDA 3BQLA 3SIOA 3UT5E 2FBWA 2KWIB 3FB2A 4M1PA 2WN9A 4DO0A 1WLXA 5C3JA 5FXZA 5CJ5A 5L3FB 3TLWA 3FBLA 1T72A 5A1LA 3FXEB 4IDOA 2YINA 3V5SA 4GK5E 5HEGA 2UXCT 4WNKA 4EZHA 1VRBA 2DCFA 3SOLA 4AKHA 1R8IA 2JIWA 4ZJTA 2W67A 5AQIB 3EI0A 1FMVA 4AXPA 3WI3A 1BR0A 4AKGA 3ZJ1A 3EUHA 4XAXB 2LJLA 3ZC1A 4YT0A 4ZK1A 3MKDA 3ZKRA 2W62A 4ADZA 3UUBA 2Y8DA 1HG5A 2JJ9A 2WZIA 3I9YA 3N9OA 3RH3A 4AKRB 2FJBA 4UEMA 4O4IE 3T1HT 2MYSA 2GK9A 2WY2A 5LJMA 1Z8UA 1I94T 4C90A 2BYNA 3DJBA 3P7IA 4IT4A 3WTKA 1E7PA 2XAFB 2LSGA 2CRBA 3WTIA 1VOMA 4YLHA 4EB6E 4U7YA 1LKXA 4ZI2D 1G73A 1OEDC 4DUYT 2V5CA 3HA4A 1HS7A 2XAGB 3V5UA 4UM3S 4O2AE 4H63H 4H9OC 4HWHA 2JQKA 3TLSA 4EXTA 3GN5B 4UV9B 3AEGA 1SUMB 2ZM2A 5F8PA 3NBXX 4WYVA 3AVSA 5EK3A 4UV8B 4LF4T 1SE7A 5LMUT 3T8OA 3GUAA 3R84B 3NKZA 2WWVA 4EGWA 1VCTA 5J5HA 2CE7A 2E2AA 5FKYA 5HXRA 4YSZA 5L3DB 4EYUA 4U3CA 4MLKA 5KXJA 3PMZA 3FZFB 2VKHA 4X1YE 5TVCA 2NTYA 3LK42 4PFPA 5AINA 2KWHA 5M4YA 2UXXB 3AE5A 3UUNA 4UVAB 2CWOA 3EABA 4LMJA 4K0UA 3LDQB 5JR9C 2Q9QA 3KFWX 3PUQA 3ZN0B 3VR8A 4EEDA 5KZUA 2YDQA 2XJ7A 2LLYA 5AQFB 2JMHA 4CI2B 3WTNA 2YDRA 3A5XA 3WTHA 2JQHA 2UZ6A 2M67A 3AXJB 2IW5B 3IBPA 1Z0PA 4GK0E 4ZR6A 5L4HA 4H9SE 1MIVA 4ZOLE 3LK2B 2LOPA 2K5BB 2CCQA 2Q9QB 3L09A 2VQET 2EHOC 2K48A 1YKEB 4L5GA 2IIUA 4ANJA 4JI2T 2OV9A 4ZI3C 3H3AA 1UX5A 4ZZBA 1N34T 1OWAA 4X66T 2G0UA 5FMNA 3KBTA 4UXUA 4B3TT 2FJAA 2WU5A 2HH7A 2BKOA 2XUEA 2Y57A 2IC6A 2SPCA 1KFYA 3N9LA 4G63A 2HN1A 3PUAA 5HXHA 3AE6A 5BP0A 2PFVA 2DI4A 2XYSA 1KNRA 4U33A 3E0ZA 2BS3A 1QLBA 1MMAA 4EAHA 4ERRA 1WR0A 3ZC0A 3KBUA 2QYWA 5HWYA 4L9IA 4NUUA 5C8YE 3QOFA 2NW9A 1OEDE 4ZHQE 3ZCJA 4ZI2C 3NRYA 4U2ZA 1M62A 3MJXA 4LMLA 2WZYA 3MZKB 2LSKA 4P09A 2Z6EA 5AFKA 2BG9A 3PURA 3IEEA 3VHLA 3L39A 3FZHB 3LBXA 1T7SA 4UVBB 4ALXA 4AFHA 2E5LT 4U72A 2IAKA 2CA5A 2ZLYA 3NWIA 3QK6A 4JEHB 5LGNB 3HKBE 2WQYA 4UIGA 3ZCIA 3AXJA 4O4HE 1W0BA 2ZM8A 3K8PC 1XWMA 3MK7C 1M7KA 3RX6A 4PJLA 2BYQA 2V7IA 3ZSTA 2NOXA 2MTQA 2UXBT 2ZM0A 3UU8A 4GKKT 3BQKA 2WDQA 1T8BA 2YDSA 5AQKB 4JBWF 5AQMB 4CN6A 3CX6B 4UF0B 2J47A 2DWKA 5J5GA 4LF9T 3ZT6A 4HE8A 2E9XC 1N32T 1VCSA 3UQ4A 4BFQA 3OYXA 1IZNB 4TX5A 2BR7A 5FL0A 4H9RC 4MHCA 1NAFA 3AE2A 1ZHCA 3CMLA 4BJNA 1SA0E 3CPZA 5LG3A 3C4WA 3I0QA 3ZMTB 5FVKA 5EK4A 1S94A 3ZMUB 3C4ZA 2JQ9A 2A2FX 4IDZA 4A56A 3P4PA 5JDGA 4CZZB 5FY1A 2BJ0A 2AXDS 2F4VT 4NUVA 5JRCA 5J1GA 4QH1A 4F6RC 2DWGA 3EHZA 2PGZA 4A5XA 1XMQT 2XQ5A 3EVYA 2K3WA 2XM1A 5LXTE 2YMDA 2XQ3A 4PJMA 3CKDA 4QXHB 4A97A 4AQYT 3PUVF 4DMWA 1U4QA 2XQ8A 2CPTA 4TV9E 1BR4A 3N2OA 4OK0A 4H9NC 2CM0A 4NPPA 2C9TA 2VKOA 2BG9E 2W66A 3I1AA 3ZLIA 4YXDA 2QC1B 5FY7A 1H7CA 3BQIA 1LVFA 3WTMA 2X9XA 4O4JE 2Y56A 3AE7A 5AFHA 2PJQA 2JRKA 5DJQC 2KINB 2WB5A 2ZJUA 1WYBA 4Z8XA 4LF6T 3J9X1 4WBNE 2X00D 3B13A 1IJ5A 5KDMC 4K0KT 5SYOA
chains in the Genus database with same CATH topology
4HFIA 4IREA 5FJVA 2WZYA 3RQWA 5CO5A 4ILBA 3SH1A 3TLWA 4UY2A 4IL4A 4IL9A 2KSRA 5HEHA 5IUXA 4ZR6A 1OEDC 3IGQA 4TNVA 2XQ6A 4UM3S 5L4HA 2BG9A 5AFKA 2MAWA 3RIFA 2BYPA 3JADA 3LSVA 4ZK4A 3TLSA 3TLVA 2LKGA 5HEGA 3UU3A 4Z90A 3UQ7A 1UW6A 4AFTA 4F8HA 2WNJA 1I9BA 3JAFA 2VL0A 2W8FA 4ALXA 5CFBA 2BJ0A 3UU4A 4AFHA 3EAMA 5HEJA 4QH4A 3U8MA 2BG9C 2XNVA 4HFCA 4TNWA 3JAEA 4HFBA 4ZJTA 4QH1A 2BYSA 3EHZA 4HFEA 2PGZA 5HCJA 4DBMA 2XQ5A 4ZZBA 2WNLA 3EI0A 3P4WA 4TWHA 5AFNA 4ZZCA 3RHWA 3GUAA 2YMDA 2PH9A 4ILCA 2XZ5A 2ZJVA 4ZRUA 3TLTA 4B5DA 4UXUA 2XQ3A 4D01A 5BW2A 2X00A 5AFJA 5J5FA 5SYOA 1OEDB 3TLUA 5L47A 3U8NA 5J5HA 2YMEA 4A97A 4FRRA 4XK9A 2Y57A 3WTOA 2W8GA 3ZDHA 3WTLA 5AFMB 5AFLA 4X5TA 3U8LA 5J5IA 2LKHA 2XQ9A 2BYQA 3SQ6A 4ZK1A 5KE4A 3C79A 2XQ8A 3RIAA 5HEOA 4NZBA 5BP0A 2LM2A 2Y7YA 4QACA 3PMZA 3T4MA 2XYSA 4COFA 4PIRA 4A98A 4UM3A 3ZKRA 3RI5A 3UU8A 2XQ7A 4UM1A 4NPPA 5TVCA 3P50A 2Y54A 3ZDGA 4HFHA 2C9TA 3UUBA 4LMKA 5AINA 1UX2A 4AFGA 4HFDA 5J0ZA 2BG9E 3RQUA 4ILAA 2YKSA 5HCMA 4QAAA 5AFMA 3WTJA 4BQTA 2M6BA 4TWFA 2QC1B 5L4EA 5JMEA 2BG9B 3UU5A 3UU6A 4LMJA 2Y58A 2XQAA 2YOEA 5J5GA 2BR8A 1OEDA 2XQ4A 3WTMA 4QABA 4UM3P 2Y56A 4EZ1A 1OEDE 5HEUA 3SQ9A 5BRXA 4WV9A 3PEOA 5AFHA 1UV6A 5KZUA 2BYNA 3UQ4A 4BFQA 4TWDA 2XNTA 2LLYA 3SIOA 2WNCA 3WTKA 2BYRA 2ZJUA 2BR7A 3C84A 3U8JA 3WTNA 2YN6A 2M6IA 2X00D 4XHEA 3U8KA 3WIPA 4LMLA 3WTHA 2XYTA 2XZ6A 3WTIA 4QH5A 4HQPA 5LXBA 4ZJSA 2UZ6A 4Z91A 2XNUA 2WN9A 5LG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFI A;  4IRE A;  5FJV A;  2WZY A;  3RQW A;  5CO5 A;  4ILB A;  3SH1 A;  3TLW A;  4UY2 A;  4IL4 A;  4IL9 A;  2KSR A;  5HEH A;  5IUX A;  4ZR6 A;  1OED C;  3IGQ A;  4TNV A;  2XQ6 A;  4UM3 S;  5L4H A;  2BG9 A;  5AFK A;  2MAW A;  3RIF A;  2BYP A;  3JAD A;  3LSV A;  4ZK4 A;  3TLS A;  3TLV A;  2LKG A;  5HEG A;  3UU3 A;  4Z90 A;  3UQ7 A;  1UW6 A;  4AFT A;  4F8H A;  2WNJ A;  1I9B A;  3JAF A;  2VL0 A;  2W8F A;  4ALX A;  5CFB A;  2BJ0 A;  3UU4 A;  4AFH A;  3EAM A;  5HEJ A;  4QH4 A;  3U8M A;  2BG9 C;  2XNV A;  4HFC A;  4TNW A;  3JAE A;  4HFB A;  4ZJT A;  4QH1 A;  2BYS A;  3EHZ A;  4HFE A;  2PGZ A;  5HCJ A;  4DBM A;  2XQ5 A;  4ZZB A;  2WNL A;  3EI0 A;  3P4W A;  4TWH A;  5AFN A;  4ZZC A;  3RHW A;  3GUA A;  2YMD A;  2PH9 A;  4ILC A;  2XZ5 A;  2ZJV A;  4ZRU A;  3TLT A;  4B5D A;  4UXU A;  2XQ3 A;  4D01 A;  5BW2 A;  2X00 A;  5AFJ A;  5J5F A;  5SYO A;  1OED B;  3TLU A;  5L47 A;  3U8N A;  5J5H A;  2YME A;  4A97 A;  4FRR A;  4XK9 A;  2Y57 A;  3WTO A;  2W8G A;  3ZDH A;  3WTL A;  5AFM B;  5AFL A;  4X5T A;  3U8L A;  5J5I A;  2LKH A;  2XQ9 A;  2BYQ A;  3SQ6 A;  4ZK1 A;  5KE4 A;  3C79 A;  2XQ8 A;  3RIA A;  5HEO A;  4NZB A;  5BP0 A;  2LM2 A;  2Y7Y A;  4QAC A;  3PMZ A;  3T4M A;  2XYS A;  4COF A;  4PIR A;  4A98 A;  4UM3 A;  3ZKR A;  3RI5 A;  3UU8 A;  2XQ7 A;  4UM1 A;  4NPP A;  5TVC A;  3P50 A;  2Y54 A;  3ZDG A;  4HFH A;  2C9T A;  3UUB A;  4LMK A;  5AIN A;  1UX2 A;  4AFG A;  4HFD A;  5J0Z A;  2BG9 E;  3RQU A;  4ILA A;  2YKS A;  5HCM A;  4QAA A;  5AFM A;  3WTJ A;  4BQT A;  2M6B A;  4TWF A;  2QC1 B;  5L4E A;  5JME A;  2BG9 B;  3UU5 A;  3UU6 A;  4LMJ A;  2Y58 A;  2XQA A;  2YOE A;  5J5G A;  2BR8 A;  1OED A;  2XQ4 A;  3WTM A;  4QAB A;  4UM3 P;  2Y56 A;  4EZ1 A;  1OED E;  5HEU A;  3SQ9 A;  5BRX A;  4WV9 A;  3PEO A;  5AFH A;  1UV6 A;  5KZU A;  2BYN A;  3UQ4 A;  4BFQ A;  4TWD A;  2XNT A;  2LLY A;  3SIO A;  2WNC A;  3WTK A;  2BYR A;  2ZJU A;  2BR7 A;  3C84 A;  3U8J A;  3WTN A;  2YN6 A;  2M6I A;  2X00 D;  4XHE A;  3U8K A;  3WIP A;  4LML A;  3WTH A;  2XYT A;  2XZ6 A;  3WTI A;  4QH5 A;  4HQP A;  5LXB A;  4ZJS A;  2UZ6 A;  4Z91 A;  2XNU A;  2WN9 A;  5LG3 A; 
#chains in the Genus database with same CATH topology
 3W15 B;  1J5E T;  3ETU A;  1YD8 G;  4YHH T;  4NXN T;  2LEH A;  4KUM B;  1KEY A;  2XQ6 A;  3E22 E;  5FXX A;  2D0U A;  2MAW A;  3ZYM A;  4AIU A;  4CN1 A;  3EDV A;  3P4S A;  3VRA A;  3UU3 A;  3RRC A;  3GWH A;  4B3S T;  5CFB A;  5LA6 E;  4JUY A;  3EAM A;  3IHR A;  4PNI A;  1YW0 A;  4KX6 A;  3KV6 A;  1WYC A;  4ZS2 A;  2K9A A;  5LYJ E;  4QWN B;  2VVN A;  5AQU B;  2LHR A;  2VB6 A;  5HXE A;  3ABV A;  5JQG E;  3U8L A;  2LKH A;  3PU3 A;  3C79 A;  4UF0 A;  4QKN A;  2VKJ A;  5DQW A;  2E9X D;  2WWU A;  4PAG A;  2V6X A;  2CLY C;  4PJJ A;  3I9W A;  1Y01 A;  3SFE A;  5AFM A;  2V7M A;  2M6B A;  4HWF A;  5L4E A;  4JEU B;  4X20 E;  2Y58 A;  2XQA A;  3M65 A;  5L3E B;  2W2U A;  2Q9Q C;  3FHN A;  5IWA T;  4DR1 T;  3BK9 A;  1J5W A;  3F57 A;  3RKG A;  3UUL A;  4YSY A;  3AEE A;  1UGO A;  2WNC A;  2XQY A;  2BYR A;  3HL6 A;  2V6Y A;  2WS3 A;  4CXY A;  3WIP A;  4ILU A;  2WDV A;  5JRC B;  3AE3 A;  3KDS E;  4WZX A;  1D1A A;  2J4G A;  2CBI A;  3OKQ A;  3L3P A;  2D5U A;  2NW8 A;  5J2T E;  2W8F A;  2QVA A;  1ZEE A;  5HCJ A;  2L9Q A;  5KX5 E;  1XDO A;  2C0S A;  4ZZC A;  2J62 A;  3G06 A;  4ZEY A;  2ZJV A;  4D01 A;  4CN4 A;  4YTP A;  5DAB A;  5AQS B;  1NWM X;  2WCA A;  3UFE A;  5L3B B;  2JMK A;  2H88 A;  1KK7 A;  4LF8 T;  4BAY B;  3VR9 A;  3PUZ F;  5JRE A;  2W0G A;  3AAI A;  3Q2M A;  4MFR A;  2Y6X A;  4JI8 T;  4HFD A;  2WMN A;  2YKS A;  5JVD E;  3B5M A;  2J1D G;  3WTJ A;  4H63 V;  4EZ4 A;  3N9M A;  1FIO A;  2I59 A;  1X9B A;  1MMN A;  3L8R A;  2BKN A;  3C64 A;  2WP9 A;  3FBZ A;  2CWY A;  4KBM B;  4J2C A;  2QRX A;  2E5V A;  5ABE A;  1HG2 A;  2H7V C;  3P4R A;  3OTO T;  2YU1 A;  2XNU A;  4WBO A;  3RC3 A;  4AQG A;  3HKD E;  4ILB A;  1UCU A;  2KSR A;  4GIW A;  2UUC T;  5HEH A;  2LSI A;  4GOU A;  4IGU A;  2MOZ A;  2XAJ B;  1U5P A;  2V8S V;  2WZH A;  1HNX T;  4OHF A;  4AFT A;  1G8X A;  4GYS A;  4F8H A;  1XMO T;  5LBQ B;  4O2B E;  4KHZ F;  3MAC A;  3VKG A;  5AQL B;  4TNW A;  3JAE A;  3A8Y C;  2BYS A;  5LGU B;  2Y48 B;  1HF8 A;  5AFN A;  2LE8 A;  1CHU A;  4DV2 T;  1Y64 B;  1IBM T;  4ILC A;  4QHO A;  2UUA T;  4AKL A;  3PJA J;  3ZMS B;  1D0Y A;  2FJE A;  5ABG A;  5J5I A;  2IHR 1;  4DR2 T;  2XY8 B;  3C50 A;  3LFM A;  2LM2 A;  2Y7Y A;  2OLT A;  1FEW A;  4UM3 A;  3P4Q A;  4DVD A;  4UM1 A;  2Y54 A;  3GA8 A;  4YJ2 E;  3RQU A;  3QB5 A;  2ES0 A;  2I0M A;  3ONX A;  5CB4 E;  4L0R A;  3RIU C;  2YOE A;  3PJA A;  4QX7 B;  2BR8 A;  3QB5 K;  5AQP B;  4H9P C;  3A7M A;  2KMF A;  5HEU A;  5BRX A;  4AQF A;  4U2Y A;  3FZL B;  2QGS A;  3IA3 A;  2XNT A;  4DV1 T;  2XAH B;  3ZT7 A;  4TV8 E;  3ZMV B;  3AVR A;  1D0X A;  4AKI A;  5LGT B;  2XZ6 A;  1WRD A;  2YK0 A;  4QH5 A;  2C5I T;  3AA7 B;  4EV6 A;  4I43 B;  1US7 B;  4Q25 A;  4OYJ A;  3SH1 A;  4ZI7 E;  4YSX A;  1UK5 A;  4AQF C;  2IUB A;  3PUG A;  2E9X B;  1MMG A;  2H89 A;  5FNV E;  3HI2 A;  2K24 A;  4DR3 T;  2WNJ A;  4KMC A;  4QXB B;  5HWX A;  4X1K E;  1YKH B;  5DQV A;  3VU7 H;  3AEC A;  2X0H A;  2IML A;  1ZKE A;  5AQV B;  2VK9 A;  2HN2 A;  4BA9 A;  4YJ3 E;  4ZI3 D;  5C2T A;  5LP6 E;  4PJN A;  1X79 A;  3ZMZ B;  2KXP B;  3SQ6 A;  3RYF E;  1SHZ C;  3H3M A;  2C5K T;  1JNZ A;  4A98 A;  4MBQ A;  3JCF A;  4ILA A;  4PK6 A;  5CA0 E;  4QAA A;  3WAJ A;  1OXZ A;  1E1H B;  4I50 E;  5JDN A;  5FXV A;  3I0O A;  5AQR B;  4TUY E;  2LM9 A;  2A3D A;  3SWH A;  3N9N A;  3NRX A;  2A72 A;  3CX7 B;  2ODU A;  4BJM A;  4IE0 A;  1WCR A;  3OPC A;  4IE5 A;  5LHG B;  3U8K A;  2XM2 A;  3ZPO A;  3AE1 A;  4IRE A;  3UUM A;  3CIR A;  2XSA A;  3RQW A;  1KNZ A;  4TN7 B;  4B6X A;  2NW7 A;  3KIN B;  3UTK A;  3KVB A;  1W09 A;  2N9D A;  3D0T A;  3LSV A;  4ZK4 A;  2L8K A;  3JAF A;  1YXR A;  4ZXL A;  4DR5 T;  5JR9 A;  4JI6 T;  4HFC A;  3MA9 A;  4GKJ T;  4DV6 T;  2WNL A;  2VKD A;  2PTF A;  4FI5 A;  3RKO A;  3O1I A;  5JDQ A;  1OED B;  1T98 A;  2RP4 A;  5TAO A;  1WR6 A;  2DHR A;  3WTL A;  2LSJ A;  1EZ3 A;  1QSD A;  4X1I E;  4NXM T;  5F3J A;  1XZY A;  3SFD A;  4H9Q C;  1GQE A;  5JDM A;  2CHO A;  3F31 A;  3RIA A;  3UUX B;  4OFZ A;  3LBX B;  2L3L A;  2VQF T;  2XQ7 A;  2JPF A;  4CI1 B;  3ZDG A;  2MBG A;  4LMK A;  5KMG P;  1MIY A;  3N9Q A;  4DR7 T;  1I6Z A;  2XTL A;  2BG9 B;  3LG7 A;  4HGA A;  3KV5 A;  3ZYK A;  2W63 A;  2LRL A;  3AEA A;  2N2N A;  2BKP A;  1E2A A;  1HX8 A;  4EZ1 A;  4G2A A;  5IHY A;  3AAA B;  2XPK A;  2X67 A;  2YN6 A;  4QXC B;  3FZM B;  2IC9 A;  2RA1 A;  5FVL A;  4UR9 A;  5FJV A;  3GMI A;  2D0T A;  3C4X A;  5FL1 A;  5JH7 E;  2W61 A;  3AEB A;  3PV0 F;  4JI5 T;  3RC8 A;  4C91 A;  2RPA A;  4HEA A;  2E8I A;  3DP7 A;  1W0A A;  3N5L A;  1UW6 A;  2H3R A;  2PBI A;  2V7K A;  3OBV E;  1XNR T;  4FJO A;  4CQI A;  1NEK A;  5LMN T;  4QH4 A;  3CQC B;  4IE6 A;  3K1S A;  2XNV A;  4DR4 T;  3RYI E;  3K3N A;  3RGL A;  3AB3 B;  2ZMA A;  5AQO B;  2FUP A;  5F5W A;  1UUS A;  2XZ5 A;  4DV5 T;  2B1E A;  2DLR A;  2YME A;  3O4X E;  5H6R B;  1BR2 A;  2D9D A;  2IDO B;  1FMW A;  5JDF A;  5CA1 E;  4DBR A;  4ASK A;  2YEV C;  2WAU A;  2WDR A;  5JTG A;  1MIW A;  5ABF B;  3AE4 A;  3PDY A;  4PIR A;  4ZS3 A;  3ANW B;  3P50 A;  2UXD T;  4DV0 T;  4AFG A;  5AQT B;  3NZP A;  1HX1 B;  2NP9 A;  4LFA T;  5BR8 T;  2V6Y B;  5E0O A;  4TWF A;  4EEB A;  2PG8 A;  3RPU A;  3UFG A;  5AQJ B;  3DTO A;  1UV6 A;  2VUR A;  4TWD A;  4UEL A;  3U8J A;  4YY3 T;  2X9Y A;  2CEA A;  4DID B;  4JI4 T;  4JI7 T;  2CHN A;  3ANW A;  4HFI A;  3PU8 A;  4NIQ A;  3CX8 B;  4IL9 A;  4PK4 A;  4PFO A;  5LJN A;  4LFC T;  5EK2 A;  3VRB A;  3JAD A;  2LHN A;  3AEF A;  3AAE B;  4AI6 A;  1HNW T;  2B76 A;  3UU4 A;  2WBL A;  4IST A;  4OX9 T;  4HKA A;  2YU2 A;  4IIJ E;  2W00 A;  5H6Q B;  3Q5D A;  3R6N A;  2PH9 A;  4B5D A;  3LJC A;  5LB7 B;  2X00 A;  5AFJ A;  4U31 A;  3U8N A;  1D1C A;  3QNU A;  4P1N A;  3HKC E;  4E7S A;  3ETV A;  3OJA A;  3E08 A;  3PE0 A;  5HAX A;  4DUZ T;  4LF5 T;  1ZOY A;  3AA6 B;  1YQ4 A;  5FY0 A;  3J7Y q;  3KV9 A;  2ODV A;  5HXS A;  3CQG B;  1N36 T;  5BMV E;  4DMV A;  4BQT A;  4HFV A;  2X9W A;  3UU6 A;  2LSY A;  4UXN B;  2XQ4 A;  3ONJ A;  4UM3 P;  4X62 T;  3SQ9 A;  3C98 B;  1IJ6 A;  3AA0 B;  5LCY A;  1HR0 T;  2VAS A;  5IYZ E;  2VL8 A;  3C84 A;  5ABF A;  5HXC A;  4XHE A;  2ACX A;  3AA1 B;  5JDL A;  2NWB A;  3IF8 B;  5AQH B;  5ETW A;  3PUW F;  1D0Z A;  4UY2 A;  4IL4 A;  2CXD A;  2DNX A;  3IGQ A;  5AQQ B;  2CBJ A;  1XNQ T;  4YHJ A;  3RIF A;  4IDQ A;  3TKL B;  2HPL A;  5AQN B;  2LT3 A;  3H37 A;  3HKE E;  1L0V A;  5HEJ A;  4HFB A;  2XAS B;  1MND A;  3O9X A;  3B57 A;  3NZQ A;  3RHW A;  2A9U A;  4IE4 A;  4N78 D;  4XZC A;  2WMO A;  2VWA A;  4I55 E;  4IHJ E;  5HEO A;  2WU2 A;  4NZB A;  2QA7 A;  3X1D A;  4ISS A;  4JI3 T;  2I6H A;  3RYC E;  3LK3 B;  5LHI B;  4JYA T;  3QC9 A;  4EIW A;  2WM9 A;  4HTE A;  3AE9 A;  4E7Z A;  4HWI B;  4PK5 A;  3SS1 A;  2BS4 A;  3T1Y T;  2BVL A;  5JME A;  3UU5 A;  4DV4 T;  4V1A v;  1XDP A;  2AE9 A;  4U74 A;  1ZP0 A;  1YQ3 A;  3ESL A;  3AE8 A;  1BR1 A;  3MXZ A;  3Q5W A;  1AJ3 A;  3ZYL A;  3K3O A;  2NR4 A;  4LFB T;  3ZEF B;  5GON E;  1ZV4 X;  5EZY E;  3EDU A;  5LG4 A;  4YTM A;  4I0U A;  3M3Z B;  2X9H A;  3N9P A;  4IE7 A;  4OYK A;  2XZE A;  5L3C B;  4AIS A;  1KF6 A;  4TNV A;  2KT9 A;  4B3M T;  2BYP A;  4X64 T;  2V7L A;  3WAK A;  3RF1 A;  4Z90 A;  4LF7 T;  3CK6 A;  4DR6 T;  4X65 T;  1DU2 A;  4QX8 B;  1QUU A;  1WFD A;  5LNK A;  2OA5 A;  4EYY R;  3TLU A;  2X0Y A;  4TZ4 C;  5FXW A;  3FXD B;  1KNP A;  1B7T A;  2W8G A;  3JC6 C;  3ZSS A;  4X5T A;  3PUX F;  5KE4 A;  5ABH A;  3PUS A;  1HTJ F;  3JC6 D;  3CWZ B;  2V7J A;  2FJD A;  1UX2 A;  3OVU A;  1J1J A;  4UVC B;  5LHH B;  2LOS A;  3U3I A;  2Q9Q D;  2EHO D;  3SRZ A;  4YFS A;  3HR0 A;  1MMD A;  2UUB T;  4DV7 T;  4KI0 F;  4WV9 A;  4CI3 B;  4XBF B;  1HNZ T;  2N1G A;  5HYA A;  3S4U A;  2D2S A;  4HQP A;  2BS2 A;  2VVS A;  4JV5 T;  4DND A;  3VKH A;  2DL1 A;  1LRZ A;  3O1J A;  3KVA A;  2P9B A;  3QUJ A;  2LKG A;  3UQ7 A;  1I9B A;  3N2K E;  2V26 A;  3PUY F;  5CGM A;  1W9R A;  3U8M A;  3OYZ A;  2R6G F;  2X51 A;  1S35 A;  2EHO A;  3P4W A;  4JLE A;  5AQG B;  1FJG T;  4YTN A;  3P8C D;  2WSS V;  3Q5X A;  4FRR A;  3WTO A;  2BBJ A;  1LVK A;  5L2L A;  3ZDH A;  4DBQ A;  4CXW A;  2XQ9 A;  3C51 A;  4EOZ B;  2E9X A;  3U78 A;  4QAC A;  2KZ7 B;  1UX4 A;  4U7I A;  4P0B A;  3Q9D A;  3FZK B;  3RI5 A;  2HPJ A;  4HFH A;  4PW8 A;  4I4T E;  3RLF F;  2XHE B;  2ZM6 T;  2CMR A;  4WW0 A;  2CLY B;  1V9D A;  2X0L B;  4B3R T;  2W4X A;  2KLQ A;  3ZJ2 A;  4O8S A;  2UU9 T;  5AFU L;  5FYM A;  1UUR A;  1O3X A;  3PEO A;  5LBM A;  2BBH A;  2LRK A;  4P0A A;  1MNE A;  2CXL A;  5LOV E;  2M6I A;  3ONL C;  5LXB A;  2XYT A;  2H7O A;  3ZN1 B;  4ZJS A;  4Z91 A;  2BDE A;  3N2G E;  4JI0 T;  5JDH A;  1HFA A;  3KV4 A;  4HN9 A;  5CO5 A;  4GYR A;  5IUX A;  3PTR B;  2V1D B;  4MAL A;  4CXX A;  3K3Q C;  3TLV A;  3CQX C;  3NVO A;  3GN5 A;  2VL0 A;  3ZT5 A;  2ACZ A;  1CUN A;  3RIU A;  1HCI A;  2BG9 C;  5FP3 A;  2XAQ B;  4HFE A;  4DBM A;  3RYH E;  5L3G B;  4TWH A;  2BVM A;  2CXF A;  2MPK A;  4ZRU A;  3TLT A;  5BW2 A;  5J5F A;  5L47 A;  2BZB A;  2JQQ A;  4XK9 A;  3F2E A;  5J2U E;  5AFM B;  4IDP A;  5AFL A;  1D1B A;  4KHP T;  1N33 T;  4HWD A;  1IAP A;  2NTX A;  4HWC A;  3RRW A;  3T4M A;  4COF A;  3O1H A;  4DV3 T;  2HHH T;  2UXN B;  1JNR A;  3Q5E A;  1IBL T;  2X68 A;  5JR9 B;  5J0Z A;  1IBK T;  4JI1 T;  4KP3 C;  5HCM A;  2X66 A;  1NEN A;  2EHO B;  5ADX L;  2KND A;  3CVR A;  4IDN A;  2C5J A;  1OED A;  4QAB A;  4O4L E;  2XSB A;  2V5D A;  3AED A;  3BQL A;  3SIO A;  3UT5 E;  2FBW A;  2KWI B;  3FB2 A;  4M1P A;  2WN9 A;  4DO0 A;  1WLX A;  5C3J A;  5FXZ A;  5CJ5 A;  5L3F B;  3TLW A;  3FBL A;  1T72 A;  5A1L A;  3FXE B;  4IDO A;  2YIN A;  3V5S A;  4GK5 E;  5HEG A;  2UXC T;  4WNK A;  4EZH A;  1VRB A;  2DCF A;  3SOL A;  4AKH A;  1R8I A;  2JIW A;  4ZJT A;  2W67 A;  5AQI B;  3EI0 A;  1FMV A;  4AXP A;  3WI3 A;  1BR0 A;  4AKG A;  3ZJ1 A;  3EUH A;  4XAX B;  2LJL A;  3ZC1 A;  4YT0 A;  4ZK1 A;  3MKD A;  3ZKR A;  2W62 A;  4ADZ A;  3UUB A;  2Y8D A;  1HG5 A;  2JJ9 A;  2WZI A;  3I9Y A;  3N9O A;  3RH3 A;  4AKR B;  2FJB A;  4UEM A;  4O4I E;  3T1H T;  2MYS A;  2GK9 A;  2WY2 A;  5LJM A;  1Z8U A;  1I94 T;  4C90 A;  2BYN A;  3DJB A;  3P7I A;  4IT4 A;  3WTK A;  1E7P A;  2XAF B;  2LSG A;  2CRB A;  3WTI A;  1VOM A;  4YLH A;  4EB6 E;  4U7Y A;  1LKX A;  4ZI2 D;  1G73 A;  1OED C;  4DUY T;  2V5C A;  3HA4 A;  1HS7 A;  2XAG B;  3V5U A;  4UM3 S;  4O2A E;  4H63 H;  4H9O C;  4HWH A;  2JQK A;  3TLS A;  4EXT A;  3GN5 B;  4UV9 B;  3AEG A;  1SUM B;  2ZM2 A;  5F8P A;  3NBX X;  4WYV A;  3AVS A;  5EK3 A;  4UV8 B;  4LF4 T;  1SE7 A;  5LMU T;  3T8O A;  3GUA A;  3R84 B;  3NKZ A;  2WWV A;  4EGW A;  1VCT A;  5J5H A;  2CE7 A;  2E2A A;  5FKY A;  5HXR A;  4YSZ A;  5L3D B;  4EYU A;  4U3C A;  4MLK A;  5KXJ A;  3PMZ A;  3FZF B;  2VKH A;  4X1Y E;  5TVC A;  2NTY A;  3LK4 2;  4PFP A;  5AIN A;  2KWH A;  5M4Y A;  2UXX B;  3AE5 A;  3UUN A;  4UVA B;  2CWO A;  3EAB A;  4LMJ A;  4K0U A;  3LDQ B;  5JR9 C;  2Q9Q A;  3KFW X;  3PUQ A;  3ZN0 B;  3VR8 A;  4EED A;  5KZU A;  2YDQ A;  2XJ7 A;  2LLY A;  5AQF B;  2JMH A;  4CI2 B;  3WTN A;  2YDR A;  3A5X A;  3WTH A;  2JQH A;  2UZ6 A;  2M67 A;  3AXJ B;  2IW5 B;  3IBP A;  1Z0P A;  4GK0 E;  4ZR6 A;  5L4H A;  4H9S E;  1MIV A;  4ZOL E;  3LK2 B;  2LOP A;  2K5B B;  2CCQ A;  2Q9Q B;  3L09 A;  2VQE T;  2EHO C;  2K48 A;  1YKE B;  4L5G A;  2IIU A;  4ANJ A;  4JI2 T;  2OV9 A;  4ZI3 C;  3H3A A;  1UX5 A;  4ZZB A;  1N34 T;  1OWA A;  4X66 T;  2G0U A;  5FMN A;  3KBT A;  4UXU A;  4B3T T;  2FJA A;  2WU5 A;  2HH7 A;  2BKO A;  2XUE A;  2Y57 A;  2IC6 A;  2SPC A;  1KFY A;  3N9L A;  4G63 A;  2HN1 A;  3PUA A;  5HXH A;  3AE6 A;  5BP0 A;  2PFV A;  2DI4 A;  2XYS A;  1KNR A;  4U33 A;  3E0Z A;  2BS3 A;  1QLB A;  1MMA A;  4EAH A;  4ERR A;  1WR0 A;  3ZC0 A;  3KBU A;  2QYW A;  5HWY A;  4L9I A;  4NUU A;  5C8Y E;  3QOF A;  2NW9 A;  1OED E;  4ZHQ E;  3ZCJ A;  4ZI2 C;  3NRY A;  4U2Z A;  1M62 A;  3MJX A;  4LML A;  2WZY A;  3MZK B;  2LSK A;  4P09 A;  2Z6E A;  5AFK A;  2BG9 A;  3PUR A;  3IEE A;  3VHL A;  3L39 A;  3FZH B;  3LBX A;  1T7S A;  4UVB B;  4ALX A;  4AFH A;  2E5L T;  4U72 A;  2IAK A;  2CA5 A;  2ZLY A;  3NWI A;  3QK6 A;  4JEH B;  5LGN B;  3HKB E;  2WQY A;  4UIG A;  3ZCI A;  3AXJ A;  4O4H E;  1W0B A;  2ZM8 A;  3K8P C;  1XWM A;  3MK7 C;  1M7K A;  3RX6 A;  4PJL A;  2BYQ A;  2V7I A;  3ZST A;  2NOX A;  2MTQ A;  2UXB T;  2ZM0 A;  3UU8 A;  4GKK T;  3BQK A;  2WDQ A;  1T8B A;  2YDS A;  5AQK B;  4JBW F;  5AQM B;  4CN6 A;  3CX6 B;  4UF0 B;  2J47 A;  2DWK A;  5J5G A;  4LF9 T;  3ZT6 A;  4HE8 A;  2E9X C;  1N32 T;  1VCS A;  3UQ4 A;  4BFQ A;  3OYX A;  1IZN B;  4TX5 A;  2BR7 A;  5FL0 A;  4H9R C;  4MHC A;  1NAF A;  3AE2 A;  1ZHC A;  3CML A;  4BJN A;  1SA0 E;  3CPZ A;  5LG3 A;  3C4W A;  3I0Q A;  3ZMT B;  5FVK A;  5EK4 A;  1S94 A;  3ZMU B;  3C4Z A;  2JQ9 A;  2A2F X;  4IDZ A;  4A56 A;  3P4P A;  5JDG A;  4CZZ B;  5FY1 A;  2BJ0 A;  2AXD S;  2F4V T;  4NUV A;  5JRC A;  5J1G A;  4QH1 A;  4F6R C;  2DWG A;  3EHZ A;  2PGZ A;  4A5X A;  1XMQ T;  2XQ5 A;  3EVY A;  2K3W A;  2XM1 A;  5LXT E;  2YMD A;  2XQ3 A;  4PJM A;  3CKD A;  4QXH B;  4A97 A;  4AQY T;  3PUV F;  4DMW A;  1U4Q A;  2XQ8 A;  2CPT A;  4TV9 E;  1BR4 A;  3N2O A;  4OK0 A;  4H9N C;  2CM0 A;  4NPP A;  2C9T A;  2VKO A;  2BG9 E;  2W66 A;  3I1A A;  3ZLI A;  4YXD A;  2QC1 B;  5FY7 A;  1H7C A;  3BQI A;  1LVF A;  3WTM A;  2X9X A;  4O4J E;  2Y56 A;  3AE7 A;  5AFH A;  2PJQ A;  2JRK A;  5DJQ C;  2KIN B;  2WB5 A;  2ZJU A;  1WYB A;  4Z8X A;  4LF6 T;  3J9X 1;  4WBN E;  2X00 D;  3B13 A;  1IJ5 A;  5KDM C;  4K0K T;  5SYO A; 
#chains in the Genus database with same CATH homology
 4HFI A;  4IRE A;  5FJV A;  2WZY A;  3RQW A;  5CO5 A;  4ILB A;  3SH1 A;  3TLW A;  4UY2 A;  4IL4 A;  4IL9 A;  2KSR A;  5HEH A;  5IUX A;  4ZR6 A;  1OED C;  3IGQ A;  4TNV A;  2XQ6 A;  4UM3 S;  5L4H A;  2BG9 A;  5AFK A;  2MAW A;  3RIF A;  2BYP A;  3JAD A;  3LSV A;  4ZK4 A;  3TLS A;  3TLV A;  2LKG A;  5HEG A;  3UU3 A;  4Z90 A;  3UQ7 A;  1UW6 A;  4AFT A;  4F8H A;  2WNJ A;  1I9B A;  3JAF A;  2VL0 A;  2W8F A;  4ALX A;  5CFB A;  2BJ0 A;  3UU4 A;  4AFH A;  3EAM A;  5HEJ A;  4QH4 A;  3U8M A;  2BG9 C;  2XNV A;  4HFC A;  4TNW A;  3JAE A;  4HFB A;  4ZJT A;  4QH1 A;  2BYS A;  3EHZ A;  4HFE A;  2PGZ A;  5HCJ A;  4DBM A;  2XQ5 A;  4ZZB A;  2WNL A;  3EI0 A;  3P4W A;  4TWH A;  5AFN A;  4ZZC A;  3RHW A;  3GUA A;  2YMD A;  2PH9 A;  4ILC A;  2XZ5 A;  2ZJV A;  4ZRU A;  3TLT A;  4B5D A;  4UXU A;  2XQ3 A;  4D01 A;  5BW2 A;  2X00 A;  5AFJ A;  5J5F A;  5SYO A;  1OED B;  3TLU A;  5L47 A;  3U8N A;  5J5H A;  2YME A;  4A97 A;  4FRR A;  4XK9 A;  2Y57 A;  3WTO A;  2W8G A;  3ZDH A;  3WTL A;  5AFM B;  5AFL A;  4X5T A;  3U8L A;  5J5I A;  2LKH A;  2XQ9 A;  2BYQ A;  3SQ6 A;  4ZK1 A;  5KE4 A;  3C79 A;  2XQ8 A;  3RIA A;  5HEO A;  4NZB A;  5BP0 A;  2LM2 A;  2Y7Y A;  4QAC A;  3PMZ A;  3T4M A;  2XYS A;  4COF A;  4PIR A;  4A98 A;  4UM3 A;  3ZKR A;  3RI5 A;  3UU8 A;  2XQ7 A;  4UM1 A;  4NPP A;  5TVC A;  3P50 A;  2Y54 A;  3ZDG A;  4HFH A;  2C9T A;  3UUB A;  4LMK A;  5AIN A;  1UX2 A;  4AFG A;  4HFD A;  5J0Z A;  2BG9 E;  3RQU A;  4ILA A;  2YKS A;  5HCM A;  4QAA A;  5AFM A;  3WTJ A;  4BQT A;  2M6B A;  4TWF A;  2QC1 B;  5L4E A;  5JME A;  2BG9 B;  3UU5 A;  3UU6 A;  4LMJ A;  2Y58 A;  2XQA A;  2YOE A;  5J5G A;  2BR8 A;  1OED A;  2XQ4 A;  3WTM A;  4QAB A;  4UM3 P;  2Y56 A;  4EZ1 A;  1OED E;  5HEU A;  3SQ9 A;  5BRX A;  4WV9 A;  3PEO A;  5AFH A;  1UV6 A;  5KZU A;  2BYN A;  3UQ4 A;  4BFQ A;  4TWD A;  2XNT A;  2LLY A;  3SIO A;  2WNC A;  3WTK A;  2BYR A;  2ZJU A;  2BR7 A;  3C84 A;  3U8J A;  3WTN A;  2YN6 A;  2M6I A;  2X00 D;  4XHE A;  3U8K A;  3WIP A;  4LML A;  3WTH A;  2XYT A;  2XZ6 A;  3WTI A;  4QH5 A;  4HQP A;  5LXB A;  4ZJS A;  2UZ6 A;  4Z91 A;  2XNU A;  2WN9 A;  5LG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...