4HFBA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant (apo)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfbA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfbA01
4HQPA 2BR7A 4BQTA 4Z91A 2UZ6A 3TLWA 2LKGA 4QH4A 4XHEA 5BW2A 4TWHA 4TNVA 5KZUA 4NZBA 4DBMA 4ZK1A 5HCJA 3RQWA 5CFBA 3SIOA 5L47A 5HEJA 2BG9A 2WNCA 4QAAA 2QC1B 3P4WA 5AFJA 3U8MA 3SQ9A 3WIPA 3ZDGA 2XNUA 4X5TA 4ILAA 1OEDB 2Y7YA 5AFMA 4TWFA 3IGQA 5J5FA 4NPPA 4AFTA 3PMZA 2WNJA 1OEDE 2WN9A 2X00D 2YMEA 4QACA 3WTOA 3WTKA 3RIFA 3UQ4A 4AFHA 4IREA 2BJ0A 5IUXA 2XQ7A 3ZKRA 3C84A 5J5HA 2XQ6A 5SYOA 5JMEA 4HFEA 4QH5A 4ILCA 1UV6A 2BG9B 5HCMA 4ZJTA 3RI5A 4EZ1A 4TNWA 4UM3A 2W8FA 5HEUA 4ZR6A 1UX2A 2XQAA 2ZJUA 2BG9E 4HFCA 2BYQA 4QABA 3SH1A 5AFLA 5AFMB 5J5IA 2XYSA 2LM2A 3EAMA 3T4MA 4D01A 4HFBA 5HEHA 3PEOA 3U8LA 1UW6A 3WTLA 2XZ6A 5AINA 4AFGA 2Y58A 2MAWA 3WTIA 2Y57A 3EHZA 3U8NA 2M6IA 4WV9A 5AFNA 4XK9A 2XQ4A 3UQ7A 4PIRA 4UXUA 4Z90A 3WTJA 4UY2A 4COFA 4UM3S 4ZRUA 3UU5A 4QH1A 4LMKA 2C9TA 4IL4A 2BYPA 3WTNA 2XQ8A 3RQUA 5KE4A 2LKHA 5J0ZA 4B5DA 3WTHA 2YMDA 2XYTA 2VL0A 3UUBA 2BYSA 2Y56A 4ILBA 5HEOA 2M6BA 4LMLA 5LG3A 2BYRA 2XZ5A 2XNVA 2X00A 5J5GA 3TLVA 3JADA 3UU8A 3UU3A 4IL9A 4ZZBA 2WNLA 4ZK4A 3ZDHA 3JAEA 2PGZA 5AFHA 5AFKA 4A97A 5CO5A 3LSVA 5TVCA 3SQ6A 2XNTA 3WTMA 4UM1A 3P50A 4BFQA 3TLUA 3U8JA 3GUAA 3RIAA 4ALXA 2W8GA 3U8KA 2Y54A 2WZYA 2XQ9A 2YN6A 3TLTA 3RHWA 1OEDC 4LMJA 2YOEA 3UU6A 1I9BA 3TLSA 5L4HA 4ZZCA 5FJVA 4ZJSA 2XQ3A 5BP0A 4A98A 2PH9A 2BYNA 4HFHA 4HFIA 4TWDA 5LXBA 4UM3P 3EI0A 4F8HA 2LLYA 2ZJVA 2KSRA 2BR8A 2XQ5A 2YKSA 5BRXA 3JAFA 4HFDA 3UU4A 4FRRA 5HEGA 1OEDA 2BG9C 3C79A 5L4EA
chains in the Genus database with same CATH superfamily
2XAFB 2QA7A 4ANJA 3GA8A 5FXXA 4O8SA 2B76A 2WDQA 1Y64B 2PJQA 2WAUA 2CA5A 4JI2T 4PK6A 4DBMA 4U2YA 3SFDA 2BG9A 4QAAA 2WU2A 2OV9A 2LSGA 3B57A 5L3GB 2Y7YA 3RIUC 3AAIA 2VKOA 4UELA 5J5FA 4CN4A 2NW7A 2WZIA 2W4XA 3HKCE 1U5PA 3ZKRA 3C84A 5JH7E 1T7SA 3PUSA 4U31A 4ZI2D 2E9XA 1MMDA 4M1PA 3F57A 3FZLB 3T4MA 5LHHB 4IHJE 2JQ9A 3ETUA 2XTLA 2P9BA 4HE8A 2JQQA 1NAFA 2WB5A 3C4XA 2Q9QB 4IE4A 2V26A 5L2LA 3O4XE 3VR8A 3P7IA 4X20E 4UF0B 2I0MA 1T8BA 2Q9QD 4DR6T 3AA1B 2X68A 5ABFB 2XJ7A 3RHWA 2LM9A 3B13A 1FMVA 2IC9A 3IF8B 4UM3P 2HN2A 3QB5A 2KZ7B 2H88A 4FRRA 2KMFA 3OPCA 4LF4T 3CX7B 3AE4A 4PK5A 3N9OA 4NZBA 5CFBA 5AQNB 2JQHA 4YSZA 1US7B 2ZM6T 5FXVA 4UR9A 2A9UA 2HN1A 4IE0A 5AFMA 5ETWA 5AQVB 1CUNA 2X0HA 2UXXB 3TKLB 4TNWA 2YDRA 2N1GA 1UK5A 5HEUA 4WYVA 4ZR6A 1UX2A 4QABA 3O1JA 5BR8T 3RYIE 4DR3T 3KDSE 3ZSTA 4JI7T 3N2KE 2Y58A 2D9DA 3RLFF 4JEUB 1HNZT 3LG7A 4PIRA 3ZC0A 5C3JA 2X9HA 3P4QA 5FL0A 5LGNB 2LSKA 3CQXC 3M65A 2PTFA 3WTNA 1KNRA 2BDEA 4ASKA 4ADZA 3Q2MA 1UCUA 3OVUA 2Y56A 2K9AA 2DNXA 2BYRA 2YK0A 4PJLA 4CXWA 2XM2A 5JRCA 3TLVA 1I6ZA 2PGZA 4CXYA 4IT4A 3K3OA 2E9XB 3E08A 4LF5T 2CEAA 2XAQB 3KV5A 2V6YA 3CKDA 3KINB 4CZZB 2NP9A 1QSDA 3UUNA 4H9QC 2E9XD 4A98A 2UXDT 2IW5B 1VCTA 5A1LA 3I1AA 4HWCA 3N9PA 3T8OA 3PUGA 2LJLA 5HXRA 3SFEA 2YDSA 4X1KE 3KBTA 4ERRA 2X9YA 3M3ZB 5FVLA 3ABVA 3FHNA 4EXTA 3ESLA 2XPKA 3LK2B 5HCMA 4ILUA 3U3IA 3N9MA 3J7Yq 4FJOA 1D0XA 4HFCA 1W0BA 2BVMA 2VVSA 3EDUA 3NZQA 5DQWA 2WDRA 5LGUB 3K3NA 2W2UA 3O1HA 3Q5XA 2ZLYA 2LRKA 3UUXB 2W61A 4B3ST 2VVNA 2WDVA 1D1AA 2BYSA 2V8SV 4PAGA 2WM9A 1E2AA 1MMGA 3ONJA 1WRDA 2NWBA 4ZZBA 3AAEB 2UXCT 4DV6T 4DR2T 3AXJB 4P09A 2X0YA 2WS3A 3CX6B 4O4HE 2C0SA 3OBVE 3TLTA 2FUPA 2CCQA 3L09A 3KVBA 4GIWA 3E22E 2PFVA 5LOVE 2JQKA 4Q25A 4J2CA 2V7LA 4TWDA 2FJAA 2C5KT 3JAFA 2BG9C 3ZJ1A 1HFAA 5J2TE 4H63H 4GYSA 4JI8T 5HWYA 3VRAA 1YW0A 5AFJA 1T72A 2X66A 4X5TA 4DIDB 2XASB 4DBQA 4TWFA 1XZYA 4NPPA 2R6GF 4QACA 4UV8B 3QB5K 1UGOA 2V6YB 1Z0PA 5HYAA 4EYYR 5FY0A 3ZT6A 4MFRA 2PBIA 3K3QC 2NOXA 1D1CA 2BG9E 3NRXA 3ETVA 4LF9T 2BKPA 5HEHA 4OYKA 1UX5A 4EV6A 5JDFA 3RGLA 5L3CB 5EK3A 3U8NA 4AKIA 3SOLA 4LFAT 1BR2A 4PFPA 3CX8B 2KXPB 4YSXA 4AQFC 3NZPA 2X9XA 4HWHA 4P1NA 3MJXA 3PJAJ 5AQGB 5LG3A 1QUUA 1N34T 3ZDHA 4AKHA 5AFKA 5KMGP 3ZJ2A 3TLUA 1T98A 2ODVA 1YD8G 5FXWA 5JR9A 2YN6A 5HXCA 3HA4A 4KHPT 4HWIB 3R84B 2LLYA 2IAKA 1MIVA 3C79A 3CWZB 2WCAA 2AE9A 5TAOA 4KBMB 3OYXA 2XSAA 3SS1A 3BQIA 5JVDE 2VURA 5L47A 2CPTA 1SE7A 3V5UA 5FNVE 3SQ9A 2BZBA 4QX7B 2K3WA 3LFMA 4TV9E 3PURA 4O4LE 4B3RT 4AFHA 5IUXA 1LRZA 5LMNT 4BA9A 3A8YC 5AQIB 3MKDA 4TV8E 5JREA 2LE8A 2WY2A 2BYQA 3R6NA 5LJNA 3RYCE 2Y57A 4H9OC 4WV9A 5FMNA 4CN6A 4UF0A 2Y6XA 4DVDA 4ZRUA 4GKKT 2XQ8A 4U3CA 2LKHA 3C4ZA 4GYRA 5LG4A 3UUBA 3VHLA 5HEOA 2M6BA 4YHJA 2VKJA 3AAAB 2WSSV 4LF6T 4WBOA 5AFUL 4WW0A 3U8KA 4EB6E 1W9RA 2Y8DA 2CLYC 4XBFB 2V5DA 3UU4A 3VKGA 2BS2A 4BJNA 1IBMT 2NR4A 3U78A 4Z91A 2LKGA 3N9NA 3MXZA 2WBLA 2UUBT 2YEVC 3JCFA 2W66A 4F6RC 5HAXA 2ZMAA 3ZMVB 3ZDGA 5LHGB 5E0OA 1OEDB 1HG5A 3LDQB 2V1DB 5FKYA 1ZV4X 5AQRB 5GONE 4E7ZA 2W63A 5JR9B 3AE8A 3N2GE 5HXSA 5JDLA 4ILCA 3RPUA 3BK9A 4EZ1A 2JRKA 2WU5A 4JI4T 3CQCB 4KUMB 3SH1A 4BJMA 1M7KA 3GWHA 2XZ6A 4AFGA 2CBIA 2MTQA 3JC6D 4NIQA 3ZT7A 3GN5A 4TZ4C 3K1SA 2C9TA 1GQEA 4UVCB 3AB3B 5J0ZA 3HKEE 4ILBA 3SWHA 4U33A 4X65T 1IAPA 4QXHB 4QWNB 2HH7A 5J1GA 2X00A 2D2SA 3H3MA 2WNLA 4EAHA 4ZS3A 1VRBA 4XAXB 1IBKT 4IGUA 2CHOA 2MPKA 1SHZC 5J2UE 2X67A 4U7YA 3IBPA 3AE1A 1I9BA 5CJ5A 2HHHT 3EVYA 4JI5T 4PJMA 5CB4E 5FVKA 4JI6T 5CA0E 2WQYA 3WAJA 4HWDA 2CXFA 3ZYLA 2NTYA 3PE0A 4BQTA 2J62A 1X79A 1NWMX 4CI3B 4I43B 4CQIA 3AEFA 1I94T 4ILAA 3AA7B 1MIWA 4JI0T 2YMEA 2XY8B 3RIFA 5J5HA 1LVKA 3PDYA 1UV6A 4DO0A 2LHRA 4UM3A 2XSBA 3T1YT 4D01A 2AXDS 4MALA 3NVOA 4GOUA 4B3TT 3QUJA 2LSYA 1KNZA 4Z90A 4UY2A 3AXJA 2Z6EA 3KFWX 4X1IE 3CQGB 2IDOB 3CMLA 2VL8A 3LBXA 4ZK4A 3UU3A 4IL9A 2ACXA 3G06A 4WNKA 4O2BE 1BR1A 3NWIA 5KXJA 4X64T 4ZI2C 1KFYA 2UU9T 4I4TE 4YJ3E 4DBRA 3N2OA 1HF8A 2FJBA 3ZT5A 4H9RC 5EZYE 3GN5B 3BQKA 2KWIB 3UTKA 4KP3C 3TLWA 5DJQC 4HKAA 2EHOB 4ZI3D 4IDOA 1XNQT 4ZK1A 5HCJA 4OFZA 1EZ3A 2HPLA 3RYHE 3AE3A 3ONLC 5LCYA 4X62T 2EHOD 5AQJB 5C2TA 1FMWA 3AECA 2WN9A 2X00D 3P4SA 4DMVA 2BJ0A 3NRYA 1MIYA 4BAYB 2Q9QC 2JPFA 3AEAA 4HGAA 5J5IA 2ZM2A 2E8IA 5BMVE 2RP4A 3RX6A 2CE7A 4DV5T 1XNRT 3T1HT 5LHIB 2BS4A 1OWAA 1HX1B 4DV1T 3AEEA 2IIUA 4UVBB 2OLTA 3RC3A 2IUBA 5JTGA 5CO5A 5LBMA 4QHOA 1YQ4A 4UM1A 3P50A 2V7MA 3ANWB 2BVLA 4JYAT 3GUAA 1KF6A 2DL1A 2W8GA 2WZYA 2XQ9A 3FZFB 4GK0E 3VRBA 2V7JA 5FJVA 2XQ3A 1NEKA 1W09A 2UXNB 3AVSA 3H37A 4L9IA 3LK3B 1ZOYA 5C8YE 4KX6A 4MBQA 4XHEA 3MA9A 2LHNA 2UUAT 1M62A 3PUWF 5HEJA 2DLRA 3LBXB 3WI3A 3U8MA 3WIPA 4YHHT 5LXTE 2VKHA 2KNDA 2H7VC 4AFTA 3KBUA 3ZN0B 4AI6A 1CHUA 5F8PA 2K48A 3AE6A 4LF8T 1N32T 1U4QA 4CXXA 4DNDA 3RI5A 3N5LA 4V1Av 2W8FA 4CI1B 2OA5A 4KI0F 4DR5T 3ZMZB 2E9XC 2XHEB 1MNEA 4NUVA 3KV6A 4UXNB 5FP3A 5L3EB 3KVAA 4DV3T 1UURA 5JDMA 3RRWA 4CI2B 2MBGA 4AXPA 3AE9A 1G8XA 3PU8A 4LMLA 2CMRA 2XZ5A 2X0LB 1J1JA 4H9NC 3NBXX 5AFHA 3SQ6A 2VK9A 3AEGA 3U8JA 5CGMA 3UFEA 5F3JA 3NKZA 3RRCA 3IA3A 4OHFA 3ZYMA 1DU2A 5IHYA 2BYNA 3SRZA 4EGWA 4UV9B 1HX8A 1G73A 3DTOA 5FYMA 3L3PA 2DHRA 4HN9A 4HTEA 1OEDA 4YLHA 3Q5WA 4AQYT 2D5UA 3AE7A 4U72A 2IHR1 3QK6A 1E1HB 5AQTB 1BR4A 3H3AA 5IYZE 3LJCA 2VWAA 1KK7A 2NW9A 4ISTA 3RYFE 2VB6A 4C90A 2XM1A 3PUYF 2JMKA 4L0RA 4I55E 2KWHA 3FBZA 4OK0A 4QH5A 3L39A 5JDGA 2XQAA 5AFLA 5LB7B 5LBQB 4OX9T 3DP7A 4IDPA 2LEHA 3DJBA 4DV2T 3QC9A 3FBLA 2M6IA 4XK9A 5LP6E 4UXUA 3I0OA 4EZHA 3RQUA 1SUMB 1J5ET 4B5DA 1LKXA 1XDOA 3UUMA 1WYCA 5L3DB 2BS3A 4EYUA 4AISA 3BQLA 3AA0B 4AQGA 4H9PC 1HNXT 4IDZA 3WTMA 2D0TA 4DR4T 4PNIA 4YTMA 5AQKB 2LOPA 3Q5EA 1HNWT 1D0ZA 2J4GA 4QXCB 5AQFB 4LMJA 3UU6A 3TLSA 5L4HA 4U7IA 4ZJSA 5FY1A 4HFHA 5HXEA 3B5MA 4O4JE 5LXBA 3ZN1B 2V7IA 3K8PC 2ZJVA 3IHRA 4GKJT 1IJ6A 2VASA 1WCRA 3PJAA 3GMIA 1FIOA 3AE5A 2UUCT 2FJEA 1D1BA 3RF1A 3L8RA 2QGSA 2H3RA 2LRLA 1WLXA 5DQVA 2LT3A 1BR0A 3ZYKA 5LMUT 3PMZA 2WNJA 4TN7B 1ZEEA 3WTKA 4JEHB 4K0UA 4P0AA 2YU2A 4ZJTA 3C64A 2Y48B 1XMQT 3D0TA 4HFBA 1UW6A 3F31A 3I0QA 3C4WA 3AA6B 4KHZF 2I59A 3PV0F 5AFNA 2XQ4A 3UQ7A 3VU7H 4JI3T 4KMCA 4LMKA 1X9BA 3AEBA 4HEAA 4IDQA 5KX5E 2QRXA 3MZKB 4QKNA 1WFDA 2VQET 2PG8A 5LA6E 1J5WA 4A56A 3FXEB 3LSVA 3AE2A 2H7OA 4N78D 2BBJA 1HTJF 1S35A 2EHOA 2PH9A 3KV4A 3CVRA 3HL6A 5H6RB 2X51A 2XQ5A 2CWOA 1FJGT 2M67A 4HQPA 2BR7A 2N9DA 4TNVA 3SIOA 5ABHA 2JJ9A 1R8IA 4FI5A 3C50A 2LOSA 2VKDA 2CRBA 3IGQA 5AQHB 2WWUA 1L0VA 3UQ4A 3PU3A 3RH3A 4HFEA 4UVAB 5AQOB 2KLQA 2CXDA 4G2AA 2LM2A 2QYWA 1VCSA 1V9DA 3PEOA 3OYZA 3I9WA 2IC6A 3WTLA 2FJDA 4AQFA 2G0UA 4AKRB 2I6HA 4UM3S 5AQPB 2L8KA 3ANWA 3FB2A 4IE5A 5F5WA 3WTHA 4YT0A 4DR7T 4C91A 3OKQA 4ZXLA 2XAJB 2XNVA 2DI4A 3QOFA 2ODUA 1ZP0A 5L3BB 4L5GA 4I0UA 1MNDA 3RIAA 4QX8B 4H9SE 1LVFA 1H7CA 4CN1A 1OEDC 3RKGA 2YOEA 5M4YA 3C51A 3MK7C 4B6XA 5JR9C 2KSRA 5BRXA 1KEYA 2YKSA 5L4EA 4DV0T 2C5IT 2V7KA 3FXDB 2XUEA 3JC6C 4QH4A 3FZKB 4LFCT 2ES0A 3RQWA 2YDQA 2L9QA 4YFSA 3C98B 2QC1B 2XNUA 2VQFT 2DWKA 3HKBE 5ABEA 4WBNE 2CXLA 2WWVA 2LSJA 1OEDE 2XQ6A 5JMEA 3ZMTB 2BG9B 2NTXA 1NENA 4JBWF 2A3DA 4AKGA 3EAMA 3ZPOA 4YTNA 3ZLIA 3WAKA 5AINA 2MAWA 4B3MT 3WTIA 2N2NA 2K5BB 3O1IA 4NXNT 4X1YE 3FZMB 5FL1A 3UU5A 4K0KT 2E5VA 4YXDA 1HR0T 4PJJA 2YMDA 3ZMSB 2MOZA 3UU8A 2W0GA 4A97A 4I50E 4OYJA 1IJ5A 4LF7T 5CA1E 3ZCJA 4AKLA 2WP9A 4O2AE 4HWFA 3QNUA 4ZHQE 3PUQA 5AQSB 2WMOA 2XZEA 2F4VT 3O9XA 2IMLA 4JLEA 2W00A 4ZEYA 1AJ3A 3RKOA 1MMNA 4DUYT 2H89A 3N9QA 1O3XA 5H6QB 2JMHA 3HI2A 2HPJA 3W15B 1YXRA 4EOZB 3AEDA 3V5SA 2A72A 4EIWA 2QVAA 3RIUA 5EK4A 3PUAA 2ZJUA 5AFMB 3ZEFB 4P0BA 3UFGA 5LGTB 3J9X1 3U8LA 1HG2A 5FY7A 5HXHA 2ZM0A 2D0UA 3PTRB 4YSYA 1JNZA 3A5XA 1YKEB 4NUUA 3IEEA 4IL4A 4H63V 2XAGB 3ONXA 5ABGA 5KE4A 4JUYA 2E2AA 2VL0A 4ZI3C 3OJAA 3JADA 5AQLB 4PW8A 1N36T 3JAEA 4EEDA 1B7TA 2A2FX 2EHOC 4BFQA 2CHNA 3CPZA 4ALXA 5FXZA 5AQMB 1SA0E 5DABA 1E7PA 1IZNB 3P4RA 4IE7A 5AQUB 4MLKA 5JRCB 5BP0A 3PUZF 2ZM8A 2DWGA 3EI0A 3HKDE 2XAHB 5EK2A 1KNPA 1XDPA 5LNKA 2UZ6A 4DV4T 4X66T 5KZUA 1UUSA 2LSIA 4U74A 2NW8A 2V6XA 2KINB 4DUZT 2WNCA 4WZXA 2ACZA 1YQ3A 3PUVF 4EZ4A 2BKNA 2FBWA 3Q5DA 3WTOA 4GK5E 2CLYB 4IREA 4TX5A 4PFOA 5JQGE 4EEBA 2WZHA 1JNRA 2CM0A 4ZOLE 3EDVA 3UULA 4NXMT 1ZKEA 2XYSA 3UT5E 3ZC1A 4XZCA 3P4PA 3ZMUB 4PK4A 3EABA 5JDQA 4YTPA 2W62A 4DV7T 4QH1A 4ISSA 2RPAA 3E0ZA 2XYTA 1HCIA 3MACA 5J5GA 2WMNA 4JV5T 4IDNA 1WR6A 1WR0A 2GK9A 5TVCA 3S4UA 2MYSA 2CWYA 4IIJE 3OTOT 5HWXA 2L3LA 1N33T 4DR1T 5LYJE 1ZHCA 4ZZCA 2SPCA 1IBLT 1FEWA 3P8CD 1HS7A 1YKHB 5L3FB 4QXBB 1WYBA 4HFVA 2J1DG 5BW2A 5AQQB 5JDHA 2K24A 3A7MA 4TWHA 4E7SA 3VR9A 1QLBA 1XMOT 2JIWA 5ADXL 3P4WA 3Q9DA 4YY3T 3EUHA 2C5JA 2Q9QA 3HR0A 2B1EA 2DCFA 4U2ZA 4JI1T 1VOMA 3RC8A 2XQ7A 5SYOA 5ABFA 4A5XA 5JDNA 4IE6A 4LFBT 4G63A 5LJMA 2E5LT 2XQYA 3ZCIA 4TUYE 4MHCA 3EHZA 1S94A 1XWMA 2KT9A 1W0AA 3WTJA 4O4IE 4COFA 4UIGA 1Z8UA 3PUXF 3AVRA 2BYPA 2V5CA 2UXBT 4ZS2A 2J47A 1UX4A 4DMWA 2BKOA 2CBJA 4AIUA 4UEMA 3VKHA 3X1DA 5KDMC 1MMAA 4PJNA 5IWAT 3LK42 4YJ2E 2XNTA 2W67A 1OXZA 3KV9A 4ZI7E 1D0YA 2Y54A 3N9LA 2X9WA 2YINA 3CK6A 3ZSSA 3FZHB 4Z8XA 3F2EA 2YU1A 4HFIA 4F8HA 1Y01A 2BR8A 2BBHA 2RA1A 4HFDA 3CIRA 5HEGA 3I9YA
chains in the Genus database with same CATH topology
4HQPA 2BR7A 4BQTA 4Z91A 2UZ6A 3TLWA 2LKGA 4QH4A 4XHEA 5BW2A 4TWHA 4TNVA 5KZUA 4NZBA 4DBMA 4ZK1A 5HCJA 3RQWA 5CFBA 3SIOA 5L47A 5HEJA 2BG9A 2WNCA 4QAAA 2QC1B 3P4WA 5AFJA 3U8MA 3SQ9A 3WIPA 3ZDGA 2XNUA 4X5TA 4ILAA 1OEDB 2Y7YA 5AFMA 4TWFA 3IGQA 5J5FA 4NPPA 4AFTA 3PMZA 2WNJA 1OEDE 2WN9A 2X00D 2YMEA 4QACA 3WTOA 3WTKA 3RIFA 3UQ4A 4AFHA 4IREA 2BJ0A 5IUXA 2XQ7A 3ZKRA 3C84A 5J5HA 2XQ6A 5SYOA 5JMEA 4HFEA 4QH5A 4ILCA 1UV6A 2BG9B 5HCMA 4ZJTA 3RI5A 4EZ1A 4TNWA 4UM3A 2W8FA 5HEUA 4ZR6A 1UX2A 2XQAA 2ZJUA 2BG9E 4HFCA 2BYQA 4QABA 3SH1A 5AFLA 5AFMB 5J5IA 2XYSA 2LM2A 3EAMA 3T4MA 4D01A 4HFBA 5HEHA 3PEOA 3U8LA 1UW6A 3WTLA 2XZ6A 5AINA 4AFGA 2Y58A 2MAWA 3WTIA 2Y57A 3EHZA 3U8NA 2M6IA 4WV9A 5AFNA 4XK9A 2XQ4A 3UQ7A 4PIRA 4UXUA 4Z90A 3WTJA 4UY2A 4COFA 4UM3S 4ZRUA 3UU5A 4QH1A 4LMKA 2C9TA 4IL4A 2BYPA 3WTNA 2XQ8A 3RQUA 5KE4A 2LKHA 5J0ZA 4B5DA 3WTHA 2YMDA 2XYTA 2VL0A 3UUBA 2BYSA 2Y56A 4ILBA 5HEOA 2M6BA 4LMLA 5LG3A 2BYRA 2XZ5A 2XNVA 2X00A 5J5GA 3TLVA 3JADA 3UU8A 3UU3A 4IL9A 4ZZBA 2WNLA 4ZK4A 3ZDHA 3JAEA 2PGZA 5AFHA 5AFKA 4A97A 5CO5A 3LSVA 5TVCA 3SQ6A 2XNTA 3WTMA 4UM1A 3P50A 4BFQA 3TLUA 3U8JA 3GUAA 3RIAA 4ALXA 2W8GA 3U8KA 2Y54A 2WZYA 2XQ9A 2YN6A 3TLTA 3RHWA 1OEDC 4LMJA 2YOEA 3UU6A 1I9BA 3TLSA 5L4HA 4ZZCA 5FJVA 4ZJSA 2XQ3A 5BP0A 4A98A 2PH9A 2BYNA 4HFHA 4HFIA 4TWDA 5LXBA 4UM3P 3EI0A 4F8HA 2LLYA 2ZJVA 2KSRA 2BR8A 2XQ5A 2YKSA 5BRXA 3JAFA 4HFDA 3UU4A 4FRRA 5HEGA 1OEDA 2BG9C 3C79A 5L4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HQP A;  2BR7 A;  4BQT A;  4Z91 A;  2UZ6 A;  3TLW A;  2LKG A;  4QH4 A;  4XHE A;  5BW2 A;  4TWH A;  4TNV A;  5KZU A;  4NZB A;  4DBM A;  4ZK1 A;  5HCJ A;  3RQW A;  5CFB A;  3SIO A;  5L47 A;  5HEJ A;  2BG9 A;  2WNC A;  4QAA A;  2QC1 B;  3P4W A;  5AFJ A;  3U8M A;  3SQ9 A;  3WIP A;  3ZDG A;  2XNU A;  4X5T A;  4ILA A;  1OED B;  2Y7Y A;  5AFM A;  4TWF A;  3IGQ A;  5J5F A;  4NPP A;  4AFT A;  3PMZ A;  2WNJ A;  1OED E;  2WN9 A;  2X00 D;  2YME A;  4QAC A;  3WTO A;  3WTK A;  3RIF A;  3UQ4 A;  4AFH A;  4IRE A;  2BJ0 A;  5IUX A;  2XQ7 A;  3ZKR A;  3C84 A;  5J5H A;  2XQ6 A;  5SYO A;  5JME A;  4HFE A;  4QH5 A;  4ILC A;  1UV6 A;  2BG9 B;  5HCM A;  4ZJT A;  3RI5 A;  4EZ1 A;  4TNW A;  4UM3 A;  2W8F A;  5HEU A;  4ZR6 A;  1UX2 A;  2XQA A;  2ZJU A;  2BG9 E;  4HFC A;  2BYQ A;  4QAB A;  3SH1 A;  5AFL A;  5AFM B;  5J5I A;  2XYS A;  2LM2 A;  3EAM A;  3T4M A;  4D01 A;  4HFB A;  5HEH A;  3PEO A;  3U8L A;  1UW6 A;  3WTL A;  2XZ6 A;  5AIN A;  4AFG A;  2Y58 A;  2MAW A;  3WTI A;  2Y57 A;  3EHZ A;  3U8N A;  2M6I A;  4WV9 A;  5AFN A;  4XK9 A;  2XQ4 A;  3UQ7 A;  4PIR A;  4UXU A;  4Z90 A;  3WTJ A;  4UY2 A;  4COF A;  4UM3 S;  4ZRU A;  3UU5 A;  4QH1 A;  4LMK A;  2C9T A;  4IL4 A;  2BYP A;  3WTN A;  2XQ8 A;  3RQU A;  5KE4 A;  2LKH A;  5J0Z A;  4B5D A;  3WTH A;  2YMD A;  2XYT A;  2VL0 A;  3UUB A;  2BYS A;  2Y56 A;  4ILB A;  5HEO A;  2M6B A;  4LML A;  5LG3 A;  2BYR A;  2XZ5 A;  2XNV A;  2X00 A;  5J5G A;  3TLV A;  3JAD A;  3UU8 A;  3UU3 A;  4IL9 A;  4ZZB A;  2WNL A;  4ZK4 A;  3ZDH A;  3JAE A;  2PGZ A;  5AFH A;  5AFK A;  4A97 A;  5CO5 A;  3LSV A;  5TVC A;  3SQ6 A;  2XNT A;  3WTM A;  4UM1 A;  3P50 A;  4BFQ A;  3TLU A;  3U8J A;  3GUA A;  3RIA A;  4ALX A;  2W8G A;  3U8K A;  2Y54 A;  2WZY A;  2XQ9 A;  2YN6 A;  3TLT A;  3RHW A;  1OED C;  4LMJ A;  2YOE A;  3UU6 A;  1I9B A;  3TLS A;  5L4H A;  4ZZC A;  5FJV A;  4ZJS A;  2XQ3 A;  5BP0 A;  4A98 A;  2PH9 A;  2BYN A;  4HFH A;  4HFI A;  4TWD A;  5LXB A;  4UM3 P;  3EI0 A;  4F8H A;  2LLY A;  2ZJV A;  2KSR A;  2BR8 A;  2XQ5 A;  2YKS A;  5BRX A;  3JAF A;  4HFD A;  3UU4 A;  4FRR A;  5HEG A;  1OED A;  2BG9 C;  3C79 A;  5L4E A; 
#chains in the Genus database with same CATH topology
 2XAF B;  2QA7 A;  4ANJ A;  3GA8 A;  5FXX A;  4O8S A;  2B76 A;  2WDQ A;  1Y64 B;  2PJQ A;  2WAU A;  2CA5 A;  4JI2 T;  4PK6 A;  4DBM A;  4U2Y A;  3SFD A;  2BG9 A;  4QAA A;  2WU2 A;  2OV9 A;  2LSG A;  3B57 A;  5L3G B;  2Y7Y A;  3RIU C;  3AAI A;  2VKO A;  4UEL A;  5J5F A;  4CN4 A;  2NW7 A;  2WZI A;  2W4X A;  3HKC E;  1U5P A;  3ZKR A;  3C84 A;  5JH7 E;  1T7S A;  3PUS A;  4U31 A;  4ZI2 D;  2E9X A;  1MMD A;  4M1P A;  3F57 A;  3FZL B;  3T4M A;  5LHH B;  4IHJ E;  2JQ9 A;  3ETU A;  2XTL A;  2P9B A;  4HE8 A;  2JQQ A;  1NAF A;  2WB5 A;  3C4X A;  2Q9Q B;  4IE4 A;  2V26 A;  5L2L A;  3O4X E;  3VR8 A;  3P7I A;  4X20 E;  4UF0 B;  2I0M A;  1T8B A;  2Q9Q D;  4DR6 T;  3AA1 B;  2X68 A;  5ABF B;  2XJ7 A;  3RHW A;  2LM9 A;  3B13 A;  1FMV A;  2IC9 A;  3IF8 B;  4UM3 P;  2HN2 A;  3QB5 A;  2KZ7 B;  2H88 A;  4FRR A;  2KMF A;  3OPC A;  4LF4 T;  3CX7 B;  3AE4 A;  4PK5 A;  3N9O A;  4NZB A;  5CFB A;  5AQN B;  2JQH A;  4YSZ A;  1US7 B;  2ZM6 T;  5FXV A;  4UR9 A;  2A9U A;  2HN1 A;  4IE0 A;  5AFM A;  5ETW A;  5AQV B;  1CUN A;  2X0H A;  2UXX B;  3TKL B;  4TNW A;  2YDR A;  2N1G A;  1UK5 A;  5HEU A;  4WYV A;  4ZR6 A;  1UX2 A;  4QAB A;  3O1J A;  5BR8 T;  3RYI E;  4DR3 T;  3KDS E;  3ZST A;  4JI7 T;  3N2K E;  2Y58 A;  2D9D A;  3RLF F;  4JEU B;  1HNZ T;  3LG7 A;  4PIR A;  3ZC0 A;  5C3J A;  2X9H A;  3P4Q A;  5FL0 A;  5LGN B;  2LSK A;  3CQX C;  3M65 A;  2PTF A;  3WTN A;  1KNR A;  2BDE A;  4ASK A;  4ADZ A;  3Q2M A;  1UCU A;  3OVU A;  2Y56 A;  2K9A A;  2DNX A;  2BYR A;  2YK0 A;  4PJL A;  4CXW A;  2XM2 A;  5JRC A;  3TLV A;  1I6Z A;  2PGZ A;  4CXY A;  4IT4 A;  3K3O A;  2E9X B;  3E08 A;  4LF5 T;  2CEA A;  2XAQ B;  3KV5 A;  2V6Y A;  3CKD A;  3KIN B;  4CZZ B;  2NP9 A;  1QSD A;  3UUN A;  4H9Q C;  2E9X D;  4A98 A;  2UXD T;  2IW5 B;  1VCT A;  5A1L A;  3I1A A;  4HWC A;  3N9P A;  3T8O A;  3PUG A;  2LJL A;  5HXR A;  3SFE A;  2YDS A;  4X1K E;  3KBT A;  4ERR A;  2X9Y A;  3M3Z B;  5FVL A;  3ABV A;  3FHN A;  4EXT A;  3ESL A;  2XPK A;  3LK2 B;  5HCM A;  4ILU A;  3U3I A;  3N9M A;  3J7Y q;  4FJO A;  1D0X A;  4HFC A;  1W0B A;  2BVM A;  2VVS A;  3EDU A;  3NZQ A;  5DQW A;  2WDR A;  5LGU B;  3K3N A;  2W2U A;  3O1H A;  3Q5X A;  2ZLY A;  2LRK A;  3UUX B;  2W61 A;  4B3S T;  2VVN A;  2WDV A;  1D1A A;  2BYS A;  2V8S V;  4PAG A;  2WM9 A;  1E2A A;  1MMG A;  3ONJ A;  1WRD A;  2NWB A;  4ZZB A;  3AAE B;  2UXC T;  4DV6 T;  4DR2 T;  3AXJ B;  4P09 A;  2X0Y A;  2WS3 A;  3CX6 B;  4O4H E;  2C0S A;  3OBV E;  3TLT A;  2FUP A;  2CCQ A;  3L09 A;  3KVB A;  4GIW A;  3E22 E;  2PFV A;  5LOV E;  2JQK A;  4Q25 A;  4J2C A;  2V7L A;  4TWD A;  2FJA A;  2C5K T;  3JAF A;  2BG9 C;  3ZJ1 A;  1HFA A;  5J2T E;  4H63 H;  4GYS A;  4JI8 T;  5HWY A;  3VRA A;  1YW0 A;  5AFJ A;  1T72 A;  2X66 A;  4X5T A;  4DID B;  2XAS B;  4DBQ A;  4TWF A;  1XZY A;  4NPP A;  2R6G F;  4QAC A;  4UV8 B;  3QB5 K;  1UGO A;  2V6Y B;  1Z0P A;  5HYA A;  4EYY R;  5FY0 A;  3ZT6 A;  4MFR A;  2PBI A;  3K3Q C;  2NOX A;  1D1C A;  2BG9 E;  3NRX A;  3ETV A;  4LF9 T;  2BKP A;  5HEH A;  4OYK A;  1UX5 A;  4EV6 A;  5JDF A;  3RGL A;  5L3C B;  5EK3 A;  3U8N A;  4AKI A;  3SOL A;  4LFA T;  1BR2 A;  4PFP A;  3CX8 B;  2KXP B;  4YSX A;  4AQF C;  3NZP A;  2X9X A;  4HWH A;  4P1N A;  3MJX A;  3PJA J;  5AQG B;  5LG3 A;  1QUU A;  1N34 T;  3ZDH A;  4AKH A;  5AFK A;  5KMG P;  3ZJ2 A;  3TLU A;  1T98 A;  2ODV A;  1YD8 G;  5FXW A;  5JR9 A;  2YN6 A;  5HXC A;  3HA4 A;  4KHP T;  4HWI B;  3R84 B;  2LLY A;  2IAK A;  1MIV A;  3C79 A;  3CWZ B;  2WCA A;  2AE9 A;  5TAO A;  4KBM B;  3OYX A;  2XSA A;  3SS1 A;  3BQI A;  5JVD E;  2VUR A;  5L47 A;  2CPT A;  1SE7 A;  3V5U A;  5FNV E;  3SQ9 A;  2BZB A;  4QX7 B;  2K3W A;  3LFM A;  4TV9 E;  3PUR A;  4O4L E;  4B3R T;  4AFH A;  5IUX A;  1LRZ A;  5LMN T;  4BA9 A;  3A8Y C;  5AQI B;  3MKD A;  4TV8 E;  5JRE A;  2LE8 A;  2WY2 A;  2BYQ A;  3R6N A;  5LJN A;  3RYC E;  2Y57 A;  4H9O C;  4WV9 A;  5FMN A;  4CN6 A;  4UF0 A;  2Y6X A;  4DVD A;  4ZRU A;  4GKK T;  2XQ8 A;  4U3C A;  2LKH A;  3C4Z A;  4GYR A;  5LG4 A;  3UUB A;  3VHL A;  5HEO A;  2M6B A;  4YHJ A;  2VKJ A;  3AAA B;  2WSS V;  4LF6 T;  4WBO A;  5AFU L;  4WW0 A;  3U8K A;  4EB6 E;  1W9R A;  2Y8D A;  2CLY C;  4XBF B;  2V5D A;  3UU4 A;  3VKG A;  2BS2 A;  4BJN A;  1IBM T;  2NR4 A;  3U78 A;  4Z91 A;  2LKG A;  3N9N A;  3MXZ A;  2WBL A;  2UUB T;  2YEV C;  3JCF A;  2W66 A;  4F6R C;  5HAX A;  2ZMA A;  3ZMV B;  3ZDG A;  5LHG B;  5E0O A;  1OED B;  1HG5 A;  3LDQ B;  2V1D B;  5FKY A;  1ZV4 X;  5AQR B;  5GON E;  4E7Z A;  2W63 A;  5JR9 B;  3AE8 A;  3N2G E;  5HXS A;  5JDL A;  4ILC A;  3RPU A;  3BK9 A;  4EZ1 A;  2JRK A;  2WU5 A;  4JI4 T;  3CQC B;  4KUM B;  3SH1 A;  4BJM A;  1M7K A;  3GWH A;  2XZ6 A;  4AFG A;  2CBI A;  2MTQ A;  3JC6 D;  4NIQ A;  3ZT7 A;  3GN5 A;  4TZ4 C;  3K1S A;  2C9T A;  1GQE A;  4UVC B;  3AB3 B;  5J0Z A;  3HKE E;  4ILB A;  3SWH A;  4U33 A;  4X65 T;  1IAP A;  4QXH B;  4QWN B;  2HH7 A;  5J1G A;  2X00 A;  2D2S A;  3H3M A;  2WNL A;  4EAH A;  4ZS3 A;  1VRB A;  4XAX B;  1IBK T;  4IGU A;  2CHO A;  2MPK A;  1SHZ C;  5J2U E;  2X67 A;  4U7Y A;  3IBP A;  3AE1 A;  1I9B A;  5CJ5 A;  2HHH T;  3EVY A;  4JI5 T;  4PJM A;  5CB4 E;  5FVK A;  4JI6 T;  5CA0 E;  2WQY A;  3WAJ A;  4HWD A;  2CXF A;  3ZYL A;  2NTY A;  3PE0 A;  4BQT A;  2J62 A;  1X79 A;  1NWM X;  4CI3 B;  4I43 B;  4CQI A;  3AEF A;  1I94 T;  4ILA A;  3AA7 B;  1MIW A;  4JI0 T;  2YME A;  2XY8 B;  3RIF A;  5J5H A;  1LVK A;  3PDY A;  1UV6 A;  4DO0 A;  2LHR A;  4UM3 A;  2XSB A;  3T1Y T;  4D01 A;  2AXD S;  4MAL A;  3NVO A;  4GOU A;  4B3T T;  3QUJ A;  2LSY A;  1KNZ A;  4Z90 A;  4UY2 A;  3AXJ A;  2Z6E A;  3KFW X;  4X1I E;  3CQG B;  2IDO B;  3CML A;  2VL8 A;  3LBX A;  4ZK4 A;  3UU3 A;  4IL9 A;  2ACX A;  3G06 A;  4WNK A;  4O2B E;  1BR1 A;  3NWI A;  5KXJ A;  4X64 T;  4ZI2 C;  1KFY A;  2UU9 T;  4I4T E;  4YJ3 E;  4DBR A;  3N2O A;  1HF8 A;  2FJB A;  3ZT5 A;  4H9R C;  5EZY E;  3GN5 B;  3BQK A;  2KWI B;  3UTK A;  4KP3 C;  3TLW A;  5DJQ C;  4HKA A;  2EHO B;  4ZI3 D;  4IDO A;  1XNQ T;  4ZK1 A;  5HCJ A;  4OFZ A;  1EZ3 A;  2HPL A;  3RYH E;  3AE3 A;  3ONL C;  5LCY A;  4X62 T;  2EHO D;  5AQJ B;  5C2T A;  1FMW A;  3AEC A;  2WN9 A;  2X00 D;  3P4S A;  4DMV A;  2BJ0 A;  3NRY A;  1MIY A;  4BAY B;  2Q9Q C;  2JPF A;  3AEA A;  4HGA A;  5J5I A;  2ZM2 A;  2E8I A;  5BMV E;  2RP4 A;  3RX6 A;  2CE7 A;  4DV5 T;  1XNR T;  3T1H T;  5LHI B;  2BS4 A;  1OWA A;  1HX1 B;  4DV1 T;  3AEE A;  2IIU A;  4UVB B;  2OLT A;  3RC3 A;  2IUB A;  5JTG A;  5CO5 A;  5LBM A;  4QHO A;  1YQ4 A;  4UM1 A;  3P50 A;  2V7M A;  3ANW B;  2BVL A;  4JYA T;  3GUA A;  1KF6 A;  2DL1 A;  2W8G A;  2WZY A;  2XQ9 A;  3FZF B;  4GK0 E;  3VRB A;  2V7J A;  5FJV A;  2XQ3 A;  1NEK A;  1W09 A;  2UXN B;  3AVS A;  3H37 A;  4L9I A;  3LK3 B;  1ZOY A;  5C8Y E;  4KX6 A;  4MBQ A;  4XHE A;  3MA9 A;  2LHN A;  2UUA T;  1M62 A;  3PUW F;  5HEJ A;  2DLR A;  3LBX B;  3WI3 A;  3U8M A;  3WIP A;  4YHH T;  5LXT E;  2VKH A;  2KND A;  2H7V C;  4AFT A;  3KBU A;  3ZN0 B;  4AI6 A;  1CHU A;  5F8P A;  2K48 A;  3AE6 A;  4LF8 T;  1N32 T;  1U4Q A;  4CXX A;  4DND A;  3RI5 A;  3N5L A;  4V1A v;  2W8F A;  4CI1 B;  2OA5 A;  4KI0 F;  4DR5 T;  3ZMZ B;  2E9X C;  2XHE B;  1MNE A;  4NUV A;  3KV6 A;  4UXN B;  5FP3 A;  5L3E B;  3KVA A;  4DV3 T;  1UUR A;  5JDM A;  3RRW A;  4CI2 B;  2MBG A;  4AXP A;  3AE9 A;  1G8X A;  3PU8 A;  4LML A;  2CMR A;  2XZ5 A;  2X0L B;  1J1J A;  4H9N C;  3NBX X;  5AFH A;  3SQ6 A;  2VK9 A;  3AEG A;  3U8J A;  5CGM A;  3UFE A;  5F3J A;  3NKZ A;  3RRC A;  3IA3 A;  4OHF A;  3ZYM A;  1DU2 A;  5IHY A;  2BYN A;  3SRZ A;  4EGW A;  4UV9 B;  1HX8 A;  1G73 A;  3DTO A;  5FYM A;  3L3P A;  2DHR A;  4HN9 A;  4HTE A;  1OED A;  4YLH A;  3Q5W A;  4AQY T;  2D5U A;  3AE7 A;  4U72 A;  2IHR 1;  3QK6 A;  1E1H B;  5AQT B;  1BR4 A;  3H3A A;  5IYZ E;  3LJC A;  2VWA A;  1KK7 A;  2NW9 A;  4IST A;  3RYF E;  2VB6 A;  4C90 A;  2XM1 A;  3PUY F;  2JMK A;  4L0R A;  4I55 E;  2KWH A;  3FBZ A;  4OK0 A;  4QH5 A;  3L39 A;  5JDG A;  2XQA A;  5AFL A;  5LB7 B;  5LBQ B;  4OX9 T;  3DP7 A;  4IDP A;  2LEH A;  3DJB A;  4DV2 T;  3QC9 A;  3FBL A;  2M6I A;  4XK9 A;  5LP6 E;  4UXU A;  3I0O A;  4EZH A;  3RQU A;  1SUM B;  1J5E T;  4B5D A;  1LKX A;  1XDO A;  3UUM A;  1WYC A;  5L3D B;  2BS3 A;  4EYU A;  4AIS A;  3BQL A;  3AA0 B;  4AQG A;  4H9P C;  1HNX T;  4IDZ A;  3WTM A;  2D0T A;  4DR4 T;  4PNI A;  4YTM A;  5AQK B;  2LOP A;  3Q5E A;  1HNW T;  1D0Z A;  2J4G A;  4QXC B;  5AQF B;  4LMJ A;  3UU6 A;  3TLS A;  5L4H A;  4U7I A;  4ZJS A;  5FY1 A;  4HFH A;  5HXE A;  3B5M A;  4O4J E;  5LXB A;  3ZN1 B;  2V7I A;  3K8P C;  2ZJV A;  3IHR A;  4GKJ T;  1IJ6 A;  2VAS A;  1WCR A;  3PJA A;  3GMI A;  1FIO A;  3AE5 A;  2UUC T;  2FJE A;  1D1B A;  3RF1 A;  3L8R A;  2QGS A;  2H3R A;  2LRL A;  1WLX A;  5DQV A;  2LT3 A;  1BR0 A;  3ZYK A;  5LMU T;  3PMZ A;  2WNJ A;  4TN7 B;  1ZEE A;  3WTK A;  4JEH B;  4K0U A;  4P0A A;  2YU2 A;  4ZJT A;  3C64 A;  2Y48 B;  1XMQ T;  3D0T A;  4HFB A;  1UW6 A;  3F31 A;  3I0Q A;  3C4W A;  3AA6 B;  4KHZ F;  2I59 A;  3PV0 F;  5AFN A;  2XQ4 A;  3UQ7 A;  3VU7 H;  4JI3 T;  4KMC A;  4LMK A;  1X9B A;  3AEB A;  4HEA A;  4IDQ A;  5KX5 E;  2QRX A;  3MZK B;  4QKN A;  1WFD A;  2VQE T;  2PG8 A;  5LA6 E;  1J5W A;  4A56 A;  3FXE B;  3LSV A;  3AE2 A;  2H7O A;  4N78 D;  2BBJ A;  1HTJ F;  1S35 A;  2EHO A;  2PH9 A;  3KV4 A;  3CVR A;  3HL6 A;  5H6R B;  2X51 A;  2XQ5 A;  2CWO A;  1FJG T;  2M67 A;  4HQP A;  2BR7 A;  2N9D A;  4TNV A;  3SIO A;  5ABH A;  2JJ9 A;  1R8I A;  4FI5 A;  3C50 A;  2LOS A;  2VKD A;  2CRB A;  3IGQ A;  5AQH B;  2WWU A;  1L0V A;  3UQ4 A;  3PU3 A;  3RH3 A;  4HFE A;  4UVA B;  5AQO B;  2KLQ A;  2CXD A;  4G2A A;  2LM2 A;  2QYW A;  1VCS A;  1V9D A;  3PEO A;  3OYZ A;  3I9W A;  2IC6 A;  3WTL A;  2FJD A;  4AQF A;  2G0U A;  4AKR B;  2I6H A;  4UM3 S;  5AQP B;  2L8K A;  3ANW A;  3FB2 A;  4IE5 A;  5F5W A;  3WTH A;  4YT0 A;  4DR7 T;  4C91 A;  3OKQ A;  4ZXL A;  2XAJ B;  2XNV A;  2DI4 A;  3QOF A;  2ODU A;  1ZP0 A;  5L3B B;  4L5G A;  4I0U A;  1MND A;  3RIA A;  4QX8 B;  4H9S E;  1LVF A;  1H7C A;  4CN1 A;  1OED C;  3RKG A;  2YOE A;  5M4Y A;  3C51 A;  3MK7 C;  4B6X A;  5JR9 C;  2KSR A;  5BRX A;  1KEY A;  2YKS A;  5L4E A;  4DV0 T;  2C5I T;  2V7K A;  3FXD B;  2XUE A;  3JC6 C;  4QH4 A;  3FZK B;  4LFC T;  2ES0 A;  3RQW A;  2YDQ A;  2L9Q A;  4YFS A;  3C98 B;  2QC1 B;  2XNU A;  2VQF T;  2DWK A;  3HKB E;  5ABE A;  4WBN E;  2CXL A;  2WWV A;  2LSJ A;  1OED E;  2XQ6 A;  5JME A;  3ZMT B;  2BG9 B;  2NTX A;  1NEN A;  4JBW F;  2A3D A;  4AKG A;  3EAM A;  3ZPO A;  4YTN A;  3ZLI A;  3WAK A;  5AIN A;  2MAW A;  4B3M T;  3WTI A;  2N2N A;  2K5B B;  3O1I A;  4NXN T;  4X1Y E;  3FZM B;  5FL1 A;  3UU5 A;  4K0K T;  2E5V A;  4YXD A;  1HR0 T;  4PJJ A;  2YMD A;  3ZMS B;  2MOZ A;  3UU8 A;  2W0G A;  4A97 A;  4I50 E;  4OYJ A;  1IJ5 A;  4LF7 T;  5CA1 E;  3ZCJ A;  4AKL A;  2WP9 A;  4O2A E;  4HWF A;  3QNU A;  4ZHQ E;  3PUQ A;  5AQS B;  2WMO A;  2XZE A;  2F4V T;  3O9X A;  2IML A;  4JLE A;  2W00 A;  4ZEY A;  1AJ3 A;  3RKO A;  1MMN A;  4DUY T;  2H89 A;  3N9Q A;  1O3X A;  5H6Q B;  2JMH A;  3HI2 A;  2HPJ A;  3W15 B;  1YXR A;  4EOZ B;  3AED A;  3V5S A;  2A72 A;  4EIW A;  2QVA A;  3RIU A;  5EK4 A;  3PUA A;  2ZJU A;  5AFM B;  3ZEF B;  4P0B A;  3UFG A;  5LGT B;  3J9X 1;  3U8L A;  1HG2 A;  5FY7 A;  5HXH A;  2ZM0 A;  2D0U A;  3PTR B;  4YSY A;  1JNZ A;  3A5X A;  1YKE B;  4NUU A;  3IEE A;  4IL4 A;  4H63 V;  2XAG B;  3ONX A;  5ABG A;  5KE4 A;  4JUY A;  2E2A A;  2VL0 A;  4ZI3 C;  3OJA A;  3JAD A;  5AQL B;  4PW8 A;  1N36 T;  3JAE A;  4EED A;  1B7T A;  2A2F X;  2EHO C;  4BFQ A;  2CHN A;  3CPZ A;  4ALX A;  5FXZ A;  5AQM B;  1SA0 E;  5DAB A;  1E7P A;  1IZN B;  3P4R A;  4IE7 A;  5AQU B;  4MLK A;  5JRC B;  5BP0 A;  3PUZ F;  2ZM8 A;  2DWG A;  3EI0 A;  3HKD E;  2XAH B;  5EK2 A;  1KNP A;  1XDP A;  5LNK A;  2UZ6 A;  4DV4 T;  4X66 T;  5KZU A;  1UUS A;  2LSI A;  4U74 A;  2NW8 A;  2V6X A;  2KIN B;  4DUZ T;  2WNC A;  4WZX A;  2ACZ A;  1YQ3 A;  3PUV F;  4EZ4 A;  2BKN A;  2FBW A;  3Q5D A;  3WTO A;  4GK5 E;  2CLY B;  4IRE A;  4TX5 A;  4PFO A;  5JQG E;  4EEB A;  2WZH A;  1JNR A;  2CM0 A;  4ZOL E;  3EDV A;  3UUL A;  4NXM T;  1ZKE A;  2XYS A;  3UT5 E;  3ZC1 A;  4XZC A;  3P4P A;  3ZMU B;  4PK4 A;  3EAB A;  5JDQ A;  4YTP A;  2W62 A;  4DV7 T;  4QH1 A;  4ISS A;  2RPA A;  3E0Z A;  2XYT A;  1HCI A;  3MAC A;  5J5G A;  2WMN A;  4JV5 T;  4IDN A;  1WR6 A;  1WR0 A;  2GK9 A;  5TVC A;  3S4U A;  2MYS A;  2CWY A;  4IIJ E;  3OTO T;  5HWX A;  2L3L A;  1N33 T;  4DR1 T;  5LYJ E;  1ZHC A;  4ZZC A;  2SPC A;  1IBL T;  1FEW A;  3P8C D;  1HS7 A;  1YKH B;  5L3F B;  4QXB B;  1WYB A;  4HFV A;  2J1D G;  5BW2 A;  5AQQ B;  5JDH A;  2K24 A;  3A7M A;  4TWH A;  4E7S A;  3VR9 A;  1QLB A;  1XMO T;  2JIW A;  5ADX L;  3P4W A;  3Q9D A;  4YY3 T;  3EUH A;  2C5J A;  2Q9Q A;  3HR0 A;  2B1E A;  2DCF A;  4U2Z A;  4JI1 T;  1VOM A;  3RC8 A;  2XQ7 A;  5SYO A;  5ABF A;  4A5X A;  5JDN A;  4IE6 A;  4LFB T;  4G63 A;  5LJM A;  2E5L T;  2XQY A;  3ZCI A;  4TUY E;  4MHC A;  3EHZ A;  1S94 A;  1XWM A;  2KT9 A;  1W0A A;  3WTJ A;  4O4I E;  4COF A;  4UIG A;  1Z8U A;  3PUX F;  3AVR A;  2BYP A;  2V5C A;  2UXB T;  4ZS2 A;  2J47 A;  1UX4 A;  4DMW A;  2BKO A;  2CBJ A;  4AIU A;  4UEM A;  3VKH A;  3X1D A;  5KDM C;  1MMA A;  4PJN A;  5IWA T;  3LK4 2;  4YJ2 E;  2XNT A;  2W67 A;  1OXZ A;  3KV9 A;  4ZI7 E;  1D0Y A;  2Y54 A;  3N9L A;  2X9W A;  2YIN A;  3CK6 A;  3ZSS A;  3FZH B;  4Z8X A;  3F2E A;  2YU1 A;  4HFI A;  4F8H A;  1Y01 A;  2BR8 A;  2BBH A;  2RA1 A;  4HFD A;  3CIR A;  5HEG A;  3I9Y A; 
#chains in the Genus database with same CATH homology
 4HQP A;  2BR7 A;  4BQT A;  4Z91 A;  2UZ6 A;  3TLW A;  2LKG A;  4QH4 A;  4XHE A;  5BW2 A;  4TWH A;  4TNV A;  5KZU A;  4NZB A;  4DBM A;  4ZK1 A;  5HCJ A;  3RQW A;  5CFB A;  3SIO A;  5L47 A;  5HEJ A;  2BG9 A;  2WNC A;  4QAA A;  2QC1 B;  3P4W A;  5AFJ A;  3U8M A;  3SQ9 A;  3WIP A;  3ZDG A;  2XNU A;  4X5T A;  4ILA A;  1OED B;  2Y7Y A;  5AFM A;  4TWF A;  3IGQ A;  5J5F A;  4NPP A;  4AFT A;  3PMZ A;  2WNJ A;  1OED E;  2WN9 A;  2X00 D;  2YME A;  4QAC A;  3WTO A;  3WTK A;  3RIF A;  3UQ4 A;  4AFH A;  4IRE A;  2BJ0 A;  5IUX A;  2XQ7 A;  3ZKR A;  3C84 A;  5J5H A;  2XQ6 A;  5SYO A;  5JME A;  4HFE A;  4QH5 A;  4ILC A;  1UV6 A;  2BG9 B;  5HCM A;  4ZJT A;  3RI5 A;  4EZ1 A;  4TNW A;  4UM3 A;  2W8F A;  5HEU A;  4ZR6 A;  1UX2 A;  2XQA A;  2ZJU A;  2BG9 E;  4HFC A;  2BYQ A;  4QAB A;  3SH1 A;  5AFL A;  5AFM B;  5J5I A;  2XYS A;  2LM2 A;  3EAM A;  3T4M A;  4D01 A;  4HFB A;  5HEH A;  3PEO A;  3U8L A;  1UW6 A;  3WTL A;  2XZ6 A;  5AIN A;  4AFG A;  2Y58 A;  2MAW A;  3WTI A;  2Y57 A;  3EHZ A;  3U8N A;  2M6I A;  4WV9 A;  5AFN A;  4XK9 A;  2XQ4 A;  3UQ7 A;  4PIR A;  4UXU A;  4Z90 A;  3WTJ A;  4UY2 A;  4COF A;  4UM3 S;  4ZRU A;  3UU5 A;  4QH1 A;  4LMK A;  2C9T A;  4IL4 A;  2BYP A;  3WTN A;  2XQ8 A;  3RQU A;  5KE4 A;  2LKH A;  5J0Z A;  4B5D A;  3WTH A;  2YMD A;  2XYT A;  2VL0 A;  3UUB A;  2BYS A;  2Y56 A;  4ILB A;  5HEO A;  2M6B A;  4LML A;  5LG3 A;  2BYR A;  2XZ5 A;  2XNV A;  2X00 A;  5J5G A;  3TLV A;  3JAD A;  3UU8 A;  3UU3 A;  4IL9 A;  4ZZB A;  2WNL A;  4ZK4 A;  3ZDH A;  3JAE A;  2PGZ A;  5AFH A;  5AFK A;  4A97 A;  5CO5 A;  3LSV A;  5TVC A;  3SQ6 A;  2XNT A;  3WTM A;  4UM1 A;  3P50 A;  4BFQ A;  3TLU A;  3U8J A;  3GUA A;  3RIA A;  4ALX A;  2W8G A;  3U8K A;  2Y54 A;  2WZY A;  2XQ9 A;  2YN6 A;  3TLT A;  3RHW A;  1OED C;  4LMJ A;  2YOE A;  3UU6 A;  1I9B A;  3TLS A;  5L4H A;  4ZZC A;  5FJV A;  4ZJS A;  2XQ3 A;  5BP0 A;  4A98 A;  2PH9 A;  2BYN A;  4HFH A;  4HFI A;  4TWD A;  5LXB A;  4UM3 P;  3EI0 A;  4F8H A;  2LLY A;  2ZJV A;  2KSR A;  2BR8 A;  2XQ5 A;  2YKS A;  5BRX A;  3JAF A;  4HFD A;  3UU4 A;  4FRR A;  5HEG A;  1OED A;  2BG9 C;  3C79 A;  5L4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...