4HFBA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant (apo)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfbA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfbA01
3U8KA 4EZ1A 4QABA 3TLWA 3RIFA 5CFBA 2XNTA 2XQAA 5AFKA 3TLUA 5KZUA 4HFIA 2YMDA 4IREA 3TLVA 1I9BA 3LSVA 4TNVA 4UY2A 3SH1A 3U8MA 4AFTA 5AFMA 5AFMB 2XZ5A 1UV6A 2WZYA 4LMKA 3SIOA 5AFLA 4BFQA 2C9TA 2M6BA 4NPPA 2BG9A 3RHWA 2XQ4A 2W8FA 4QACA 2BG9B 4ILCA 2YKSA 2XNUA 3SQ9A 5AFHA 2XQ3A 1OEDE 3UU5A 2QC1B 2WN9A 4FRRA 4ZZCA 2Y58A 3UU3A 2WNJA 4WV9A 5HEUA 4LMJA 5SYOA 1OEDB 2BYSA 4ZK1A 1OEDC 2LKGA 4HQPA 3JAFA 2Y56A 3RIAA 2KSRA 2Y57A 3IGQA 5LXBA 3U8JA 4DBMA 5J5IA 3UU6A 4TNWA 4QH5A 5HEHA 4UXUA 2WNCA 2UZ6A 2XQ7A 3WTJA 3ZDGA 3C79A 2X00A 3JAEA 4UM3S 3P4WA 3WTNA 4TWHA 3WTLA 5BP0A 4HFHA 4HFDA 4B5DA 5J0ZA 4ZK4A 3ZKRA 4LMLA 5HCMA 3TLSA 4PIRA 4ALXA 3C84A 5L47A 4TWDA 4A98A 3RI5A 3UQ7A 3SQ6A 2YMEA 3WTHA 2XZ6A 5AFNA 5BW2A 4ZJSA 4AFGA 3U8NA 5J5HA 5IUXA 3WTIA 2MAWA 2Y7YA 4AFHA 3EHZA 5HEGA 2PH9A 2WNLA 1UW6A 2LLYA 5TVCA 2XNVA 3TLTA 2YOEA 4IL9A 3RQWA 4A97A 2XYTA 2BYPA 4QH4A 5J5FA 4D01A 4TWFA 2XQ5A 4F8HA 5L4HA 4ZZBA 4BQTA 3RQUA 4XHEA 4QAAA 4UM1A 2ZJUA 5HEJA 3GUAA 3UQ4A 2W8GA 2XQ9A 2BJ0A 5AFJA 4Z90A 4ZRUA 5CO5A 2XQ6A 5HEOA 5HCJA 3WTKA 2BYRA 3P50A 5FJVA 2BYQA 3ZDHA 2LKHA 2PGZA 4ZJTA 4IL4A 2BYNA 4ILBA 5JMEA 5LG3A 5L4EA 2VL0A 3WTOA 2YN6A 2BG9C 4Z91A 3T4MA 4UM3A 2ZJVA 5BRXA 2Y54A 3UU4A 2LM2A 2BG9E 4COFA 2XYSA 4ILAA 2M6IA 4HFBA 3JADA 2XQ8A 5KE4A 2BR7A 4NZBA 2X00D 4X5TA 4HFCA 3UU8A 3EAMA 3EI0A 1UX2A 3PEOA 3U8LA 4ZR6A 1OEDA 5J5GA 4HFEA 3PMZA 4UM3P 4XK9A 5AINA 2BR8A 3WTMA 3UUBA 3WIPA 4QH1A
chains in the Genus database with same CATH superfamily
3AA0B 5CFBA 5JQGE 5AFKA 3UULA 3E08A 4IREA 4UY2A 4AFTA 3SIOA 1UV6A 1MMAA 1UX4A 3RX6A 5FNVE 4CQIA 4YTNA 4CXYA 4TUYE 3JC6C 4ANJA 5ABEA 1D0XA 4LMJA 1OEDB 4NIQA 4H9OC 4H63V 2X66A 2XQ7A 1KEYA 3WTNA 3ZSTA 2G0UA 2MOZA 1YQ3A 3AXJB 4IDZA 4K0UA 2ZM0A 4CXXA 4M1PA 2W66A 3WTIA 2MAWA 3H3MA 5FKYA 3TLTA 3AEAA 1D0ZA 3CPZA 5LG4A 3AEFA 5J5FA 5HWYA 2RA1A 2JMHA 2V1DB 2CLYC 2ES0A 3RQUA 2DCFA 2XQ9A 3NVOA 4Z90A 4JI8T 4IDNA 4QWNB 2CEAA 4GK0E 1I6ZA 5FXZA 1JNZA 2XPKA 1HNXT 1SA0E 2BG9C 3KBUA 3CWZB 2ZJVA 2HPJA 3FZLB 4DR1T 4MHCA 4AQFA 3KBTA 1H7CA 3KV6A 1UX2A 2F4VT 4DUZT 2WAUA 2LSGA 3TLWA 2YMDA 3NZPA 4XZCA 4ILCA 3UU5A 3UU3A 5JDLA 4NUVA 3UUMA 2UUAT 4ZEYA 3RIAA 1E1HB 5AQHB 2V5DA 4QH5A 5DJQC 3HKEE 3OYXA 4PK5A 3LDQB 3RKGA 3WI3A 4YHHT 4HFDA 4CI3B 2W61A 5J0ZA 4PJMA 4G2AA 3QNUA 4ZI3C 4ZK4A 1UGOA 2FBWA 4L9IA 3CMLA 5L47A 3SQ6A 3O1JA 4NXNT 2KWIB 2OLTA 1YXRA 5IUXA 4DV3T 2UXBT 3IF8B 2LHRA 2WNLA 5JDMA 3ZYKA 2UXXB 4JI2T 3F31A 1XDOA 2J47A 2WS3A 3GUAA 1IZNB 5L3DB 2BJ0A 5FP3A 3UUXB 3WTKA 5AQGB 2WM9A 2Q9QC 1HS7A 5L3EB 3ZDHA 2VWAA 4UEMA 4DV4T 4U74A 3MK7C 4DR2T 1W09A 4MBQA 2M6IA 2QA7A 3PEOA 1HTJF 3CQXC 2X0HA 2UU9T 3PMZA 4HEAA 2BR8A 3K3QC 2QRXA 4HFVA 3IHRA 2XSAA 2BZBA 3RIFA 3DP7A 2WU2A 2LE8A 1LVFA 5AFMA 3OYZA 5HWXA 5AFLA 4DIDB 3FXEB 4L0RA 2BG9A 3Q5DA 2LSIA 1N34T 5AFUL 2WNJA 2NTXA 3ZLIA 5HEHA 2HN1A 4XAXB 3PUAA 5ADXL 3LFMA 2XASB 3NBXX 3EDVA 4HWIB 5L3FB 4ALXA 2YDQA 3PUQA 2YDRA 3UQ7A 4O2AE 2YMEA 3AVSA 3IBPA 3AEEA 4ISSA 5C2TA 2LSKA 4DMWA 4JI4T 2BVMA 2IC6A 2MTQA 4ZI7E 2PTFA 2K24A 3I0QA 1ZKEA 3HI2A 1HNZT 2EHOA 2VKOA 4OFZA 4LF8T 3O9XA 1BR0A 2VVNA 1HX8A 4IL4A 4DR6T 2ZMAA 4I4TE 5JRCA 4P09A 4JI7T 3T4MA 4QX7B 4GYSA 5JTGA 5LMUT 4EIWA 3LJCA 3T1YT 1WR0A 3ZMUB 3NRXA 4HTEA 5F3JA 2JRKA 4I55E 1JNRA 3MJXA 3TLVA 1OXZA 4AQYT 1XNRT 4YJ2E 4IE4A 2KINB 3B13A 1XMQT 2Y58A 5HXCA 5AQIB 2XM2A 5ETWA 2BDEA 1LRZA 3P4SA 2SPCA 3K1SA 5LXBA 5FXWA 4DBMA 2FJDA 3GMIA 2A2FX 2J4GA 2HN2A 3GA8A 3C79A 5ABFB 4G63A 5LHIB 4JUYA 4TWHA 3J7Yq 2W63A 2DWGA 3OBVE 2V6XA 5KX5E 2ZLYA 3AXJA 4V1Av 4DBRA 3QB5K 4YSXA 3V5SA 3WAKA 3RQWA 2CXLA 5KMGP 1KNRA 3RF1A 4HGAA 4QXBB 3A7MA 3C4WA 5HXEA 1IAPA 3V5UA 4QKNA 2IDOB 3RC3A 4ZS2A 2NP9A 4O8SA 2DI4A 5CGMA 1LVKA 1VCSA 2WWUA 3RH3A 4DBQA 3LBXA 5JR9C 2JPFA 1YKHB 1ZP0A 4ILAA 1E2AA 3N9MA 2Z6EA 2M67A 3C50A 3VRBA 5FXVA 5C8YE 4ZR6A 5J5GA 2VL8A 3PUGA 1ZV4X 3WTMA 4CN4A 4EV6A 2XZEA 2JQKA 3CVRA 3N9NA 5LMNT 1W0AA 3H37A 2JMKA 2HH7A 2XAFB 3CX6B 5FVKA 1IJ5A 2XQ3A 5IHYA 2E2AA 3PU3A 5L3GB 1WYBA 3T1HT 3IGQA 2B1EA 5AQOB 1WRDA 4YT0A 1O3XA 3EABA 4KP3C 2XHEB 1MIVA 4HFHA 2KNDA 3TLSA 2NTYA 2V6YA 3C84A 4UV8B 3AB3B 4JI0T 4IGUA 2EHOB 4AQFC 3VR8A 2H3RA 4ILUA 2E9XA 3A5XA 3M3ZB 4UM1A 4UIGA 4JEHB 4ASKA 3AE8A 3CQCB 2HHHT 3ZCIA 3PDYA 2YU2A 1T98A 5CJ5A 3NRYA 3ONXA 3ZN1B 3FB2A 2CM0A 3FZFB 1D0YA 2CXDA 4CN1A 4YJ3E 4I50E 3VHLA 2DL1A 5AQQB 4HFBA 1QSDA 2BR7A 5J1GA 3KV9A 1UK5A 1ZEEA 1D1CA 4KX6A 4LF9T 4J2CA 4K0KT 5HXSA 2A9UA 3U8MA 1M7KA 3P4RA 1I9BA 1S35A 4BFQA 3MXZA 2C9TA 3SFDA 2M6BA 3ZEFB 3RHWA 1Z0PA 2Y8DA 4GYRA 4EEDA 3ABVA 2V8SV 2ZM2A 3EUHA 3EDUA 3L3PA 5HXRA 2CRBA 1IBLT 4PJNA 3J9X1 2Y48B 3K3OA 2JQHA 1J5ET 4UM3S 3ZKRA 1BR1A 5HCMA 2W4XA 4HWCA 3FHNA 4A98A 5J5HA 5H6QB 4ZHQE 4AFHA 5AQPB 3FZKB 3HKBE 3DTOA 4A56A 5LYJE 2XNVA 4DR3T 5F8PA 4TWFA 2XQ5A 5L4HA 4DV5T 3C64A 5C3JA 5HEOA 2I6HA 2MYSA 3ZPOA 4ZI3D 2LT3A 1HCIA 5LG3A 5F5WA 5L4EA 2CHOA 2Y54A 3NZQA 3L39A 4U7IA 3SOLA 4PNIA 3FXDB 2IMLA 3UU8A 2XSBA 5BR8T 3SFEA 4PK4A 2IW5B 5M4YA 4U2ZA 2BS2A 2X51A 2E5LT 4DV0T 1MIYA 4YSYA 5FY0A 1N33T 2Q9QB 2Q9QD 4LF4T 2WDVA 3RKOA 5FY7A 3CX8B 1MMNA 2CA5A 3P7IA 2CCQA 4UV9B 5IWAT 3PJAJ 4HWDA 1N36T 3WTJA 4OK0A 4H9PC 3RYIE 4QX8B 4WZXA 2PFVA 2E8IA 4OX9T 1SE7A 2EHOC 4TV9E 3VR9A 1WCRA 4TWDA 5BW2A 3HL6A 2WMOA 4YHJA 3I9YA 4PK6A 1UW6A 5A1LA 3RYCE 4AXPA 4X64T 2NW8A 5LCYA 5CB4E 2V7JA 2V6YB 3PUSA 3ZCJA 4ADZA 5CO5A 2V5CA 5HCJA 1B7TA 4OYKA 2H88A 1WFDA 4O4IE 4EZ4A 2QGSA 1V9DA 3WTOA 5BRXA 4UF0B 1S94A 3MZKB 2X68A 4KHPT 4GK5E 2UXDT 4XK9A 2XAHB 1X9BA 3RLFF 5IYZE 2VVSA 5LA6E 4H9RC 3F2EA 2E9XD 5EZYE 2XNUA 2ACXA 4I43B 2W0GA 3JCFA 5J2TE 2WY2A 4GIWA 3N9OA 4H9SE 3FBZA 4IE0A 1EZ3A 2Y56A 5DABA 4QXHB 4AKIA 2FJBA 2X9WA 3ZMTB 3IA3A 4PIRA 3L09A 1YD8G 3RI5A 3UT5E 3ZC0A 1FIOA 3C4ZA 1G73A 2CPTA 4B3ST 2NW7A 2OV9A 3HKDE 3MACA 4YXDA 3AEDA 1UURA 4H9QC 4AKRB 2CXFA 2LEHA 3AE4A 4D01A 3VU7H 1UX5A 1ZHCA 3CQGB 4IHJE 5AFJA 1D1BA 3AAEB 4AKGA 4PJJA 4UR9A 4JEUB 3K3NA 3GN5B 4U33A 5L3CB 2KLQA 5FMNA 3BQIA 5JMEA 1T72A 2YK0A 5JRCB 3UFGA 2Y6XA 2WZHA 2LM9A 4EYUA 5HAXA 3AE6A 2C5JA 3M65A 5LBMA 2W00A 1U4QA 1L0VA 2VURA 3OPCA 3UUBA 3KV5A 5TAOA 3O1IA 4B3RT 4QABA 3GWHA 5LOVE 2W67A 4JI1T 3RRWA 2V7LA 1BR2A 2CE7A 3S4UA 1MIWA 5DQWA 5LHHB 1CHUA 1OWAA 1HFAA 2I0MA 2WDQA 1VCTA 3P8CD 4AISA 4U72A 3JAFA 1X79A 2D0UA 4HE8A 2JQ9A 2FJAA 2RP4A 5JREA 2KMFA 4P1NA 1KNPA 3N9QA 1T7SA 2DHRA 2WZIA 4ZXLA 2UUCT 3QK6A 2BKNA 3ANWA 1UCUA 4TX5A 2XAJB 2VKJA 2YOEA 2XYTA 4DV1T 2YINA 4PW8A 3LK42 5JDGA 5AQMB 4B6XA 5LGUB 4ZS3A 1M62A 4QHOA 4QXCB 3H3AA 3P50A 5FJVA 1US7B 4LF6T 4ZJTA 3EVYA 3N2OA 2HPLA 3GN5A 3A8YC 4HN9A 4TN7B 1Y64B 4EXTA 4Z91A 4UM3A 2CWOA 4XBFB 3RGLA 2NW9A 2AXDS 5EK2A 1E7PA 2BKOA 3QOFA 3UUNA 3Q5WA 2B76A 3KVAA 4BJMA 5LBQB 3TLUA 5KZUA 3AA1B 3NKZA 2BKPA 2VK9A 2OA5A 3ZMSB 5ABFA 3G06A 4QACA 3SQ9A 2QC1B 1OEDE 5AQKB 2NWBA 4FRRA 2RPAA 3AE2A 3MKDA 2J62A 2XY8B 5SYOA 1OEDC 3FBLA 3KDSE 5AQRB 3U8JA 2MPKA 3UU6A 1YQ4A 3ETUA 4TNWA 1DU2A 3F57A 3Q9DA 2ODUA 3JAEA 3P4WA 2P9BA 4KHZF 3HA4A 2D9DA 1XMOT 4YLHA 2DNXA 3AE7A 5FY1A 3RRCA 3ZMVB 2YEVC 2A72A 3ETVA 4CN6A 2CWYA 2KZ7B 2Y7YA 4DO0A 4I0UA 4B3MT 3AA7B 4BJNA 5JDNA 4IE5A 5KDMC 2V7MA 2WSSV 4ERRA 2X9YA 5JR9B 4LF5T 4LFAT 5HEJA 3UQ4A 4EYYR 4ZRUA 4CI2B 2XQ6A 2K5BB 2NOXA 3DJBA 4C91A 3D0TA 3QUJA 4BA9A 4UELA 1KNZA 1FMWA 4ILBA 3AE9A 5BMVE 2V26A 4X20E 3BQLA 2WU5A 3E0ZA 5KE4A 4X5TA 3PUZF 2N2NA 3CIRA 4UM3P 3AA6B 2X0YA 4O4HE 4QH1A 3PE0A 4H9NC 4MLKA 1IBMT 2XNTA 2VASA 3QC9A 4HFIA 1VOMA 3LSVA 2YU1A 4HWHA 2WCAA 4YSZA 3BK9A 2WZYA 2NR4A 3PJAA 2WN9A 4ZI2C 2E5VA 4ZZCA 3Q5EA 4O2BE 5LHGB 3ZT6A 4GOUA 3ANWB 5FXXA 1KK7A 2E9XC 4U3CA 4WBOA 2LOSA 5H6RB 3PUWF 2XM1A 3K8PC 2WNCA 1XDPA 3ZDGA 4UXNB 3Q5XA 4IE7A 3PU8A 2K48A 3PUYF 3ZT5A 4KI0F 3N5LA 4KBMB 4ZOLE 4AFGA 3AAAB 4HWFA 4EEBA 2X9HA 5TVCA 3RIUA 2BBHA 4A97A 4X66T 4Q25A 3LK2B 5HYAA 2XUEA 3AECA 3C4XA 5AQNB 2C5IT 4EB6E 2PGZA 3ESLA 2BYNA 4TV8E 5EK4A 4DR4T 1U5PA 3UFEA 2BG9E 2WMNA 2XYSA 1XWMA 1WR6A 3JADA 1D1AA 4UVCB 2PBIA 3Q2MA 1NAFA 4TNVA 5AFMB 2XZ5A 1LKXA 4MALA 5KXJA 4NPPA 2XQ4A 2BG9B 5DQVA 4WBNE 4IDOA 2BYSA 5E0OA 1J1JA 1R8IA 5LNKA 5CA0E 2KSRA 3N9LA 4UVAB 1W9RA 1SUMB 4GKJT 2UZ6A 2X00A 1Z8UA 3WTLA 3OJAA 5BP0A 4B5DA 3VRAA 2LHNA 4N78D 1BR4A 5JDFA 3AAIA 4U31A 2VQET 1FJGT 2XZ6A 4ZJSA 3U8NA 3NWIA 1SHZC 2LLYA 2IHR1 1MMGA 4IL9A 1QUUA 4NUUA 2WWVA 5ABGA 4BQTA 1KFYA 5AQSB 5AQFB 2W8GA 4DV6T 3I1AA 3VKHA 4IE6A 4L5GA 1T8BA 5LB7B 4IDQA 4P0AA 4IDPA 5ABHA 2FUPA 2VKDA 4LFBT 1KF6A 1YKEB 2WBLA 3QB5A 4A5XA 2XAGB 5LJNA 2YDSA 4UF0A 4E7SA 3HKCE 3HR0A 3RIUC 4CI1B 1WYCA 2X00D 3R84B 1W0BA 4AKHA 5LGTB 4PJLA 3B57A 3U8KA 3ONJA 1CUNA 2IAKA 4JI5T 2EHOD 2CHNA 3SH1A 5HXHA 2DWKA 3E22E 3OTOT 3N2GE 2WDRA 2X9XA 3I9WA 2LOPA 4ZK1A 1UUSA 2XQYA 4X1IE 2MBGA 2LRLA 4YTMA 4JBWF 3RYFE 4IIJE 3KINB 1NENA 2CMRA 3C51A 4YTPA 3RPUA 4OHFA 4X1KE 1FMVA 5FYMA 3ONLC 4FI5A 2L9QA 1GQEA 4EGWA 4DNDA 5FVLA 2JIWA 3KVBA 3EHZA 5HEGA 2BYPA 2K9AA 4F8HA 2KWHA 1HNWT 2QVAA 2VQFT 3B5MA 4UVBB 2LRKA 3SS1A 4Z8XA 2BYRA 4DV2T 1ZOYA 2BVLA 2LKHA 4JYAT 1MNDA 2UUBT 4DMVA 2VL0A 5JDHA 2N1GA 3UU4A 2V7KA 3WIPA 2K3WA 4AIUA 4EZ1A 4BAYB 2KXPB 5EK3A 1IBKT 5FL1A 4U2YA 5AFHA 1VRBA 1Y01A 2CLYB 1HR0T 4X1YE 2J1DG 2WB5A 4WV9A 3P4QA 4AI6A 2XAQB 1N32T 2LKGA 3W15B 3ZYLA 3OKQA 2VKHA 4O4LE 3AE3A 5LXTE 3SWHA 4P0BA 2UXNB 4F6RC 1HG2A 3PUXF 2XJ7A 3MA9A 1MMDA 4X65T 5CA1E 4HKAA 4EZHA 2VB6A 5AFNA 2D0TA 4DUYT 3OVUA 2PH9A 3ZYMA 3AEGA 3PURA 2D5UA 2A3DA 2IIUA 2JQQA 2W62A 2ZJUA 3CK6A 2IC9A 2QYWA 1IJ6A 3U78A 5LP6E 2CBIA 3UTKA 2PJQA 4O4JE 2LM2A 4U7YA 2XQ8A 2N9DA 3EI0A 3O4XE 3U8LA 4CXWA 1OEDA 4HFEA 5AINA 4AKLA 2H7VC 2R6GF 5L3BB 2WQYA 4PAGA 4X62T 3LBXB 3LG7A 2BBJA 2W8FA 3O1HA 4WNKA 1MNEA 3U3IA 3RC8A 3ZSSA 2AE9A 5AQLB 2Y57A 1HX1B 2UXCT 4UXUA 2L3LA 3WAJA 2W2UA 2IUBA 2C0SA 1I94T 1WLXA 4LMLA 4EOZB 2BS3A 1HG5A 3KV4A 4LFCT 1YW0A 2PG8A 1XNQT 3T8OA 2LSJA 2FJEA 3PV0F 4QH4A 5JR9A 5GONE 3X1DA 1G8XA 2ODVA 4YFSA 4QAAA 4H63H 2LSYA 2GK9A 5FL0A 4B3TT 2ACZA 2XTLA 3N9PA 2BYQA 4DV7T 1J5WA 3CX7B 4EAHA 5JH7E 2E9XB 3ZT7A 1HF8A 3TKLB 4NXMT 4KMCA 4COFA 3PTRB 4MFRA 3L8RA 4FJOA 5AQTB 4HFCA 2ZM8A 3AEBA 2L8KA 3ZN0B 5LJMA 2WP9A 2BS4A 5AQUB 4WW0A 2X67A 4ZI2D 3RYHE 2XQAA 2ZM6T 4LMKA 2C5KT 2Q9QA 2YKSA 4ISTA 5JDQA 3N2KE 3LK3B 3R6NA 2JJ9A 3CKDA 3KFWX 4CZZB 5HEUA 4DR7T 3ZJ2A 4HQPA 4C90A 1QLBA 4PFPA 5AQVB 5J5IA 4JI3T 3ZC1A 3ZMZB 4WYVA 1NEKA 3ZJ1A 1NWMX 2CBJA 3AE1A 4JV5T 4PFOA 3IEEA 4YY3T 4JLEA 3C98B 4LF7T 5L2LA 3WTHA 4AQGA 4GKKT 3SRZA 2KT9A 4TZ4C 3I0OA 4KUMB 3FZMB 3VKGA 2H89A 4IT4A 5AQJB 5JVDE 2D2SA 4ZZBA 2DLRA 4XHEA 2I59A 2X0LB 1XZYA 5J2UE 5LGNB 2H7OA 3AE5A 4OYJA 2LJLA 3JC6D 4JI6T 2V7IA 2YN6A 3PUVF 4E7ZA 3FZHB 3AVRA 4NZBA 3EAMA 3P4PA 4DR5T 4DVDA 3BQKA 1AJ3A 1FEWA
chains in the Genus database with same CATH topology
3U8KA 4EZ1A 4QABA 3TLWA 3RIFA 5CFBA 2XNTA 2XQAA 5AFKA 3TLUA 5KZUA 4HFIA 2YMDA 4IREA 3TLVA 1I9BA 3LSVA 4TNVA 4UY2A 3SH1A 3U8MA 4AFTA 5AFMA 5AFMB 2XZ5A 1UV6A 2WZYA 4LMKA 3SIOA 5AFLA 4BFQA 2C9TA 2M6BA 4NPPA 2BG9A 3RHWA 2XQ4A 2W8FA 4QACA 2BG9B 4ILCA 2YKSA 2XNUA 3SQ9A 5AFHA 2XQ3A 1OEDE 3UU5A 2QC1B 2WN9A 4FRRA 4ZZCA 2Y58A 3UU3A 2WNJA 4WV9A 5HEUA 4LMJA 5SYOA 1OEDB 2BYSA 4ZK1A 1OEDC 2LKGA 4HQPA 3JAFA 2Y56A 3RIAA 2KSRA 2Y57A 3IGQA 5LXBA 3U8JA 4DBMA 5J5IA 3UU6A 4TNWA 4QH5A 5HEHA 4UXUA 2WNCA 2UZ6A 2XQ7A 3WTJA 3ZDGA 3C79A 2X00A 3JAEA 4UM3S 3P4WA 3WTNA 4TWHA 3WTLA 5BP0A 4HFHA 4HFDA 4B5DA 5J0ZA 4ZK4A 3ZKRA 4LMLA 5HCMA 3TLSA 4PIRA 4ALXA 3C84A 5L47A 4TWDA 4A98A 3RI5A 3UQ7A 3SQ6A 2YMEA 3WTHA 2XZ6A 5AFNA 5BW2A 4ZJSA 4AFGA 3U8NA 5J5HA 5IUXA 3WTIA 2MAWA 2Y7YA 4AFHA 3EHZA 5HEGA 2PH9A 2WNLA 1UW6A 2LLYA 5TVCA 2XNVA 3TLTA 2YOEA 4IL9A 3RQWA 4A97A 2XYTA 2BYPA 4QH4A 5J5FA 4D01A 4TWFA 2XQ5A 4F8HA 5L4HA 4ZZBA 4BQTA 3RQUA 4XHEA 4QAAA 4UM1A 2ZJUA 5HEJA 3GUAA 3UQ4A 2W8GA 2XQ9A 2BJ0A 5AFJA 4Z90A 4ZRUA 5CO5A 2XQ6A 5HEOA 5HCJA 3WTKA 2BYRA 3P50A 5FJVA 2BYQA 3ZDHA 2LKHA 2PGZA 4ZJTA 4IL4A 2BYNA 4ILBA 5JMEA 5LG3A 5L4EA 2VL0A 3WTOA 2YN6A 2BG9C 4Z91A 3T4MA 4UM3A 2ZJVA 5BRXA 2Y54A 3UU4A 2LM2A 2BG9E 4COFA 2XYSA 4ILAA 2M6IA 4HFBA 3JADA 2XQ8A 5KE4A 2BR7A 4NZBA 2X00D 4X5TA 4HFCA 3UU8A 3EAMA 3EI0A 1UX2A 3PEOA 3U8LA 4ZR6A 1OEDA 5J5GA 4HFEA 3PMZA 4UM3P 4XK9A 5AINA 2BR8A 3WTMA 3UUBA 3WIPA 4QH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8K A;  4EZ1 A;  4QAB A;  3TLW A;  3RIF A;  5CFB A;  2XNT A;  2XQA A;  5AFK A;  3TLU A;  5KZU A;  4HFI A;  2YMD A;  4IRE A;  3TLV A;  1I9B A;  3LSV A;  4TNV A;  4UY2 A;  3SH1 A;  3U8M A;  4AFT A;  5AFM A;  5AFM B;  2XZ5 A;  1UV6 A;  2WZY A;  4LMK A;  3SIO A;  5AFL A;  4BFQ A;  2C9T A;  2M6B A;  4NPP A;  2BG9 A;  3RHW A;  2XQ4 A;  2W8F A;  4QAC A;  2BG9 B;  4ILC A;  2YKS A;  2XNU A;  3SQ9 A;  5AFH A;  2XQ3 A;  1OED E;  3UU5 A;  2QC1 B;  2WN9 A;  4FRR A;  4ZZC A;  2Y58 A;  3UU3 A;  2WNJ A;  4WV9 A;  5HEU A;  4LMJ A;  5SYO A;  1OED B;  2BYS A;  4ZK1 A;  1OED C;  2LKG A;  4HQP A;  3JAF A;  2Y56 A;  3RIA A;  2KSR A;  2Y57 A;  3IGQ A;  5LXB A;  3U8J A;  4DBM A;  5J5I A;  3UU6 A;  4TNW A;  4QH5 A;  5HEH A;  4UXU A;  2WNC A;  2UZ6 A;  2XQ7 A;  3WTJ A;  3ZDG A;  3C79 A;  2X00 A;  3JAE A;  4UM3 S;  3P4W A;  3WTN A;  4TWH A;  3WTL A;  5BP0 A;  4HFH A;  4HFD A;  4B5D A;  5J0Z A;  4ZK4 A;  3ZKR A;  4LML A;  5HCM A;  3TLS A;  4PIR A;  4ALX A;  3C84 A;  5L47 A;  4TWD A;  4A98 A;  3RI5 A;  3UQ7 A;  3SQ6 A;  2YME A;  3WTH A;  2XZ6 A;  5AFN A;  5BW2 A;  4ZJS A;  4AFG A;  3U8N A;  5J5H A;  5IUX A;  3WTI A;  2MAW A;  2Y7Y A;  4AFH A;  3EHZ A;  5HEG A;  2PH9 A;  2WNL A;  1UW6 A;  2LLY A;  5TVC A;  2XNV A;  3TLT A;  2YOE A;  4IL9 A;  3RQW A;  4A97 A;  2XYT A;  2BYP A;  4QH4 A;  5J5F A;  4D01 A;  4TWF A;  2XQ5 A;  4F8H A;  5L4H A;  4ZZB A;  4BQT A;  3RQU A;  4XHE A;  4QAA A;  4UM1 A;  2ZJU A;  5HEJ A;  3GUA A;  3UQ4 A;  2W8G A;  2XQ9 A;  2BJ0 A;  5AFJ A;  4Z90 A;  4ZRU A;  5CO5 A;  2XQ6 A;  5HEO A;  5HCJ A;  3WTK A;  2BYR A;  3P50 A;  5FJV A;  2BYQ A;  3ZDH A;  2LKH A;  2PGZ A;  4ZJT A;  4IL4 A;  2BYN A;  4ILB A;  5JME A;  5LG3 A;  5L4E A;  2VL0 A;  3WTO A;  2YN6 A;  2BG9 C;  4Z91 A;  3T4M A;  4UM3 A;  2ZJV A;  5BRX A;  2Y54 A;  3UU4 A;  2LM2 A;  2BG9 E;  4COF A;  2XYS A;  4ILA A;  2M6I A;  4HFB A;  3JAD A;  2XQ8 A;  5KE4 A;  2BR7 A;  4NZB A;  2X00 D;  4X5T A;  4HFC A;  3UU8 A;  3EAM A;  3EI0 A;  1UX2 A;  3PEO A;  3U8L A;  4ZR6 A;  1OED A;  5J5G A;  4HFE A;  3PMZ A;  4UM3 P;  4XK9 A;  5AIN A;  2BR8 A;  3WTM A;  3UUB A;  3WIP A;  4QH1 A; 
#chains in the Genus database with same CATH topology
 3AA0 B;  5CFB A;  5JQG E;  5AFK A;  3UUL A;  3E08 A;  4IRE A;  4UY2 A;  4AFT A;  3SIO A;  1UV6 A;  1MMA A;  1UX4 A;  3RX6 A;  5FNV E;  4CQI A;  4YTN A;  4CXY A;  4TUY E;  3JC6 C;  4ANJ A;  5ABE A;  1D0X A;  4LMJ A;  1OED B;  4NIQ A;  4H9O C;  4H63 V;  2X66 A;  2XQ7 A;  1KEY A;  3WTN A;  3ZST A;  2G0U A;  2MOZ A;  1YQ3 A;  3AXJ B;  4IDZ A;  4K0U A;  2ZM0 A;  4CXX A;  4M1P A;  2W66 A;  3WTI A;  2MAW A;  3H3M A;  5FKY A;  3TLT A;  3AEA A;  1D0Z A;  3CPZ A;  5LG4 A;  3AEF A;  5J5F A;  5HWY A;  2RA1 A;  2JMH A;  2V1D B;  2CLY C;  2ES0 A;  3RQU A;  2DCF A;  2XQ9 A;  3NVO A;  4Z90 A;  4JI8 T;  4IDN A;  4QWN B;  2CEA A;  4GK0 E;  1I6Z A;  5FXZ A;  1JNZ A;  2XPK A;  1HNX T;  1SA0 E;  2BG9 C;  3KBU A;  3CWZ B;  2ZJV A;  2HPJ A;  3FZL B;  4DR1 T;  4MHC A;  4AQF A;  3KBT A;  1H7C A;  3KV6 A;  1UX2 A;  2F4V T;  4DUZ T;  2WAU A;  2LSG A;  3TLW A;  2YMD A;  3NZP A;  4XZC A;  4ILC A;  3UU5 A;  3UU3 A;  5JDL A;  4NUV A;  3UUM A;  2UUA T;  4ZEY A;  3RIA A;  1E1H B;  5AQH B;  2V5D A;  4QH5 A;  5DJQ C;  3HKE E;  3OYX A;  4PK5 A;  3LDQ B;  3RKG A;  3WI3 A;  4YHH T;  4HFD A;  4CI3 B;  2W61 A;  5J0Z A;  4PJM A;  4G2A A;  3QNU A;  4ZI3 C;  4ZK4 A;  1UGO A;  2FBW A;  4L9I A;  3CML A;  5L47 A;  3SQ6 A;  3O1J A;  4NXN T;  2KWI B;  2OLT A;  1YXR A;  5IUX A;  4DV3 T;  2UXB T;  3IF8 B;  2LHR A;  2WNL A;  5JDM A;  3ZYK A;  2UXX B;  4JI2 T;  3F31 A;  1XDO A;  2J47 A;  2WS3 A;  3GUA A;  1IZN B;  5L3D B;  2BJ0 A;  5FP3 A;  3UUX B;  3WTK A;  5AQG B;  2WM9 A;  2Q9Q C;  1HS7 A;  5L3E B;  3ZDH A;  2VWA A;  4UEM A;  4DV4 T;  4U74 A;  3MK7 C;  4DR2 T;  1W09 A;  4MBQ A;  2M6I A;  2QA7 A;  3PEO A;  1HTJ F;  3CQX C;  2X0H A;  2UU9 T;  3PMZ A;  4HEA A;  2BR8 A;  3K3Q C;  2QRX A;  4HFV A;  3IHR A;  2XSA A;  2BZB A;  3RIF A;  3DP7 A;  2WU2 A;  2LE8 A;  1LVF A;  5AFM A;  3OYZ A;  5HWX A;  5AFL A;  4DID B;  3FXE B;  4L0R A;  2BG9 A;  3Q5D A;  2LSI A;  1N34 T;  5AFU L;  2WNJ A;  2NTX A;  3ZLI A;  5HEH A;  2HN1 A;  4XAX B;  3PUA A;  5ADX L;  3LFM A;  2XAS B;  3NBX X;  3EDV A;  4HWI B;  5L3F B;  4ALX A;  2YDQ A;  3PUQ A;  2YDR A;  3UQ7 A;  4O2A E;  2YME A;  3AVS A;  3IBP A;  3AEE A;  4ISS A;  5C2T A;  2LSK A;  4DMW A;  4JI4 T;  2BVM A;  2IC6 A;  2MTQ A;  4ZI7 E;  2PTF A;  2K24 A;  3I0Q A;  1ZKE A;  3HI2 A;  1HNZ T;  2EHO A;  2VKO A;  4OFZ A;  4LF8 T;  3O9X A;  1BR0 A;  2VVN A;  1HX8 A;  4IL4 A;  4DR6 T;  2ZMA A;  4I4T E;  5JRC A;  4P09 A;  4JI7 T;  3T4M A;  4QX7 B;  4GYS A;  5JTG A;  5LMU T;  4EIW A;  3LJC A;  3T1Y T;  1WR0 A;  3ZMU B;  3NRX A;  4HTE A;  5F3J A;  2JRK A;  4I55 E;  1JNR A;  3MJX A;  3TLV A;  1OXZ A;  4AQY T;  1XNR T;  4YJ2 E;  4IE4 A;  2KIN B;  3B13 A;  1XMQ T;  2Y58 A;  5HXC A;  5AQI B;  2XM2 A;  5ETW A;  2BDE A;  1LRZ A;  3P4S A;  2SPC A;  3K1S A;  5LXB A;  5FXW A;  4DBM A;  2FJD A;  3GMI A;  2A2F X;  2J4G A;  2HN2 A;  3GA8 A;  3C79 A;  5ABF B;  4G63 A;  5LHI B;  4JUY A;  4TWH A;  3J7Y q;  2W63 A;  2DWG A;  3OBV E;  2V6X A;  5KX5 E;  2ZLY A;  3AXJ A;  4V1A v;  4DBR A;  3QB5 K;  4YSX A;  3V5S A;  3WAK A;  3RQW A;  2CXL A;  5KMG P;  1KNR A;  3RF1 A;  4HGA A;  4QXB B;  3A7M A;  3C4W A;  5HXE A;  1IAP A;  3V5U A;  4QKN A;  2IDO B;  3RC3 A;  4ZS2 A;  2NP9 A;  4O8S A;  2DI4 A;  5CGM A;  1LVK A;  1VCS A;  2WWU A;  3RH3 A;  4DBQ A;  3LBX A;  5JR9 C;  2JPF A;  1YKH B;  1ZP0 A;  4ILA A;  1E2A A;  3N9M A;  2Z6E A;  2M67 A;  3C50 A;  3VRB A;  5FXV A;  5C8Y E;  4ZR6 A;  5J5G A;  2VL8 A;  3PUG A;  1ZV4 X;  3WTM A;  4CN4 A;  4EV6 A;  2XZE A;  2JQK A;  3CVR A;  3N9N A;  5LMN T;  1W0A A;  3H37 A;  2JMK A;  2HH7 A;  2XAF B;  3CX6 B;  5FVK A;  1IJ5 A;  2XQ3 A;  5IHY A;  2E2A A;  3PU3 A;  5L3G B;  1WYB A;  3T1H T;  3IGQ A;  2B1E A;  5AQO B;  1WRD A;  4YT0 A;  1O3X A;  3EAB A;  4KP3 C;  2XHE B;  1MIV A;  4HFH A;  2KND A;  3TLS A;  2NTY A;  2V6Y A;  3C84 A;  4UV8 B;  3AB3 B;  4JI0 T;  4IGU A;  2EHO B;  4AQF C;  3VR8 A;  2H3R A;  4ILU A;  2E9X A;  3A5X A;  3M3Z B;  4UM1 A;  4UIG A;  4JEH B;  4ASK A;  3AE8 A;  3CQC B;  2HHH T;  3ZCI A;  3PDY A;  2YU2 A;  1T98 A;  5CJ5 A;  3NRY A;  3ONX A;  3ZN1 B;  3FB2 A;  2CM0 A;  3FZF B;  1D0Y A;  2CXD A;  4CN1 A;  4YJ3 E;  4I50 E;  3VHL A;  2DL1 A;  5AQQ B;  4HFB A;  1QSD A;  2BR7 A;  5J1G A;  3KV9 A;  1UK5 A;  1ZEE A;  1D1C A;  4KX6 A;  4LF9 T;  4J2C A;  4K0K T;  5HXS A;  2A9U A;  3U8M A;  1M7K A;  3P4R A;  1I9B A;  1S35 A;  4BFQ A;  3MXZ A;  2C9T A;  3SFD A;  2M6B A;  3ZEF B;  3RHW A;  1Z0P A;  2Y8D A;  4GYR A;  4EED A;  3ABV A;  2V8S V;  2ZM2 A;  3EUH A;  3EDU A;  3L3P A;  5HXR A;  2CRB A;  1IBL T;  4PJN A;  3J9X 1;  2Y48 B;  3K3O A;  2JQH A;  1J5E T;  4UM3 S;  3ZKR A;  1BR1 A;  5HCM A;  2W4X A;  4HWC A;  3FHN A;  4A98 A;  5J5H A;  5H6Q B;  4ZHQ E;  4AFH A;  5AQP B;  3FZK B;  3HKB E;  3DTO A;  4A56 A;  5LYJ E;  2XNV A;  4DR3 T;  5F8P A;  4TWF A;  2XQ5 A;  5L4H A;  4DV5 T;  3C64 A;  5C3J A;  5HEO A;  2I6H A;  2MYS A;  3ZPO A;  4ZI3 D;  2LT3 A;  1HCI A;  5LG3 A;  5F5W A;  5L4E A;  2CHO A;  2Y54 A;  3NZQ A;  3L39 A;  4U7I A;  3SOL A;  4PNI A;  3FXD B;  2IML A;  3UU8 A;  2XSB A;  5BR8 T;  3SFE A;  4PK4 A;  2IW5 B;  5M4Y A;  4U2Z A;  2BS2 A;  2X51 A;  2E5L T;  4DV0 T;  1MIY A;  4YSY A;  5FY0 A;  1N33 T;  2Q9Q B;  2Q9Q D;  4LF4 T;  2WDV A;  3RKO A;  5FY7 A;  3CX8 B;  1MMN A;  2CA5 A;  3P7I A;  2CCQ A;  4UV9 B;  5IWA T;  3PJA J;  4HWD A;  1N36 T;  3WTJ A;  4OK0 A;  4H9P C;  3RYI E;  4QX8 B;  4WZX A;  2PFV A;  2E8I A;  4OX9 T;  1SE7 A;  2EHO C;  4TV9 E;  3VR9 A;  1WCR A;  4TWD A;  5BW2 A;  3HL6 A;  2WMO A;  4YHJ A;  3I9Y A;  4PK6 A;  1UW6 A;  5A1L A;  3RYC E;  4AXP A;  4X64 T;  2NW8 A;  5LCY A;  5CB4 E;  2V7J A;  2V6Y B;  3PUS A;  3ZCJ A;  4ADZ A;  5CO5 A;  2V5C A;  5HCJ A;  1B7T A;  4OYK A;  2H88 A;  1WFD A;  4O4I E;  4EZ4 A;  2QGS A;  1V9D A;  3WTO A;  5BRX A;  4UF0 B;  1S94 A;  3MZK B;  2X68 A;  4KHP T;  4GK5 E;  2UXD T;  4XK9 A;  2XAH B;  1X9B A;  3RLF F;  5IYZ E;  2VVS A;  5LA6 E;  4H9R C;  3F2E A;  2E9X D;  5EZY E;  2XNU A;  2ACX A;  4I43 B;  2W0G A;  3JCF A;  5J2T E;  2WY2 A;  4GIW A;  3N9O A;  4H9S E;  3FBZ A;  4IE0 A;  1EZ3 A;  2Y56 A;  5DAB A;  4QXH B;  4AKI A;  2FJB A;  2X9W A;  3ZMT B;  3IA3 A;  4PIR A;  3L09 A;  1YD8 G;  3RI5 A;  3UT5 E;  3ZC0 A;  1FIO A;  3C4Z A;  1G73 A;  2CPT A;  4B3S T;  2NW7 A;  2OV9 A;  3HKD E;  3MAC A;  4YXD A;  3AED A;  1UUR A;  4H9Q C;  4AKR B;  2CXF A;  2LEH A;  3AE4 A;  4D01 A;  3VU7 H;  1UX5 A;  1ZHC A;  3CQG B;  4IHJ E;  5AFJ A;  1D1B A;  3AAE B;  4AKG A;  4PJJ A;  4UR9 A;  4JEU B;  3K3N A;  3GN5 B;  4U33 A;  5L3C B;  2KLQ A;  5FMN A;  3BQI A;  5JME A;  1T72 A;  2YK0 A;  5JRC B;  3UFG A;  2Y6X A;  2WZH A;  2LM9 A;  4EYU A;  5HAX A;  3AE6 A;  2C5J A;  3M65 A;  5LBM A;  2W00 A;  1U4Q A;  1L0V A;  2VUR A;  3OPC A;  3UUB A;  3KV5 A;  5TAO A;  3O1I A;  4B3R T;  4QAB A;  3GWH A;  5LOV E;  2W67 A;  4JI1 T;  3RRW A;  2V7L A;  1BR2 A;  2CE7 A;  3S4U A;  1MIW A;  5DQW A;  5LHH B;  1CHU A;  1OWA A;  1HFA A;  2I0M A;  2WDQ A;  1VCT A;  3P8C D;  4AIS A;  4U72 A;  3JAF A;  1X79 A;  2D0U A;  4HE8 A;  2JQ9 A;  2FJA A;  2RP4 A;  5JRE A;  2KMF A;  4P1N A;  1KNP A;  3N9Q A;  1T7S A;  2DHR A;  2WZI A;  4ZXL A;  2UUC T;  3QK6 A;  2BKN A;  3ANW A;  1UCU A;  4TX5 A;  2XAJ B;  2VKJ A;  2YOE A;  2XYT A;  4DV1 T;  2YIN A;  4PW8 A;  3LK4 2;  5JDG A;  5AQM B;  4B6X A;  5LGU B;  4ZS3 A;  1M62 A;  4QHO A;  4QXC B;  3H3A A;  3P50 A;  5FJV A;  1US7 B;  4LF6 T;  4ZJT A;  3EVY A;  3N2O A;  2HPL A;  3GN5 A;  3A8Y C;  4HN9 A;  4TN7 B;  1Y64 B;  4EXT A;  4Z91 A;  4UM3 A;  2CWO A;  4XBF B;  3RGL A;  2NW9 A;  2AXD S;  5EK2 A;  1E7P A;  2BKO A;  3QOF A;  3UUN A;  3Q5W A;  2B76 A;  3KVA A;  4BJM A;  5LBQ B;  3TLU A;  5KZU A;  3AA1 B;  3NKZ A;  2BKP A;  2VK9 A;  2OA5 A;  3ZMS B;  5ABF A;  3G06 A;  4QAC A;  3SQ9 A;  2QC1 B;  1OED E;  5AQK B;  2NWB A;  4FRR A;  2RPA A;  3AE2 A;  3MKD A;  2J62 A;  2XY8 B;  5SYO A;  1OED C;  3FBL A;  3KDS E;  5AQR B;  3U8J A;  2MPK A;  3UU6 A;  1YQ4 A;  3ETU A;  4TNW A;  1DU2 A;  3F57 A;  3Q9D A;  2ODU A;  3JAE A;  3P4W A;  2P9B A;  4KHZ F;  3HA4 A;  2D9D A;  1XMO T;  4YLH A;  2DNX A;  3AE7 A;  5FY1 A;  3RRC A;  3ZMV B;  2YEV C;  2A72 A;  3ETV A;  4CN6 A;  2CWY A;  2KZ7 B;  2Y7Y A;  4DO0 A;  4I0U A;  4B3M T;  3AA7 B;  4BJN A;  5JDN A;  4IE5 A;  5KDM C;  2V7M A;  2WSS V;  4ERR A;  2X9Y A;  5JR9 B;  4LF5 T;  4LFA T;  5HEJ A;  3UQ4 A;  4EYY R;  4ZRU A;  4CI2 B;  2XQ6 A;  2K5B B;  2NOX A;  3DJB A;  4C91 A;  3D0T A;  3QUJ A;  4BA9 A;  4UEL A;  1KNZ A;  1FMW A;  4ILB A;  3AE9 A;  5BMV E;  2V26 A;  4X20 E;  3BQL A;  2WU5 A;  3E0Z A;  5KE4 A;  4X5T A;  3PUZ F;  2N2N A;  3CIR A;  4UM3 P;  3AA6 B;  2X0Y A;  4O4H E;  4QH1 A;  3PE0 A;  4H9N C;  4MLK A;  1IBM T;  2XNT A;  2VAS A;  3QC9 A;  4HFI A;  1VOM A;  3LSV A;  2YU1 A;  4HWH A;  2WCA A;  4YSZ A;  3BK9 A;  2WZY A;  2NR4 A;  3PJA A;  2WN9 A;  4ZI2 C;  2E5V A;  4ZZC A;  3Q5E A;  4O2B E;  5LHG B;  3ZT6 A;  4GOU A;  3ANW B;  5FXX A;  1KK7 A;  2E9X C;  4U3C A;  4WBO A;  2LOS A;  5H6R B;  3PUW F;  2XM1 A;  3K8P C;  2WNC A;  1XDP A;  3ZDG A;  4UXN B;  3Q5X A;  4IE7 A;  3PU8 A;  2K48 A;  3PUY F;  3ZT5 A;  4KI0 F;  3N5L A;  4KBM B;  4ZOL E;  4AFG A;  3AAA B;  4HWF A;  4EEB A;  2X9H A;  5TVC A;  3RIU A;  2BBH A;  4A97 A;  4X66 T;  4Q25 A;  3LK2 B;  5HYA A;  2XUE A;  3AEC A;  3C4X A;  5AQN B;  2C5I T;  4EB6 E;  2PGZ A;  3ESL A;  2BYN A;  4TV8 E;  5EK4 A;  4DR4 T;  1U5P A;  3UFE A;  2BG9 E;  2WMN A;  2XYS A;  1XWM A;  1WR6 A;  3JAD A;  1D1A A;  4UVC B;  2PBI A;  3Q2M A;  1NAF A;  4TNV A;  5AFM B;  2XZ5 A;  1LKX A;  4MAL A;  5KXJ A;  4NPP A;  2XQ4 A;  2BG9 B;  5DQV A;  4WBN E;  4IDO A;  2BYS A;  5E0O A;  1J1J A;  1R8I A;  5LNK A;  5CA0 E;  2KSR A;  3N9L A;  4UVA B;  1W9R A;  1SUM B;  4GKJ T;  2UZ6 A;  2X00 A;  1Z8U A;  3WTL A;  3OJA A;  5BP0 A;  4B5D A;  3VRA A;  2LHN A;  4N78 D;  1BR4 A;  5JDF A;  3AAI A;  4U31 A;  2VQE T;  1FJG T;  2XZ6 A;  4ZJS A;  3U8N A;  3NWI A;  1SHZ C;  2LLY A;  2IHR 1;  1MMG A;  4IL9 A;  1QUU A;  4NUU A;  2WWV A;  5ABG A;  4BQT A;  1KFY A;  5AQS B;  5AQF B;  2W8G A;  4DV6 T;  3I1A A;  3VKH A;  4IE6 A;  4L5G A;  1T8B A;  5LB7 B;  4IDQ A;  4P0A A;  4IDP A;  5ABH A;  2FUP A;  2VKD A;  4LFB T;  1KF6 A;  1YKE B;  2WBL A;  3QB5 A;  4A5X A;  2XAG B;  5LJN A;  2YDS A;  4UF0 A;  4E7S A;  3HKC E;  3HR0 A;  3RIU C;  4CI1 B;  1WYC A;  2X00 D;  3R84 B;  1W0B A;  4AKH A;  5LGT B;  4PJL A;  3B57 A;  3U8K A;  3ONJ A;  1CUN A;  2IAK A;  4JI5 T;  2EHO D;  2CHN A;  3SH1 A;  5HXH A;  2DWK A;  3E22 E;  3OTO T;  3N2G E;  2WDR A;  2X9X A;  3I9W A;  2LOP A;  4ZK1 A;  1UUS A;  2XQY A;  4X1I E;  2MBG A;  2LRL A;  4YTM A;  4JBW F;  3RYF E;  4IIJ E;  3KIN B;  1NEN A;  2CMR A;  3C51 A;  4YTP A;  3RPU A;  4OHF A;  4X1K E;  1FMV A;  5FYM A;  3ONL C;  4FI5 A;  2L9Q A;  1GQE A;  4EGW A;  4DND A;  5FVL A;  2JIW A;  3KVB A;  3EHZ A;  5HEG A;  2BYP A;  2K9A A;  4F8H A;  2KWH A;  1HNW T;  2QVA A;  2VQF T;  3B5M A;  4UVB B;  2LRK A;  3SS1 A;  4Z8X A;  2BYR A;  4DV2 T;  1ZOY A;  2BVL A;  2LKH A;  4JYA T;  1MND A;  2UUB T;  4DMV A;  2VL0 A;  5JDH A;  2N1G A;  3UU4 A;  2V7K A;  3WIP A;  2K3W A;  4AIU A;  4EZ1 A;  4BAY B;  2KXP B;  5EK3 A;  1IBK T;  5FL1 A;  4U2Y A;  5AFH A;  1VRB A;  1Y01 A;  2CLY B;  1HR0 T;  4X1Y E;  2J1D G;  2WB5 A;  4WV9 A;  3P4Q A;  4AI6 A;  2XAQ B;  1N32 T;  2LKG A;  3W15 B;  3ZYL A;  3OKQ A;  2VKH A;  4O4L E;  3AE3 A;  5LXT E;  3SWH A;  4P0B A;  2UXN B;  4F6R C;  1HG2 A;  3PUX F;  2XJ7 A;  3MA9 A;  1MMD A;  4X65 T;  5CA1 E;  4HKA A;  4EZH A;  2VB6 A;  5AFN A;  2D0T A;  4DUY T;  3OVU A;  2PH9 A;  3ZYM A;  3AEG A;  3PUR A;  2D5U A;  2A3D A;  2IIU A;  2JQQ A;  2W62 A;  2ZJU A;  3CK6 A;  2IC9 A;  2QYW A;  1IJ6 A;  3U78 A;  5LP6 E;  2CBI A;  3UTK A;  2PJQ A;  4O4J E;  2LM2 A;  4U7Y A;  2XQ8 A;  2N9D A;  3EI0 A;  3O4X E;  3U8L A;  4CXW A;  1OED A;  4HFE A;  5AIN A;  4AKL A;  2H7V C;  2R6G F;  5L3B B;  2WQY A;  4PAG A;  4X62 T;  3LBX B;  3LG7 A;  2BBJ A;  2W8F A;  3O1H A;  4WNK A;  1MNE A;  3U3I A;  3RC8 A;  3ZSS A;  2AE9 A;  5AQL B;  2Y57 A;  1HX1 B;  2UXC T;  4UXU A;  2L3L A;  3WAJ A;  2W2U A;  2IUB A;  2C0S A;  1I94 T;  1WLX A;  4LML A;  4EOZ B;  2BS3 A;  1HG5 A;  3KV4 A;  4LFC T;  1YW0 A;  2PG8 A;  1XNQ T;  3T8O A;  2LSJ A;  2FJE A;  3PV0 F;  4QH4 A;  5JR9 A;  5GON E;  3X1D A;  1G8X A;  2ODV A;  4YFS A;  4QAA A;  4H63 H;  2LSY A;  2GK9 A;  5FL0 A;  4B3T T;  2ACZ A;  2XTL A;  3N9P A;  2BYQ A;  4DV7 T;  1J5W A;  3CX7 B;  4EAH A;  5JH7 E;  2E9X B;  3ZT7 A;  1HF8 A;  3TKL B;  4NXM T;  4KMC A;  4COF A;  3PTR B;  4MFR A;  3L8R A;  4FJO A;  5AQT B;  4HFC A;  2ZM8 A;  3AEB A;  2L8K A;  3ZN0 B;  5LJM A;  2WP9 A;  2BS4 A;  5AQU B;  4WW0 A;  2X67 A;  4ZI2 D;  3RYH E;  2XQA A;  2ZM6 T;  4LMK A;  2C5K T;  2Q9Q A;  2YKS A;  4IST A;  5JDQ A;  3N2K E;  3LK3 B;  3R6N A;  2JJ9 A;  3CKD A;  3KFW X;  4CZZ B;  5HEU A;  4DR7 T;  3ZJ2 A;  4HQP A;  4C90 A;  1QLB A;  4PFP A;  5AQV B;  5J5I A;  4JI3 T;  3ZC1 A;  3ZMZ B;  4WYV A;  1NEK A;  3ZJ1 A;  1NWM X;  2CBJ A;  3AE1 A;  4JV5 T;  4PFO A;  3IEE A;  4YY3 T;  4JLE A;  3C98 B;  4LF7 T;  5L2L A;  3WTH A;  4AQG A;  4GKK T;  3SRZ A;  2KT9 A;  4TZ4 C;  3I0O A;  4KUM B;  3FZM B;  3VKG A;  2H89 A;  4IT4 A;  5AQJ B;  5JVD E;  2D2S A;  4ZZB A;  2DLR A;  4XHE A;  2I59 A;  2X0L B;  1XZY A;  5J2U E;  5LGN B;  2H7O A;  3AE5 A;  4OYJ A;  2LJL A;  3JC6 D;  4JI6 T;  2V7I A;  2YN6 A;  3PUV F;  4E7Z A;  3FZH B;  3AVR A;  4NZB A;  3EAM A;  3P4P A;  4DR5 T;  4DVD A;  3BQK A;  1AJ3 A;  1FEW A; 
#chains in the Genus database with same CATH homology
 3U8K A;  4EZ1 A;  4QAB A;  3TLW A;  3RIF A;  5CFB A;  2XNT A;  2XQA A;  5AFK A;  3TLU A;  5KZU A;  4HFI A;  2YMD A;  4IRE A;  3TLV A;  1I9B A;  3LSV A;  4TNV A;  4UY2 A;  3SH1 A;  3U8M A;  4AFT A;  5AFM A;  5AFM B;  2XZ5 A;  1UV6 A;  2WZY A;  4LMK A;  3SIO A;  5AFL A;  4BFQ A;  2C9T A;  2M6B A;  4NPP A;  2BG9 A;  3RHW A;  2XQ4 A;  2W8F A;  4QAC A;  2BG9 B;  4ILC A;  2YKS A;  2XNU A;  3SQ9 A;  5AFH A;  2XQ3 A;  1OED E;  3UU5 A;  2QC1 B;  2WN9 A;  4FRR A;  4ZZC A;  2Y58 A;  3UU3 A;  2WNJ A;  4WV9 A;  5HEU A;  4LMJ A;  5SYO A;  1OED B;  2BYS A;  4ZK1 A;  1OED C;  2LKG A;  4HQP A;  3JAF A;  2Y56 A;  3RIA A;  2KSR A;  2Y57 A;  3IGQ A;  5LXB A;  3U8J A;  4DBM A;  5J5I A;  3UU6 A;  4TNW A;  4QH5 A;  5HEH A;  4UXU A;  2WNC A;  2UZ6 A;  2XQ7 A;  3WTJ A;  3ZDG A;  3C79 A;  2X00 A;  3JAE A;  4UM3 S;  3P4W A;  3WTN A;  4TWH A;  3WTL A;  5BP0 A;  4HFH A;  4HFD A;  4B5D A;  5J0Z A;  4ZK4 A;  3ZKR A;  4LML A;  5HCM A;  3TLS A;  4PIR A;  4ALX A;  3C84 A;  5L47 A;  4TWD A;  4A98 A;  3RI5 A;  3UQ7 A;  3SQ6 A;  2YME A;  3WTH A;  2XZ6 A;  5AFN A;  5BW2 A;  4ZJS A;  4AFG A;  3U8N A;  5J5H A;  5IUX A;  3WTI A;  2MAW A;  2Y7Y A;  4AFH A;  3EHZ A;  5HEG A;  2PH9 A;  2WNL A;  1UW6 A;  2LLY A;  5TVC A;  2XNV A;  3TLT A;  2YOE A;  4IL9 A;  3RQW A;  4A97 A;  2XYT A;  2BYP A;  4QH4 A;  5J5F A;  4D01 A;  4TWF A;  2XQ5 A;  4F8H A;  5L4H A;  4ZZB A;  4BQT A;  3RQU A;  4XHE A;  4QAA A;  4UM1 A;  2ZJU A;  5HEJ A;  3GUA A;  3UQ4 A;  2W8G A;  2XQ9 A;  2BJ0 A;  5AFJ A;  4Z90 A;  4ZRU A;  5CO5 A;  2XQ6 A;  5HEO A;  5HCJ A;  3WTK A;  2BYR A;  3P50 A;  5FJV A;  2BYQ A;  3ZDH A;  2LKH A;  2PGZ A;  4ZJT A;  4IL4 A;  2BYN A;  4ILB A;  5JME A;  5LG3 A;  5L4E A;  2VL0 A;  3WTO A;  2YN6 A;  2BG9 C;  4Z91 A;  3T4M A;  4UM3 A;  2ZJV A;  5BRX A;  2Y54 A;  3UU4 A;  2LM2 A;  2BG9 E;  4COF A;  2XYS A;  4ILA A;  2M6I A;  4HFB A;  3JAD A;  2XQ8 A;  5KE4 A;  2BR7 A;  4NZB A;  2X00 D;  4X5T A;  4HFC A;  3UU8 A;  3EAM A;  3EI0 A;  1UX2 A;  3PEO A;  3U8L A;  4ZR6 A;  1OED A;  5J5G A;  4HFE A;  3PMZ A;  4UM3 P;  4XK9 A;  5AIN A;  2BR8 A;  3WTM A;  3UUB A;  3WIP A;  4QH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...