4HFBA

The glic pentameric ligand-gated ion channel f14'a ethanol-sensitive mutant (apo)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 96
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4hfbA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4hfbA01
5KZUA 3ZKRA 5AFJA 3WTKA 4UXUA 2BYRA 3WTHA 5J5IA 3WIPA 4ILAA 4TNVA 4AFGA 3JADA 4LMLA 5J5HA 2YN6A 2XQ9A 5HEHA 2X00D 3JAFA 2XYTA 3TLSA 3C79A 1OEDB 2WN9A 4TWDA 4HFEA 1UV6A 2UZ6A 2YOEA 3RIFA 1I9BA 2WNJA 5JMEA 4QH1A 2XZ5A 4ZJSA 2XQ7A 5BW2A 2M6BA 4LMKA 2PH9A 5HEGA 4ZJTA 2KSRA 4AFHA 3P4WA 3U8JA 2WNCA 4TWFA 3SQ6A 2BG9B 2Y56A 2XNUA 4HFCA 2YMEA 2XQAA 4UM3P 5AFMB 3EHZA 4XK9A 3WTJA 5LXBA 5L4HA 5AFHA 3U8MA 2BG9E 5AFNA 1UW6A 2XQ4A 4ILBA 4COFA 1UX2A 2W8FA 3U8KA 5LG3A 2ZJUA 5TVCA 3WTLA 4F8HA 5J5FA 4IREA 4UM3S 4ZK1A 3EAMA 2BG9C 4LMJA 2LM2A 3TLVA 4ZK4A 5HEOA 4UM3A 5HCMA 3UU3A 2Y58A 4D01A 2XYSA 4UY2A 2XZ6A 5CFBA 4A98A 3SQ9A 4FRRA 1OEDE 5L47A 3WTMA 5IUXA 3T4MA 3RQWA 2PGZA 4AFTA 5KE4A 5SYOA 4ZRUA 2MAWA 2BYQA 3PMZA 5FJVA 3ZDGA 2BJ0A 3WTNA 2XNTA 1OEDC 2WNLA 4BFQA 4ZR6A 3P50A 3LSVA 3ZDHA 4QH5A 2QC1B 2X00A 2WZYA 3PEOA 3UU8A 2XNVA 4HFIA 4IL4A 3UUBA 4XHEA 4A97A 3WTIA 3UQ4A 5HCJA 3GUAA 3WTOA 4BQTA 2XQ5A 4Z90A 5J0ZA 4Z91A 2ZJVA 5CO5A 3SIOA 3JAEA 3RQUA 4EZ1A 4HFHA 4PIRA 5AFKA 4QABA 3C84A 4IL9A 2Y54A 5BP0A 4ILCA 2W8GA 5BRXA 2XQ3A 2C9TA 2BYPA 2YKSA 2BYSA 4DBMA 3RI5A 3TLWA 2BYNA 2BR7A 4QACA 4ZZCA 4HQPA 4QAAA 4WV9A 3U8LA 5HEJA 2LKGA 3RHWA 4NZBA 3RIAA 3SH1A 4X5TA 2YMDA 5J5GA 2XQ6A 4UM1A 3UU6A 4TNWA 1OEDA 5L4EA 5HEUA 3TLUA 2LLYA 3U8NA 4ZZBA 2XQ8A 3UU4A 3IGQA 2M6IA 3EI0A 3TLTA 5AINA 2VL0A 4HFDA 4B5DA 4ALXA 2BG9A 2LKHA 4NPPA 3UQ7A 4HFBA 5AFLA 2Y7YA 2Y57A 4QH4A 2BR8A 5AFMA 3UU5A 4TWHA
chains in the Genus database with same CATH superfamily
3FZFB 2NW8A 4O4JE 1H7CA 2LHNA 5AQLB 2LE8A 1OEDB 5L3EB 2MYSA 4CI3B 2JJ9A 2XM2A 4WW0A 4JI3T 4QXHB 2WMNA 2BG9B 2BBHA 3VKHA 3AVRA 3PU8A 2EHOA 4PAGA 3FZMB 1UURA 5L4HA 1YKHB 1T8BA 3P7IA 4UM3S 1XNRT 2WY2A 1QSDA 1KNRA 3Q9DA 3LJCA 4DV2T 4ZRUA 2K9AA 3Q2MA 4IIJE 1MNEA 3EABA 4IE0A 3SFDA 3CX6B 3WAJA 1YD8G 3VRAA 4FI5A 3G06A 2W4XA 4EEBA 2XSBA 3PTRB 5LBMA 1W09A 5AQMB 5LMUT 4CQIA 4ILUA 1XWMA 2KT9A 5F3JA 1N34T 2BYNA 5LOVE 2V7LA 5LXTE 4JI4T 3FHNA 2Q9QA 3AB3B 2C0SA 2LOSA 2CXFA 2D2SA 2FUPA 1E2AA 1YQ3A 4EOZB 4HN9A 3AXJB 1IBLT 3EI0A 2HH7A 3CMLA 3N9QA 2N9DA 4MBQA 4DV5T 2JIWA 2PJQA 1UUSA 4JEUB 2L9QA 4IDPA 2FBWA 2X51A 1HF8A 1XDOA 4G63A 2C5KT 2K48A 2C5JA 4X65T 3L39A 4PFOA 2HN2A 4HGAA 5AFMB 3F57A 1O3XA 5L3GB 1D1CA 1T98A 3WTLA 4F8HA 2UXNB 4ZK1A 3EAMA 1SE7A 4X20E 3M65A 4LF7T 3V5UA 5LHGB 1XZYA 2PGZA 4KHPT 4UV9B 2NP9A 4EB6E 4U72A 1WYCA 3KDSE 3N2OA 3UULA 5LB7B 2UXXB 3UTKA 2RPAA 3AEAA 3UUBA 4CXYA 4GKJT 5HCJA 3WTOA 5CO5A 2HN1A 3RYIE 4EZ1A 4H9RC 3N2GE 3AAAB 2BS2A 4IDNA 2UUCT 5HEJA 3L8RA 1MMDA 3N9LA 5HAXA 2XAHB 4UM1A 4A56A 4N78D 4GK5E 5FVKA 1OEDA 2WS3A 2WMOA 5AQOB 3CX8B 3ZSSA 4HFDA 2BG9A 4U7YA 3DJBA 3PURA 2BR8A 4DBQA 1X9BA 1U5PA 2XYTA 4HFEA 4IHJE 2XAQB 5JMEA 2A3DA 4ZS2A 4ZJSA 4ZJTA 5LJNA 1D1BA 2WWUA 3P4WA 3OVUA 4ASKA 1NEKA 1YQ4A 5LCYA 2H88A 1QLBA 4YLHA 1IBMT 2BDEA 4OYJA 1MMGA 4IREA 4YTPA 3AAEB 3RH3A 5CFBA 2FJBA 5LJMA 5FXWA 5FP3A 3OJAA 4NXNT 2BZBA 4QX8B 2F4VT 2RP4A 2BVLA 2X9WA 2CPTA 4IE6A 3C64A 1KEYA 2LRLA 3LK3B 2PTFA 4XHEA 3WI3A 2LT3A 2NW7A 3O1HA 4Z91A 1HNZT 4HFHA 2QRXA 4IL9A 2ACXA 4GIWA 3AXJA 3ZC0A 2W8GA 5CB4E 2XQ3A 3RI5A 4QAAA 4WNKA 2H3RA 2B76A 3RHWA 4CXWA 1HNWT 4K0KT 5AQQB 3PUYF 2XQ6A 2X0YA 2VKDA 3VR8A 3JCFA 4HWDA 2LLYA 3U8NA 1QUUA 4ZZBA 4O2BE 1G73A 2V7JA 4ZOLE 4ALXA 3VHLA 3O1IA 2CXLA 3P8CD 1UX5A 2Y7YA 5AFLA 5AFMA 4UIGA 4UXUA 3AA1B 4H9SE 3FZKB 4ILAA 4LMLA 3LK42 1B7TA 4IDQA 2YOEA 1I9BA 3K1SA 4JI7T 5FNVE 3PU3A 3N5LA 2CHNA 4G2AA 4TWFA 4YJ3E 3H37A 5IYZE 5E0OA 3AE6A 3X1DA 2L3LA 5KX5E 3LDQB 5JH7E 2IIUA 2WB5A 3N9OA 4MHCA 3T1YT 3GN5B 3QNUA 3PUAA 2Y58A 5JR9C 1UK5A 1WRDA 4WBNE 4DR4T 3RQWA 2X67A 5SYOA 3HA4A 3ZN1B 3KBTA 4OYKA 2IC6A 1M62A 4CZZB 4QH5A 4NUVA 3HL6A 3WTIA 2ZJVA 3ZCIA 2D0UA 3A5XA 1BR0A 1R8IA 2AE9A 4DR5T 2BYPA 4I43B 2UXCT 2FJAA 2LSJA 2K5BB 3Q5DA 4TV8E 2WP9A 2HPLA 5HEUA 2NOXA 4B3RT 4HTEA 1SA0E 4DR7T 3P4SA 4M1PA 1KNZA 5KZUA 2A72A 2J4GA 3K3NA 5A1LA 5C8YE 4EV6A 3JAFA 3HKCE 3PUSA 3K3QC 3QB5K 4U2ZA 2X9YA 3PJAA 4YFSA 5F5WA 1BR2A 3NVOA 2I59A 4DV6T 3EHZA 2X0HA 1D1AA 2JQ9A 3ZMZB 1UW6A 2V1DB 3U8KA 5J5FA 2DL1A 2H89A 4JV5T 2CBJA 3P4QA 3T4MA 4ZI2D 2MAWA 2V5CA 4IT4A 2N2NA 4AXPA 3ZDHA 3U3IA 2C5IT 5AQRB 5LHHB 4HKAA 4PFPA 3ZN0B 3GUAA 3IHRA 5JDMA 3AEFA 4B3ST 3L3PA 3KBUA 3KV4A 4O2AE 5BRXA 2DLRA 2BYSA 4DBMA 3LBXB 4KP3C 4PK6A 4QWNB 2N1GA 3P4RA 4Q25A 5JVDE 4QKNA 3RLFF 5KMGP 2KWIB 2OA5A 3RYCE 3DTOA 2V7IA 1VCTA 4ZXLA 3T1HT 5JR9B 2BBJA 2BKOA 2UU9T 3CQCB 4I55E 3WTHA 3I1AA 2NTYA 2CLYC 1HR0T 4KX6A 2WNJA 5AQGB 3GN5A 5AQSB 1W0AA 2XNUA 3MXZA 4HFCA 3NRYA 2YDSA 3ZT7A 4BAYB 1UCUA 1ZP0A 2OV9A 2W61A 5DQWA 3N2KE 5LG3A 2J62A 3CK6A 4LMJA 3HKDE 5HEOA 3UU3A 4DR2T 4FRRA 3W15B 4IDZA 3I9WA 3PMZA 5IHYA 4TX5A 1ZV4X 1G8XA 3IA3A 2P9BA 3CQGB 3BQLA 3P50A 1D0XA 1SUMB 2XQ5A 4Z90A 5LGNB 3EDUA 4DBRA 2IMLA 2QYWA 3BK9A 3NBXX 1N33T 2XHEB 5JTGA 4L5GA 3UU6A 2IAKA 3TLUA 3RC8A 4JLEA 3TLTA 3ZYLA 4CXXA 2IW5B 5EZYE 3ZPOA 2LSIA 3ONJA 1XMQT 1FJGT 3B13A 5AFJA 1HS7A 4YTMA 2DCFA 3FXDB 5AQPB 5JDQA 4YJ2E 5FY0A 2JMHA 1ZOYA 2WZIA 4H9PC 4AQFA 2WDRA 3RKGA 4EYUA 1FMVA 5CGMA 1ZEEA 1WYBA 2VVNA 2W2UA 2VQFT 1WFDA 2XQAA 3UFGA 5L3DB 4XK9A 1NENA 5HXEA 2XTLA 3J7Yq 1HX8A 3IEEA 3AE3A 4JEHB 5LYJE 3C98B 3AECA 4YHJA 4E7SA 4YHHT 4P09A 2LSKA 1W0BA 3C4XA 2D0TA 5KXJA 2Y6XA 3LBXA 1WR0A 3AEBA 3ZT6A 3PUXF 4UF0B 3LSVA 2FJDA 3EVYA 4LF8T 5FVLA 5JRCB 3D0TA 2DI4A 4PIRA 5AFKA 1DU2A 5ETWA 2D9DA 4ILCA 5JR9A 3FZLB 5ABFB 1HNXT 3ONXA 4HQPA 3AE5A 2H7VC 2WU5A 1D0ZA 2LJLA 4AKLA 3SH1A 4EEDA 1YW0A 4PK5A 4O4IE 2YU2A 3AAIA 4DMWA 2Y48B 4CI2B 2VL0A 4AKGA 4EXTA 2E9XD 3OPCA 2PG8A 3V5SA 4HFBA 4P0AA 2VB6A 2YMEA 4OK0A 3WIPA 4B3TT 2E8IA 3NZQA 4JBWF 4TWDA 1IZNB 2ZMAA 4I4TE 2E9XC 2JQKA 3UUXB 4E7ZA 4IE4A 3VRBA 2VK9A 3FBZA 5DJQC 4ISSA 3PUZF 3O4XE 1T72A 5HCMA 5ABGA 4GKKT 4NUUA 2CA5A 2V7MA 4UR9A 3QK6A 5FXXA 3R6NA 1X79A 3AA7B 5CA1E 5EK3A 4HE8A 5FMNA 4B6XA 2DWKA 2YK0A 4DR6T 3Q5EA 2RA1A 3ZC1A 5FYMA 1W9RA 2XY8B 3U8LA 3ONLC 3A8YC 5AQFB 3FBLA 4UVBB 3AEEA 4HWFA 3CVRA 3RPUA 1JNRA 1LVFA 4GYSA 5HYAA 4NPPA 3RIUA 4EGWA 3NKZA 4TZ4C 2Y57A 2Q9QD 2CRBA 2YN6A 5CA0E 4IE7A 2UZ6A 2Z6EA 4PJLA 3RRCA 1XNQT 2X66A 3RKOA 4X62T 2Q9QC 2WCAA 2UXBT 3ZMVB 3R84B 2BG9E 5AQIB 5M4YA 4UF0A 2LM9A 3GWHA 4NXMT 3BQIA 2LM2A 5JRCA 1IBKT 4D01A 2XYSA 4UY2A 3O1JA 4OFZA 2KLQA 3WTMA 5LGTB 4NIQA 3AE4A 2XUEA 4UXNB 3ETUA 2BJ0A 5AQVB 5ABFA 2I6HA 2W62A 3O9XA 3GMIA 1CHUA 2QC1B 3N9PA 4YT0A 2MBGA 1E7PA 5J0ZA 4U74A 3I0QA 2V8SV 1KNPA 2E9XB 3AVSA 4CN1A 3RIAA 4X5TA 4V1Av 3KV6A 3ABVA 3RX6A 2SPCA 2BS4A 1U4QA 2LSGA 1VRBA 5L4EA 1WCRA 3J9X1 3UUNA 4UELA 3IGQA 2M6IA 4HEAA 1LKXA 5L3BB 4QXBB 4C91A 1NWMX 2YU1A 2E2AA 1IJ5A 4QH4A 5H6RB 4TWHA 4DUYT 2W63A 5J5HA 2DHRA 2XQ9A 2NW9A 2DNXA 3AEGA 5HEGA 3AE7A 3VKGA 3SFEA 5C2TA 2W67A 3OTOT 2WAUA 5AFHA 2E5VA 1HG2A 2AXDS 4A5XA 2W8FA 2VQET 4AQYT 3C51A 2ODUA 4TV9E 2V6XA 2BG9C 5FL1A 4A98A 1FMWA 4H9QC 3MACA 5FXZA 4AFTA 3CKDA 2XAFB 4MALA 4DIDB 1J5ET 5LGUB 4B3MT 2WNLA 4BFQA 4QX7B 1I94T 2CM0A 3UU8A 3CX7B 4BQTA 3UQ4A 5HXSA 3NZPA 4ANJA 1JNZA 1MNDA 2UUAT 3JAEA 5HXRA 3PJAJ 2KMFA 4JI5T 3K8PC 3OYZA 4WYVA 2YKSA 2JRKA 4AKIA 4X1KE 4WV9A 2OLTA 2LKGA 2XSAA 1BR1A 5CJ5A 3UT5E 2YDRA 5LG4A 4DR1T 5LMNT 2ES0A 4ZS3A 2VURA 2PBIA 3ZYKA 5AQTB 4I50E 4X1YE 1D0YA 3CWZB 4IDOA 2XJ7A 3WTKA 5JDHA 2WN9A 2XASB 5L3CB 3RIFA 4QH1A 1Z8UA 3U8JA 3SQ6A 4GOUA 3F31A 2X68A 4DV1T 1EZ3A 2VKJA 3MK7C 3RC3A 5H6QB 3AA6B 3SS1A 4COFA 4ADZA 2WDQA 2ZJUA 5TVCA 4YTNA 3H3AA 3QC9A 2CEAA 3TLVA 2VKOA 3LG7A 3ETVA 3ZMUB 1OWAA 5J2UE 1V9DA 2ZM8A 4L9IA 2E9XA 3IF8B 3PUGA 2VVSA 5GONE 3WTNA 4CN4A 1AJ3A 2IC9A 1HG5A 5JDFA 3H3MA 1OXZA 5FXVA 2MTQA 4H63V 4PNIA 2BS3A 4H9OC 2G0UA 4DV7T 2W66A 2ACZA 2CE7A 5L3FB 3RGLA 2BR7A 3ZMSB 3FZHB 2CBIA 3RRWA 3VR9A 1IAPA 5TAOA 1N36T 2LRKA 3IBPA 3BQKA 3ZYMA 4YSZA 2X9HA 2JPFA 5IWAT 5AINA 5ADXL 2A2FX 2VKHA 2ZM2A 3ZMTB 1UGOA 4WBOA 3GA8A 4BJNA 3ANWB 3ZKRA 5C3JA 1KK7A 4TNVA 1I6ZA 2M67A 4XAXB 2I0MA 3OKQA 2M6BA 3KINB 1MMNA 4QXCB 5AQJB 2WNCA 5FY1A 3C4WA 3ZSTA 2W0GA 2WZHA 3WTJA 4ISTA 3SRZA 2JQQA 5FL0A 5AFNA 4ILBA 4EYYR 1NAFA 2XAJB 4K0UA 5DABA 4AI6A 4H9NC 3TKLB 3N9MA 3RYFE 3KV5A 5AQHB 3N9NA 4JI8T 5DQVA 3M3ZB 2LEHA 1E1HB 3UFEA 4DVDA 1KFYA 2QVAA 4LFAT 4DV3T 3NRXA 4YSYA 5FJVA 2Y8DA 3K3OA 1Z0PA 1L0VA 2WZYA 1XMOT 5LNKA 3SIOA 1M7KA 4U33A 3PUVF 1HCIA 2VASA 2V26A 3CQXC 4U31A 2CCQA 1LVKA 2DWGA 3TLWA 2LHRA 4YSXA 2NTXA 5FKYA 1T7SA 2KXPB 4PK4A 5FY7A 2CLYB 2IUBA 4JYAT 4IGUA 1FEWA 4PW8A 3NWIA 4LF4T 3KVBA 3P4PA 4ZI3D 3UU5A 4C90A 4UVAB 3JADA 4U2YA 2X00D 1UV6A 3AE1A 2WWVA 4J2CA 4XZCA 4ZI3C 5JDLA 2WDVA 4WZXA 3FXEB 2JQHA 4ZEYA 5LXBA 3U8MA 3PE0A 3B57A 2XQ4A 1UX2A 4HWCA 4TN7B 4PJNA 4BA9A 2LOPA 5LBQB 2E5LT 2ZM6T 3QUJA 4JUYA 4ZHQE 4HWHA 4EZHA 5AFUL 4ERRA 5EK2A 3ZJ2A 1WLXA 3MA9A 5HXCA 2CWOA 3UUMA 2XM1A 4QABA 4DMVA 4EZ4A 2ZLYA 3MJXA 2EHOD 3LFMA 3ANWA 2XQYA 4IE5A 2KWHA 2MPKA 4O4LE 1SHZC 2CMRA 4OX9T 1YKEB 4JI6T 1MIVA 4TUYE 2MOZA 2EHOC 3MZKB 4YXDA 3ZLIA 2PFVA 2WQYA 2VWAA 1IJ6A 3I9YA 2BYRA 2A9UA 1LRZA 4AFGA 3ZT5A 1Y01A 2ZM0A 3TLSA 3C79A 2W00A 2UXDT 2XZ5A 2KSRA 2XZEA 4AQGA 2UUBT 4KMCA 2L8KA 4BJMA 5JDGA 2KZ7B 3AE9A 3C4ZA 1HFAA 4DR3T 4KHZF 2YINA 3PUWF 4U3CA 3F2EA 5AQKB 3EUHA 2KINB 2WU2A 4ZK4A 2KNDA 4UM3A 2CHOA 2V7KA 4DV4T 3DP7A 5JQGE 1OEDE 5L47A 2QA7A 3HKBE 2VL8A 5ABHA 4XBFB 3ZDGA 2V6YB 1US7B 2XNTA 4X66T 2YDQA 1VOMA 4AQFC 4YY3T 3C50A 2ODVA 3S4UA 5BR8T 3WAKA 4LFBT 3MKDA 3AE8A 3HKEE 5BP0A 4JI2T 2C9TA 3RF1A 2CWYA 5AQNB 3AEDA 3HR0A 2NR4A 1HX1B 3CPZA 4MFRA 3JC6D 4AKHA 4H63H 3ZJ1A 1CUNA 1S35A 5AQUB 4B5DA 4AKRB 3JC6C 4HWIB 5J5IA 2B1EA 3OYXA 4KBMB 1KF6A 2GK9A 4PJMA 5F8PA 4LMKA 1Y64B 2PH9A 2WBLA 4DUZT 2BKNA 1MIYA 1ZKEA 2CXDA 1N32T 5J1GA 4X1IE 4UM3P 1GQEA 2NWBA 3B5MA 3SWHA 2XPKA 2JMKA 3Q5XA 5HWXA 1S94A 2FJEA 4CN6A 2X9XA 3SQ9A 2HPJA 1VCSA 3L09A 5KE4A 2EHOB 2YEVC 2BYQA 5JREA 2K24A 1OEDC 4KUMB 4JI1T 3OBVE 3PV0F 2QGSA 1XDPA 2K3WA 1MIWA 3PEOA 2XNVA 5EK4A 4DNDA 2R6GF 3SOLA 3RQUA 3AA0B 4EIWA 4UEMA 2IHR1 3U78A 4KI0F 3CIRA 3ZCJA 3PUQA 3HI2A 3QB5A 4ZZCA 4LFCT 1WR6A 4LF6T 2IDOB 4LF9T 5ABEA 4Z8XA 4AIUA 4CI1B 2J47A 1FIOA 1J1JA 2LKHA 3KVAA 3UQ7A 1UX4A 2Q9QB 2BKPA 3FB2A 5HEHA 4FJOA 1J5WA 2X0LB 3KV9A 1YXRA 3EDVA 4ZI7E 5LP6E 5BW2A 2XQ7A 3E08A 5KDMC 4AFHA 5JDNA 2Y56A 4GYRA 4HFVA 2D5UA 4UV8B 3RYHE 1BR4A 4L0RA 5LHIB 2V6YA 4O4HE 4DV0T 4U7IA 4EAHA 3Q5WA 3ZEFB 5LA6E 4ZI2C 3RIUC 4JI0T 2XZ6A 3PDYA 4UVCB 5IUXA 4QHOA 4AISA 4LF5T 1ZHCA 1HTJF 2BVMA 4GK0E 4ZR6A 4O8SA 2X00A 1MMAA 4MLKA 4F6RC 4HFIA 4IL4A 4A97A 4PJJA 3A7MA 5L2LA 5BMVE 2XAGB 3QOFA 4DO0A 5HWYA 3C84A 3LK2B 4I0UA 2WM9A 3I0OA 2Y54A 2WSSV 5HXHA 2H7OA 3E22E 3KFWX 4P0BA 4QACA 4X64T 3VU7H 2HHHT 4NZBA 3E0ZA 2V5DA 2YMDA 3ESLA 5J5GA 2LSYA 5J2TE 4TNWA 2J1DG 2XQ8A 3UU4A 4P1NA 4OHFA 3T8OA 3AE2A
chains in the Genus database with same CATH topology
5KZUA 3ZKRA 5AFJA 3WTKA 4UXUA 2BYRA 3WTHA 5J5IA 3WIPA 4ILAA 4TNVA 4AFGA 3JADA 4LMLA 5J5HA 2YN6A 2XQ9A 5HEHA 2X00D 3JAFA 2XYTA 3TLSA 3C79A 1OEDB 2WN9A 4TWDA 4HFEA 1UV6A 2UZ6A 2YOEA 3RIFA 1I9BA 2WNJA 5JMEA 4QH1A 2XZ5A 4ZJSA 2XQ7A 5BW2A 2M6BA 4LMKA 2PH9A 5HEGA 4ZJTA 2KSRA 4AFHA 3P4WA 3U8JA 2WNCA 4TWFA 3SQ6A 2BG9B 2Y56A 2XNUA 4HFCA 2YMEA 2XQAA 4UM3P 5AFMB 3EHZA 4XK9A 3WTJA 5LXBA 5L4HA 5AFHA 3U8MA 2BG9E 5AFNA 1UW6A 2XQ4A 4ILBA 4COFA 1UX2A 2W8FA 3U8KA 5LG3A 2ZJUA 5TVCA 3WTLA 4F8HA 5J5FA 4IREA 4UM3S 4ZK1A 3EAMA 2BG9C 4LMJA 2LM2A 3TLVA 4ZK4A 5HEOA 4UM3A 5HCMA 3UU3A 2Y58A 4D01A 2XYSA 4UY2A 2XZ6A 5CFBA 4A98A 3SQ9A 4FRRA 1OEDE 5L47A 3WTMA 5IUXA 3T4MA 3RQWA 2PGZA 4AFTA 5KE4A 5SYOA 4ZRUA 2MAWA 2BYQA 3PMZA 5FJVA 3ZDGA 2BJ0A 3WTNA 2XNTA 1OEDC 2WNLA 4BFQA 4ZR6A 3P50A 3LSVA 3ZDHA 4QH5A 2QC1B 2X00A 2WZYA 3PEOA 3UU8A 2XNVA 4HFIA 4IL4A 3UUBA 4XHEA 4A97A 3WTIA 3UQ4A 5HCJA 3GUAA 3WTOA 4BQTA 2XQ5A 4Z90A 5J0ZA 4Z91A 2ZJVA 5CO5A 3SIOA 3JAEA 3RQUA 4EZ1A 4HFHA 4PIRA 5AFKA 4QABA 3C84A 4IL9A 2Y54A 5BP0A 4ILCA 2W8GA 5BRXA 2XQ3A 2C9TA 2BYPA 2YKSA 2BYSA 4DBMA 3RI5A 3TLWA 2BYNA 2BR7A 4QACA 4ZZCA 4HQPA 4QAAA 4WV9A 3U8LA 5HEJA 2LKGA 3RHWA 4NZBA 3RIAA 3SH1A 4X5TA 2YMDA 5J5GA 2XQ6A 4UM1A 3UU6A 4TNWA 1OEDA 5L4EA 5HEUA 3TLUA 2LLYA 3U8NA 4ZZBA 2XQ8A 3UU4A 3IGQA 2M6IA 3EI0A 3TLTA 5AINA 2VL0A 4HFDA 4B5DA 4ALXA 2BG9A 2LKHA 4NPPA 3UQ7A 4HFBA 5AFLA 2Y7YA 2Y57A 4QH4A 2BR8A 5AFMA 3UU5A 4TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KZU A;  3ZKR A;  5AFJ A;  3WTK A;  4UXU A;  2BYR A;  3WTH A;  5J5I A;  3WIP A;  4ILA A;  4TNV A;  4AFG A;  3JAD A;  4LML A;  5J5H A;  2YN6 A;  2XQ9 A;  5HEH A;  2X00 D;  3JAF A;  2XYT A;  3TLS A;  3C79 A;  1OED B;  2WN9 A;  4TWD A;  4HFE A;  1UV6 A;  2UZ6 A;  2YOE A;  3RIF A;  1I9B A;  2WNJ A;  5JME A;  4QH1 A;  2XZ5 A;  4ZJS A;  2XQ7 A;  5BW2 A;  2M6B A;  4LMK A;  2PH9 A;  5HEG A;  4ZJT A;  2KSR A;  4AFH A;  3P4W A;  3U8J A;  2WNC A;  4TWF A;  3SQ6 A;  2BG9 B;  2Y56 A;  2XNU A;  4HFC A;  2YME A;  2XQA A;  4UM3 P;  5AFM B;  3EHZ A;  4XK9 A;  3WTJ A;  5LXB A;  5L4H A;  5AFH A;  3U8M A;  2BG9 E;  5AFN A;  1UW6 A;  2XQ4 A;  4ILB A;  4COF A;  1UX2 A;  2W8F A;  3U8K A;  5LG3 A;  2ZJU A;  5TVC A;  3WTL A;  4F8H A;  5J5F A;  4IRE A;  4UM3 S;  4ZK1 A;  3EAM A;  2BG9 C;  4LMJ A;  2LM2 A;  3TLV A;  4ZK4 A;  5HEO A;  4UM3 A;  5HCM A;  3UU3 A;  2Y58 A;  4D01 A;  2XYS A;  4UY2 A;  2XZ6 A;  5CFB A;  4A98 A;  3SQ9 A;  4FRR A;  1OED E;  5L47 A;  3WTM A;  5IUX A;  3T4M A;  3RQW A;  2PGZ A;  4AFT A;  5KE4 A;  5SYO A;  4ZRU A;  2MAW A;  2BYQ A;  3PMZ A;  5FJV A;  3ZDG A;  2BJ0 A;  3WTN A;  2XNT A;  1OED C;  2WNL A;  4BFQ A;  4ZR6 A;  3P50 A;  3LSV A;  3ZDH A;  4QH5 A;  2QC1 B;  2X00 A;  2WZY A;  3PEO A;  3UU8 A;  2XNV A;  4HFI A;  4IL4 A;  3UUB A;  4XHE A;  4A97 A;  3WTI A;  3UQ4 A;  5HCJ A;  3GUA A;  3WTO A;  4BQT A;  2XQ5 A;  4Z90 A;  5J0Z A;  4Z91 A;  2ZJV A;  5CO5 A;  3SIO A;  3JAE A;  3RQU A;  4EZ1 A;  4HFH A;  4PIR A;  5AFK A;  4QAB A;  3C84 A;  4IL9 A;  2Y54 A;  5BP0 A;  4ILC A;  2W8G A;  5BRX A;  2XQ3 A;  2C9T A;  2BYP A;  2YKS A;  2BYS A;  4DBM A;  3RI5 A;  3TLW A;  2BYN A;  2BR7 A;  4QAC A;  4ZZC A;  4HQP A;  4QAA A;  4WV9 A;  3U8L A;  5HEJ A;  2LKG A;  3RHW A;  4NZB A;  3RIA A;  3SH1 A;  4X5T A;  2YMD A;  5J5G A;  2XQ6 A;  4UM1 A;  3UU6 A;  4TNW A;  1OED A;  5L4E A;  5HEU A;  3TLU A;  2LLY A;  3U8N A;  4ZZB A;  2XQ8 A;  3UU4 A;  3IGQ A;  2M6I A;  3EI0 A;  3TLT A;  5AIN A;  2VL0 A;  4HFD A;  4B5D A;  4ALX A;  2BG9 A;  2LKH A;  4NPP A;  3UQ7 A;  4HFB A;  5AFL A;  2Y7Y A;  2Y57 A;  4QH4 A;  2BR8 A;  5AFM A;  3UU5 A;  4TWH A; 
#chains in the Genus database with same CATH topology
 3FZF B;  2NW8 A;  4O4J E;  1H7C A;  2LHN A;  5AQL B;  2LE8 A;  1OED B;  5L3E B;  2MYS A;  4CI3 B;  2JJ9 A;  2XM2 A;  4WW0 A;  4JI3 T;  4QXH B;  2WMN A;  2BG9 B;  2BBH A;  3VKH A;  3AVR A;  3PU8 A;  2EHO A;  4PAG A;  3FZM B;  1UUR A;  5L4H A;  1YKH B;  1T8B A;  3P7I A;  4UM3 S;  1XNR T;  2WY2 A;  1QSD A;  1KNR A;  3Q9D A;  3LJC A;  4DV2 T;  4ZRU A;  2K9A A;  3Q2M A;  4IIJ E;  1MNE A;  3EAB A;  4IE0 A;  3SFD A;  3CX6 B;  3WAJ A;  1YD8 G;  3VRA A;  4FI5 A;  3G06 A;  2W4X A;  4EEB A;  2XSB A;  3PTR B;  5LBM A;  1W09 A;  5AQM B;  5LMU T;  4CQI A;  4ILU A;  1XWM A;  2KT9 A;  5F3J A;  1N34 T;  2BYN A;  5LOV E;  2V7L A;  5LXT E;  4JI4 T;  3FHN A;  2Q9Q A;  3AB3 B;  2C0S A;  2LOS A;  2CXF A;  2D2S A;  2FUP A;  1E2A A;  1YQ3 A;  4EOZ B;  4HN9 A;  3AXJ B;  1IBL T;  3EI0 A;  2HH7 A;  3CML A;  3N9Q A;  2N9D A;  4MBQ A;  4DV5 T;  2JIW A;  2PJQ A;  1UUS A;  4JEU B;  2L9Q A;  4IDP A;  2FBW A;  2X51 A;  1HF8 A;  1XDO A;  4G63 A;  2C5K T;  2K48 A;  2C5J A;  4X65 T;  3L39 A;  4PFO A;  2HN2 A;  4HGA A;  5AFM B;  3F57 A;  1O3X A;  5L3G B;  1D1C A;  1T98 A;  3WTL A;  4F8H A;  2UXN B;  4ZK1 A;  3EAM A;  1SE7 A;  4X20 E;  3M65 A;  4LF7 T;  3V5U A;  5LHG B;  1XZY A;  2PGZ A;  4KHP T;  4UV9 B;  2NP9 A;  4EB6 E;  4U72 A;  1WYC A;  3KDS E;  3N2O A;  3UUL A;  5LB7 B;  2UXX B;  3UTK A;  2RPA A;  3AEA A;  3UUB A;  4CXY A;  4GKJ T;  5HCJ A;  3WTO A;  5CO5 A;  2HN1 A;  3RYI E;  4EZ1 A;  4H9R C;  3N2G E;  3AAA B;  2BS2 A;  4IDN A;  2UUC T;  5HEJ A;  3L8R A;  1MMD A;  3N9L A;  5HAX A;  2XAH B;  4UM1 A;  4A56 A;  4N78 D;  4GK5 E;  5FVK A;  1OED A;  2WS3 A;  2WMO A;  5AQO B;  3CX8 B;  3ZSS A;  4HFD A;  2BG9 A;  4U7Y A;  3DJB A;  3PUR A;  2BR8 A;  4DBQ A;  1X9B A;  1U5P A;  2XYT A;  4HFE A;  4IHJ E;  2XAQ B;  5JME A;  2A3D A;  4ZS2 A;  4ZJS A;  4ZJT A;  5LJN A;  1D1B A;  2WWU A;  3P4W A;  3OVU A;  4ASK A;  1NEK A;  1YQ4 A;  5LCY A;  2H88 A;  1QLB A;  4YLH A;  1IBM T;  2BDE A;  4OYJ A;  1MMG A;  4IRE A;  4YTP A;  3AAE B;  3RH3 A;  5CFB A;  2FJB A;  5LJM A;  5FXW A;  5FP3 A;  3OJA A;  4NXN T;  2BZB A;  4QX8 B;  2F4V T;  2RP4 A;  2BVL A;  2X9W A;  2CPT A;  4IE6 A;  3C64 A;  1KEY A;  2LRL A;  3LK3 B;  2PTF A;  4XHE A;  3WI3 A;  2LT3 A;  2NW7 A;  3O1H A;  4Z91 A;  1HNZ T;  4HFH A;  2QRX A;  4IL9 A;  2ACX A;  4GIW A;  3AXJ A;  3ZC0 A;  2W8G A;  5CB4 E;  2XQ3 A;  3RI5 A;  4QAA A;  4WNK A;  2H3R A;  2B76 A;  3RHW A;  4CXW A;  1HNW T;  4K0K T;  5AQQ B;  3PUY F;  2XQ6 A;  2X0Y A;  2VKD A;  3VR8 A;  3JCF A;  4HWD A;  2LLY A;  3U8N A;  1QUU A;  4ZZB A;  4O2B E;  1G73 A;  2V7J A;  4ZOL E;  4ALX A;  3VHL A;  3O1I A;  2CXL A;  3P8C D;  1UX5 A;  2Y7Y A;  5AFL A;  5AFM A;  4UIG A;  4UXU A;  3AA1 B;  4H9S E;  3FZK B;  4ILA A;  4LML A;  3LK4 2;  1B7T A;  4IDQ A;  2YOE A;  1I9B A;  3K1S A;  4JI7 T;  5FNV E;  3PU3 A;  3N5L A;  2CHN A;  4G2A A;  4TWF A;  4YJ3 E;  3H37 A;  5IYZ E;  5E0O A;  3AE6 A;  3X1D A;  2L3L A;  5KX5 E;  3LDQ B;  5JH7 E;  2IIU A;  2WB5 A;  3N9O A;  4MHC A;  3T1Y T;  3GN5 B;  3QNU A;  3PUA A;  2Y58 A;  5JR9 C;  1UK5 A;  1WRD A;  4WBN E;  4DR4 T;  3RQW A;  2X67 A;  5SYO A;  3HA4 A;  3ZN1 B;  3KBT A;  4OYK A;  2IC6 A;  1M62 A;  4CZZ B;  4QH5 A;  4NUV A;  3HL6 A;  3WTI A;  2ZJV A;  3ZCI A;  2D0U A;  3A5X A;  1BR0 A;  1R8I A;  2AE9 A;  4DR5 T;  2BYP A;  4I43 B;  2UXC T;  2FJA A;  2LSJ A;  2K5B B;  3Q5D A;  4TV8 E;  2WP9 A;  2HPL A;  5HEU A;  2NOX A;  4B3R T;  4HTE A;  1SA0 E;  4DR7 T;  3P4S A;  4M1P A;  1KNZ A;  5KZU A;  2A72 A;  2J4G A;  3K3N A;  5A1L A;  5C8Y E;  4EV6 A;  3JAF A;  3HKC E;  3PUS A;  3K3Q C;  3QB5 K;  4U2Z A;  2X9Y A;  3PJA A;  4YFS A;  5F5W A;  1BR2 A;  3NVO A;  2I59 A;  4DV6 T;  3EHZ A;  2X0H A;  1D1A A;  2JQ9 A;  3ZMZ B;  1UW6 A;  2V1D B;  3U8K A;  5J5F A;  2DL1 A;  2H89 A;  4JV5 T;  2CBJ A;  3P4Q A;  3T4M A;  4ZI2 D;  2MAW A;  2V5C A;  4IT4 A;  2N2N A;  4AXP A;  3ZDH A;  3U3I A;  2C5I T;  5AQR B;  5LHH B;  4HKA A;  4PFP A;  3ZN0 B;  3GUA A;  3IHR A;  5JDM A;  3AEF A;  4B3S T;  3L3P A;  3KBU A;  3KV4 A;  4O2A E;  5BRX A;  2DLR A;  2BYS A;  4DBM A;  3LBX B;  4KP3 C;  4PK6 A;  4QWN B;  2N1G A;  3P4R A;  4Q25 A;  5JVD E;  4QKN A;  3RLF F;  5KMG P;  2KWI B;  2OA5 A;  3RYC E;  3DTO A;  2V7I A;  1VCT A;  4ZXL A;  3T1H T;  5JR9 B;  2BBJ A;  2BKO A;  2UU9 T;  3CQC B;  4I55 E;  3WTH A;  3I1A A;  2NTY A;  2CLY C;  1HR0 T;  4KX6 A;  2WNJ A;  5AQG B;  3GN5 A;  5AQS B;  1W0A A;  2XNU A;  3MXZ A;  4HFC A;  3NRY A;  2YDS A;  3ZT7 A;  4BAY B;  1UCU A;  1ZP0 A;  2OV9 A;  2W61 A;  5DQW A;  3N2K E;  5LG3 A;  2J62 A;  3CK6 A;  4LMJ A;  3HKD E;  5HEO A;  3UU3 A;  4DR2 T;  4FRR A;  3W15 B;  4IDZ A;  3I9W A;  3PMZ A;  5IHY A;  4TX5 A;  1ZV4 X;  1G8X A;  3IA3 A;  2P9B A;  3CQG B;  3BQL A;  3P50 A;  1D0X A;  1SUM B;  2XQ5 A;  4Z90 A;  5LGN B;  3EDU A;  4DBR A;  2IML A;  2QYW A;  3BK9 A;  3NBX X;  1N33 T;  2XHE B;  5JTG A;  4L5G A;  3UU6 A;  2IAK A;  3TLU A;  3RC8 A;  4JLE A;  3TLT A;  3ZYL A;  4CXX A;  2IW5 B;  5EZY E;  3ZPO A;  2LSI A;  3ONJ A;  1XMQ T;  1FJG T;  3B13 A;  5AFJ A;  1HS7 A;  4YTM A;  2DCF A;  3FXD B;  5AQP B;  5JDQ A;  4YJ2 E;  5FY0 A;  2JMH A;  1ZOY A;  2WZI A;  4H9P C;  4AQF A;  2WDR A;  3RKG A;  4EYU A;  1FMV A;  5CGM A;  1ZEE A;  1WYB A;  2VVN A;  2W2U A;  2VQF T;  1WFD A;  2XQA A;  3UFG A;  5L3D B;  4XK9 A;  1NEN A;  5HXE A;  2XTL A;  3J7Y q;  1HX8 A;  3IEE A;  3AE3 A;  4JEH B;  5LYJ E;  3C98 B;  3AEC A;  4YHJ A;  4E7S A;  4YHH T;  4P09 A;  2LSK A;  1W0B A;  3C4X A;  2D0T A;  5KXJ A;  2Y6X A;  3LBX A;  1WR0 A;  3AEB A;  3ZT6 A;  3PUX F;  4UF0 B;  3LSV A;  2FJD A;  3EVY A;  4LF8 T;  5FVL A;  5JRC B;  3D0T A;  2DI4 A;  4PIR A;  5AFK A;  1DU2 A;  5ETW A;  2D9D A;  4ILC A;  5JR9 A;  3FZL B;  5ABF B;  1HNX T;  3ONX A;  4HQP A;  3AE5 A;  2H7V C;  2WU5 A;  1D0Z A;  2LJL A;  4AKL A;  3SH1 A;  4EED A;  1YW0 A;  4PK5 A;  4O4I E;  2YU2 A;  3AAI A;  4DMW A;  2Y48 B;  4CI2 B;  2VL0 A;  4AKG A;  4EXT A;  2E9X D;  3OPC A;  2PG8 A;  3V5S A;  4HFB A;  4P0A A;  2VB6 A;  2YME A;  4OK0 A;  3WIP A;  4B3T T;  2E8I A;  3NZQ A;  4JBW F;  4TWD A;  1IZN B;  2ZMA A;  4I4T E;  2E9X C;  2JQK A;  3UUX B;  4E7Z A;  4IE4 A;  3VRB A;  2VK9 A;  3FBZ A;  5DJQ C;  4ISS A;  3PUZ F;  3O4X E;  1T72 A;  5HCM A;  5ABG A;  4GKK T;  4NUU A;  2CA5 A;  2V7M A;  4UR9 A;  3QK6 A;  5FXX A;  3R6N A;  1X79 A;  3AA7 B;  5CA1 E;  5EK3 A;  4HE8 A;  5FMN A;  4B6X A;  2DWK A;  2YK0 A;  4DR6 T;  3Q5E A;  2RA1 A;  3ZC1 A;  5FYM A;  1W9R A;  2XY8 B;  3U8L A;  3ONL C;  3A8Y C;  5AQF B;  3FBL A;  4UVB B;  3AEE A;  4HWF A;  3CVR A;  3RPU A;  1JNR A;  1LVF A;  4GYS A;  5HYA A;  4NPP A;  3RIU A;  4EGW A;  3NKZ A;  4TZ4 C;  2Y57 A;  2Q9Q D;  2CRB A;  2YN6 A;  5CA0 E;  4IE7 A;  2UZ6 A;  2Z6E A;  4PJL A;  3RRC A;  1XNQ T;  2X66 A;  3RKO A;  4X62 T;  2Q9Q C;  2WCA A;  2UXB T;  3ZMV B;  3R84 B;  2BG9 E;  5AQI B;  5M4Y A;  4UF0 A;  2LM9 A;  3GWH A;  4NXM T;  3BQI A;  2LM2 A;  5JRC A;  1IBK T;  4D01 A;  2XYS A;  4UY2 A;  3O1J A;  4OFZ A;  2KLQ A;  3WTM A;  5LGT B;  4NIQ A;  3AE4 A;  2XUE A;  4UXN B;  3ETU A;  2BJ0 A;  5AQV B;  5ABF A;  2I6H A;  2W62 A;  3O9X A;  3GMI A;  1CHU A;  2QC1 B;  3N9P A;  4YT0 A;  2MBG A;  1E7P A;  5J0Z A;  4U74 A;  3I0Q A;  2V8S V;  1KNP A;  2E9X B;  3AVS A;  4CN1 A;  3RIA A;  4X5T A;  4V1A v;  3KV6 A;  3ABV A;  3RX6 A;  2SPC A;  2BS4 A;  1U4Q A;  2LSG A;  1VRB A;  5L4E A;  1WCR A;  3J9X 1;  3UUN A;  4UEL A;  3IGQ A;  2M6I A;  4HEA A;  1LKX A;  5L3B B;  4QXB B;  4C91 A;  1NWM X;  2YU1 A;  2E2A A;  1IJ5 A;  4QH4 A;  5H6R B;  4TWH A;  4DUY T;  2W63 A;  5J5H A;  2DHR A;  2XQ9 A;  2NW9 A;  2DNX A;  3AEG A;  5HEG A;  3AE7 A;  3VKG A;  3SFE A;  5C2T A;  2W67 A;  3OTO T;  2WAU A;  5AFH A;  2E5V A;  1HG2 A;  2AXD S;  4A5X A;  2W8F A;  2VQE T;  4AQY T;  3C51 A;  2ODU A;  4TV9 E;  2V6X A;  2BG9 C;  5FL1 A;  4A98 A;  1FMW A;  4H9Q C;  3MAC A;  5FXZ A;  4AFT A;  3CKD A;  2XAF B;  4MAL A;  4DID B;  1J5E T;  5LGU B;  4B3M T;  2WNL A;  4BFQ A;  4QX7 B;  1I94 T;  2CM0 A;  3UU8 A;  3CX7 B;  4BQT A;  3UQ4 A;  5HXS A;  3NZP A;  4ANJ A;  1JNZ A;  1MND A;  2UUA T;  3JAE A;  5HXR A;  3PJA J;  2KMF A;  4JI5 T;  3K8P C;  3OYZ A;  4WYV A;  2YKS A;  2JRK A;  4AKI A;  4X1K E;  4WV9 A;  2OLT A;  2LKG A;  2XSA A;  1BR1 A;  5CJ5 A;  3UT5 E;  2YDR A;  5LG4 A;  4DR1 T;  5LMN T;  2ES0 A;  4ZS3 A;  2VUR A;  2PBI A;  3ZYK A;  5AQT B;  4I50 E;  4X1Y E;  1D0Y A;  3CWZ B;  4IDO A;  2XJ7 A;  3WTK A;  5JDH A;  2WN9 A;  2XAS B;  5L3C B;  3RIF A;  4QH1 A;  1Z8U A;  3U8J A;  3SQ6 A;  4GOU A;  3F31 A;  2X68 A;  4DV1 T;  1EZ3 A;  2VKJ A;  3MK7 C;  3RC3 A;  5H6Q B;  3AA6 B;  3SS1 A;  4COF A;  4ADZ A;  2WDQ A;  2ZJU A;  5TVC A;  4YTN A;  3H3A A;  3QC9 A;  2CEA A;  3TLV A;  2VKO A;  3LG7 A;  3ETV A;  3ZMU B;  1OWA A;  5J2U E;  1V9D A;  2ZM8 A;  4L9I A;  2E9X A;  3IF8 B;  3PUG A;  2VVS A;  5GON E;  3WTN A;  4CN4 A;  1AJ3 A;  2IC9 A;  1HG5 A;  5JDF A;  3H3M A;  1OXZ A;  5FXV A;  2MTQ A;  4H63 V;  4PNI A;  2BS3 A;  4H9O C;  2G0U A;  4DV7 T;  2W66 A;  2ACZ A;  2CE7 A;  5L3F B;  3RGL A;  2BR7 A;  3ZMS B;  3FZH B;  2CBI A;  3RRW A;  3VR9 A;  1IAP A;  5TAO A;  1N36 T;  2LRK A;  3IBP A;  3BQK A;  3ZYM A;  4YSZ A;  2X9H A;  2JPF A;  5IWA T;  5AIN A;  5ADX L;  2A2F X;  2VKH A;  2ZM2 A;  3ZMT B;  1UGO A;  4WBO A;  3GA8 A;  4BJN A;  3ANW B;  3ZKR A;  5C3J A;  1KK7 A;  4TNV A;  1I6Z A;  2M67 A;  4XAX B;  2I0M A;  3OKQ A;  2M6B A;  3KIN B;  1MMN A;  4QXC B;  5AQJ B;  2WNC A;  5FY1 A;  3C4W A;  3ZST A;  2W0G A;  2WZH A;  3WTJ A;  4IST A;  3SRZ A;  2JQQ A;  5FL0 A;  5AFN A;  4ILB A;  4EYY R;  1NAF A;  2XAJ B;  4K0U A;  5DAB A;  4AI6 A;  4H9N C;  3TKL B;  3N9M A;  3RYF E;  3KV5 A;  5AQH B;  3N9N A;  4JI8 T;  5DQV A;  3M3Z B;  2LEH A;  1E1H B;  3UFE A;  4DVD A;  1KFY A;  2QVA A;  4LFA T;  4DV3 T;  3NRX A;  4YSY A;  5FJV A;  2Y8D A;  3K3O A;  1Z0P A;  1L0V A;  2WZY A;  1XMO T;  5LNK A;  3SIO A;  1M7K A;  4U33 A;  3PUV F;  1HCI A;  2VAS A;  2V26 A;  3CQX C;  4U31 A;  2CCQ A;  1LVK A;  2DWG A;  3TLW A;  2LHR A;  4YSX A;  2NTX A;  5FKY A;  1T7S A;  2KXP B;  4PK4 A;  5FY7 A;  2CLY B;  2IUB A;  4JYA T;  4IGU A;  1FEW A;  4PW8 A;  3NWI A;  4LF4 T;  3KVB A;  3P4P A;  4ZI3 D;  3UU5 A;  4C90 A;  4UVA B;  3JAD A;  4U2Y A;  2X00 D;  1UV6 A;  3AE1 A;  2WWV A;  4J2C A;  4XZC A;  4ZI3 C;  5JDL A;  2WDV A;  4WZX A;  3FXE B;  2JQH A;  4ZEY A;  5LXB A;  3U8M A;  3PE0 A;  3B57 A;  2XQ4 A;  1UX2 A;  4HWC A;  4TN7 B;  4PJN A;  4BA9 A;  2LOP A;  5LBQ B;  2E5L T;  2ZM6 T;  3QUJ A;  4JUY A;  4ZHQ E;  4HWH A;  4EZH A;  5AFU L;  4ERR A;  5EK2 A;  3ZJ2 A;  1WLX A;  3MA9 A;  5HXC A;  2CWO A;  3UUM A;  2XM1 A;  4QAB A;  4DMV A;  4EZ4 A;  2ZLY A;  3MJX A;  2EHO D;  3LFM A;  3ANW A;  2XQY A;  4IE5 A;  2KWH A;  2MPK A;  4O4L E;  1SHZ C;  2CMR A;  4OX9 T;  1YKE B;  4JI6 T;  1MIV A;  4TUY E;  2MOZ A;  2EHO C;  3MZK B;  4YXD A;  3ZLI A;  2PFV A;  2WQY A;  2VWA A;  1IJ6 A;  3I9Y A;  2BYR A;  2A9U A;  1LRZ A;  4AFG A;  3ZT5 A;  1Y01 A;  2ZM0 A;  3TLS A;  3C79 A;  2W00 A;  2UXD T;  2XZ5 A;  2KSR A;  2XZE A;  4AQG A;  2UUB T;  4KMC A;  2L8K A;  4BJM A;  5JDG A;  2KZ7 B;  3AE9 A;  3C4Z A;  1HFA A;  4DR3 T;  4KHZ F;  2YIN A;  3PUW F;  4U3C A;  3F2E A;  5AQK B;  3EUH A;  2KIN B;  2WU2 A;  4ZK4 A;  2KND A;  4UM3 A;  2CHO A;  2V7K A;  4DV4 T;  3DP7 A;  5JQG E;  1OED E;  5L47 A;  2QA7 A;  3HKB E;  2VL8 A;  5ABH A;  4XBF B;  3ZDG A;  2V6Y B;  1US7 B;  2XNT A;  4X66 T;  2YDQ A;  1VOM A;  4AQF C;  4YY3 T;  3C50 A;  2ODV A;  3S4U A;  5BR8 T;  3WAK A;  4LFB T;  3MKD A;  3AE8 A;  3HKE E;  5BP0 A;  4JI2 T;  2C9T A;  3RF1 A;  2CWY A;  5AQN B;  3AED A;  3HR0 A;  2NR4 A;  1HX1 B;  3CPZ A;  4MFR A;  3JC6 D;  4AKH A;  4H63 H;  3ZJ1 A;  1CUN A;  1S35 A;  5AQU B;  4B5D A;  4AKR B;  3JC6 C;  4HWI B;  5J5I A;  2B1E A;  3OYX A;  4KBM B;  1KF6 A;  2GK9 A;  4PJM A;  5F8P A;  4LMK A;  1Y64 B;  2PH9 A;  2WBL A;  4DUZ T;  2BKN A;  1MIY A;  1ZKE A;  2CXD A;  1N32 T;  5J1G A;  4X1I E;  4UM3 P;  1GQE A;  2NWB A;  3B5M A;  3SWH A;  2XPK A;  2JMK A;  3Q5X A;  5HWX A;  1S94 A;  2FJE A;  4CN6 A;  2X9X A;  3SQ9 A;  2HPJ A;  1VCS A;  3L09 A;  5KE4 A;  2EHO B;  2YEV C;  2BYQ A;  5JRE A;  2K24 A;  1OED C;  4KUM B;  4JI1 T;  3OBV E;  3PV0 F;  2QGS A;  1XDP A;  2K3W A;  1MIW A;  3PEO A;  2XNV A;  5EK4 A;  4DND A;  2R6G F;  3SOL A;  3RQU A;  3AA0 B;  4EIW A;  4UEM A;  2IHR 1;  3U78 A;  4KI0 F;  3CIR A;  3ZCJ A;  3PUQ A;  3HI2 A;  3QB5 A;  4ZZC A;  4LFC T;  1WR6 A;  4LF6 T;  2IDO B;  4LF9 T;  5ABE A;  4Z8X A;  4AIU A;  4CI1 B;  2J47 A;  1FIO A;  1J1J A;  2LKH A;  3KVA A;  3UQ7 A;  1UX4 A;  2Q9Q B;  2BKP A;  3FB2 A;  5HEH A;  4FJO A;  1J5W A;  2X0L B;  3KV9 A;  1YXR A;  3EDV A;  4ZI7 E;  5LP6 E;  5BW2 A;  2XQ7 A;  3E08 A;  5KDM C;  4AFH A;  5JDN A;  2Y56 A;  4GYR A;  4HFV A;  2D5U A;  4UV8 B;  3RYH E;  1BR4 A;  4L0R A;  5LHI B;  2V6Y A;  4O4H E;  4DV0 T;  4U7I A;  4EAH A;  3Q5W A;  3ZEF B;  5LA6 E;  4ZI2 C;  3RIU C;  4JI0 T;  2XZ6 A;  3PDY A;  4UVC B;  5IUX A;  4QHO A;  4AIS A;  4LF5 T;  1ZHC A;  1HTJ F;  2BVM A;  4GK0 E;  4ZR6 A;  4O8S A;  2X00 A;  1MMA A;  4MLK A;  4F6R C;  4HFI A;  4IL4 A;  4A97 A;  4PJJ A;  3A7M A;  5L2L A;  5BMV E;  2XAG B;  3QOF A;  4DO0 A;  5HWY A;  3C84 A;  3LK2 B;  4I0U A;  2WM9 A;  3I0O A;  2Y54 A;  2WSS V;  5HXH A;  2H7O A;  3E22 E;  3KFW X;  4P0B A;  4QAC A;  4X64 T;  3VU7 H;  2HHH T;  4NZB A;  3E0Z A;  2V5D A;  2YMD A;  3ESL A;  5J5G A;  2LSY A;  5J2T E;  4TNW A;  2J1D G;  2XQ8 A;  3UU4 A;  4P1N A;  4OHF A;  3T8O A;  3AE2 A; 
#chains in the Genus database with same CATH homology
 5KZU A;  3ZKR A;  5AFJ A;  3WTK A;  4UXU A;  2BYR A;  3WTH A;  5J5I A;  3WIP A;  4ILA A;  4TNV A;  4AFG A;  3JAD A;  4LML A;  5J5H A;  2YN6 A;  2XQ9 A;  5HEH A;  2X00 D;  3JAF A;  2XYT A;  3TLS A;  3C79 A;  1OED B;  2WN9 A;  4TWD A;  4HFE A;  1UV6 A;  2UZ6 A;  2YOE A;  3RIF A;  1I9B A;  2WNJ A;  5JME A;  4QH1 A;  2XZ5 A;  4ZJS A;  2XQ7 A;  5BW2 A;  2M6B A;  4LMK A;  2PH9 A;  5HEG A;  4ZJT A;  2KSR A;  4AFH A;  3P4W A;  3U8J A;  2WNC A;  4TWF A;  3SQ6 A;  2BG9 B;  2Y56 A;  2XNU A;  4HFC A;  2YME A;  2XQA A;  4UM3 P;  5AFM B;  3EHZ A;  4XK9 A;  3WTJ A;  5LXB A;  5L4H A;  5AFH A;  3U8M A;  2BG9 E;  5AFN A;  1UW6 A;  2XQ4 A;  4ILB A;  4COF A;  1UX2 A;  2W8F A;  3U8K A;  5LG3 A;  2ZJU A;  5TVC A;  3WTL A;  4F8H A;  5J5F A;  4IRE A;  4UM3 S;  4ZK1 A;  3EAM A;  2BG9 C;  4LMJ A;  2LM2 A;  3TLV A;  4ZK4 A;  5HEO A;  4UM3 A;  5HCM A;  3UU3 A;  2Y58 A;  4D01 A;  2XYS A;  4UY2 A;  2XZ6 A;  5CFB A;  4A98 A;  3SQ9 A;  4FRR A;  1OED E;  5L47 A;  3WTM A;  5IUX A;  3T4M A;  3RQW A;  2PGZ A;  4AFT A;  5KE4 A;  5SYO A;  4ZRU A;  2MAW A;  2BYQ A;  3PMZ A;  5FJV A;  3ZDG A;  2BJ0 A;  3WTN A;  2XNT A;  1OED C;  2WNL A;  4BFQ A;  4ZR6 A;  3P50 A;  3LSV A;  3ZDH A;  4QH5 A;  2QC1 B;  2X00 A;  2WZY A;  3PEO A;  3UU8 A;  2XNV A;  4HFI A;  4IL4 A;  3UUB A;  4XHE A;  4A97 A;  3WTI A;  3UQ4 A;  5HCJ A;  3GUA A;  3WTO A;  4BQT A;  2XQ5 A;  4Z90 A;  5J0Z A;  4Z91 A;  2ZJV A;  5CO5 A;  3SIO A;  3JAE A;  3RQU A;  4EZ1 A;  4HFH A;  4PIR A;  5AFK A;  4QAB A;  3C84 A;  4IL9 A;  2Y54 A;  5BP0 A;  4ILC A;  2W8G A;  5BRX A;  2XQ3 A;  2C9T A;  2BYP A;  2YKS A;  2BYS A;  4DBM A;  3RI5 A;  3TLW A;  2BYN A;  2BR7 A;  4QAC A;  4ZZC A;  4HQP A;  4QAA A;  4WV9 A;  3U8L A;  5HEJ A;  2LKG A;  3RHW A;  4NZB A;  3RIA A;  3SH1 A;  4X5T A;  2YMD A;  5J5G A;  2XQ6 A;  4UM1 A;  3UU6 A;  4TNW A;  1OED A;  5L4E A;  5HEU A;  3TLU A;  2LLY A;  3U8N A;  4ZZB A;  2XQ8 A;  3UU4 A;  3IGQ A;  2M6I A;  3EI0 A;  3TLT A;  5AIN A;  2VL0 A;  4HFD A;  4B5D A;  4ALX A;  2BG9 A;  2LKH A;  4NPP A;  3UQ7 A;  4HFB A;  5AFL A;  2Y7Y A;  2Y57 A;  4QH4 A;  2BR8 A;  5AFM A;  3UU5 A;  4TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...