2BYQA

Crystal structure of aplysia californica achbp in complex with epibatidine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
b'DDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structures of Aplysia Achbp Complexes with Nicotinic Agonists and Antagonists Reveal Distinctive Binding Interfaces and Conformations.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 51
structure length 214
sequence length 214
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2byqA00
2BG9A 3U8MA 5BP0A 5AINA 3WTMA 4X5TA 3SH1A 3SQ9A 2XNVA 4ZJTA 5L47A 4Z90A 5BW2A 2W8GA 2XYTA 3U8LA 4QH1A 4UM3S 2BJ0A 2XQ4A 4UM1A 3RIFA 4ZR6A 3WTNA 4HFCA 3U8NA 3UU5A 2WNCA 2VL0A 4TNVA 5LXBA 3GUAA 4TNWA 3WTKA 2BR7A 4B5DA 4Z91A 2YN6A 5KZUA 3TLWA 2BYQA 3JADA 5AFJA 3RHWA 4UXUA 2BR8A 5AFNA 5JMEA 5IUXA 3U8JA 5HEHA 4LMKA 1UW6A 3TLUA 2Y57A 5HCJA 3TLSA 1I9BA 5L4EA 4ZK4A 4WV9A 2BYPA 5FJVA 4QH4A 4NPPA 3RIAA 2BYNA 2BG9C 2XQ3A 3PMZA 5AFMB 3WTLA 3ZKRA 3RQWA 5HEUA 3TLTA 5J5HA 2X00D 4IL9A 5CFBA 4A97A 3WIPA 3EI0A 3UU4A 4BQTA 2XZ5A 5L4HA 3SIOA 3ZDHA 5AFKA 4TWFA 3RQUA 2PGZA 3TLVA 3ZDGA 4HQPA 4IL4A 5HCMA 3UUBA 2XQAA 2XZ6A 2UZ6A 3LSVA 3WTJA 3UQ4A 4ZZBA 5AFMA 2C9TA 2WNJA 2XYSA 4HFHA 5TVCA 4UM3A 4F8HA 3SQ6A 2YMEA 4ZZCA 5J0ZA 4TWHA 3JAEA 2XQ9A 4QH5A 3P4WA 3UU8A 4ILAA 5HEGA 4AFHA 5LG3A 5J5FA 5SYOA 4IREA 4XK9A 5HEOA 2BG9E 2XQ6A 4LMJA 4QACA 4QAAA 2X00A 4QABA 3UU3A 4DBMA 2Y7YA 3UU6A 4EZ1A 4ILCA 5J5GA 3C84A 4AFGA 2Y58A 5KE4A 4ILBA 5AFLA 4COFA 3EHZA 4FRRA 4A98A 3WTOA 4LMLA 3WTIA 2WN9A 1UX2A 4UM3P 2XQ7A 4AFTA 3U8KA 2W8FA 4UY2A 4ALXA 2YOEA 4PIRA 3JAFA 4D01A 3UQ7A 4HFBA 4ZK1A 2WNLA 2ZJVA 2PH9A 3PEOA 5HEJA 2QC1B 5BRXA 4ZJSA 3T4MA 2BYRA 5AFHA 5J5IA 4HFIA 4HFDA 4ZRUA 4HFEA 4TWDA 2WZYA 2BG9B 2Y54A 2XQ8A 2YMDA 2XNTA 2YKSA 3IGQA 2ZJUA 2BYSA 1UV6A 2Y56A 3RI5A 2XQ5A 3C79A 4XHEA 3EAMA 5CO5A 3WTHA 4BFQA 3P50A 4NZBA 2XNUA
chains in the Genus database with same CATH superfamily
2BG9A 3U8MA 5BP0A 5AINA 3WTMA 4X5TA 3SH1A 3SQ9A 2XNVA 4ZJTA 5L47A 4Z90A 5BW2A 2W8GA 2XYTA 3U8LA 4QH1A 4UM3S 2BJ0A 2XQ4A 4UM1A 3RIFA 4ZR6A 3WTNA 4HFCA 3U8NA 3UU5A 2WNCA 2VL0A 4TNVA 5LXBA 3GUAA 4TNWA 3WTKA 2BR7A 4B5DA 4Z91A 2YN6A 5KZUA 3TLWA 2BYQA 3JADA 5AFJA 3RHWA 4UXUA 2BR8A 5AFNA 5JMEA 5IUXA 3U8JA 5HEHA 4LMKA 1UW6A 3TLUA 2Y57A 5HCJA 3TLSA 1I9BA 5L4EA 4ZK4A 4WV9A 2BYPA 5FJVA 4QH4A 4NPPA 3RIAA 2BYNA 2BG9C 2XQ3A 3PMZA 5AFMB 3WTLA 3ZKRA 3RQWA 5HEUA 3TLTA 5J5HA 2X00D 4IL9A 5CFBA 4A97A 3WIPA 3EI0A 3UU4A 4BQTA 2XZ5A 5L4HA 3SIOA 3ZDHA 5AFKA 4TWFA 3RQUA 2PGZA 3TLVA 3ZDGA 4HQPA 4IL4A 5HCMA 3UUBA 2XQAA 2XZ6A 2UZ6A 3LSVA 3WTJA 3UQ4A 4ZZBA 5AFMA 2C9TA 2WNJA 2XYSA 4HFHA 5TVCA 4UM3A 4F8HA 3SQ6A 2YMEA 4ZZCA 5J0ZA 4TWHA 3JAEA 2XQ9A 4QH5A 3P4WA 3UU8A 4ILAA 5HEGA 4AFHA 5LG3A 5J5FA 5SYOA 4IREA 4XK9A 5HEOA 2BG9E 2XQ6A 4LMJA 4QACA 4QAAA 2X00A 4QABA 3UU3A 4DBMA 2Y7YA 3UU6A 4EZ1A 4ILCA 5J5GA 3C84A 4AFGA 2Y58A 5KE4A 4ILBA 5AFLA 4COFA 3EHZA 4FRRA 4A98A 3WTOA 4LMLA 3WTIA 2WN9A 1UX2A 4UM3P 2XQ7A 4AFTA 3U8KA 2W8FA 4UY2A 4ALXA 2YOEA 4PIRA 3JAFA 4D01A 3UQ7A 4HFBA 4ZK1A 2WNLA 2ZJVA 2PH9A 3PEOA 5HEJA 2QC1B 5BRXA 4ZJSA 3T4MA 2BYRA 5AFHA 5J5IA 4HFIA 4HFDA 4ZRUA 4HFEA 4TWDA 2WZYA 2BG9B 2Y54A 2XQ8A 2YMDA 2XNTA 2YKSA 3IGQA 2ZJUA 2BYSA 1UV6A 2Y56A 3RI5A 2XQ5A 3C79A 4XHEA 3EAMA 5CO5A 3WTHA 4BFQA 3P50A 4NZBA 2XNUA
chains in the Genus database with same CATH topology
2BG9A 3U8MA 5BP0A 5AINA 3WTMA 4X5TA 3SH1A 3SQ9A 2XNVA 4ZJTA 5L47A 4Z90A 5BW2A 2W8GA 2XYTA 3U8LA 4QH1A 4UM3S 2BJ0A 2XQ4A 4UM1A 3RIFA 4ZR6A 3WTNA 4HFCA 3U8NA 3UU5A 2WNCA 2VL0A 4TNVA 5LXBA 3GUAA 4TNWA 3WTKA 2BR7A 4B5DA 4Z91A 2YN6A 5KZUA 3TLWA 2BYQA 3JADA 5AFJA 3RHWA 4UXUA 2BR8A 5AFNA 5JMEA 5IUXA 3U8JA 5HEHA 4LMKA 1UW6A 3TLUA 2Y57A 5HCJA 3TLSA 1I9BA 5L4EA 4ZK4A 4WV9A 2BYPA 5FJVA 4QH4A 4NPPA 3RIAA 2BYNA 2BG9C 2XQ3A 3PMZA 5AFMB 3WTLA 3ZKRA 3RQWA 5HEUA 3TLTA 5J5HA 2X00D 4IL9A 5CFBA 4A97A 3WIPA 3EI0A 3UU4A 4BQTA 2XZ5A 5L4HA 3SIOA 3ZDHA 5AFKA 4TWFA 3RQUA 2PGZA 3TLVA 3ZDGA 4HQPA 4IL4A 5HCMA 3UUBA 2XQAA 2XZ6A 2UZ6A 3LSVA 3WTJA 3UQ4A 4ZZBA 5AFMA 2C9TA 2WNJA 2XYSA 4HFHA 5TVCA 4UM3A 4F8HA 3SQ6A 2YMEA 4ZZCA 5J0ZA 4TWHA 3JAEA 2XQ9A 4QH5A 3P4WA 3UU8A 4ILAA 5HEGA 4AFHA 5LG3A 5J5FA 5SYOA 4IREA 4XK9A 5HEOA 2BG9E 2XQ6A 4LMJA 4QACA 4QAAA 2X00A 4QABA 3UU3A 4DBMA 2Y7YA 3UU6A 4EZ1A 4ILCA 5J5GA 3C84A 4AFGA 2Y58A 5KE4A 4ILBA 5AFLA 4COFA 3EHZA 4FRRA 4A98A 3WTOA 4LMLA 3WTIA 2WN9A 1UX2A 4UM3P 2XQ7A 4AFTA 3U8KA 2W8FA 4UY2A 4ALXA 2YOEA 4PIRA 3JAFA 4D01A 3UQ7A 4HFBA 4ZK1A 2WNLA 2ZJVA 2PH9A 3PEOA 5HEJA 2QC1B 5BRXA 4ZJSA 3T4MA 2BYRA 5AFHA 5J5IA 4HFIA 4HFDA 4ZRUA 4HFEA 4TWDA 2WZYA 2BG9B 2Y54A 2XQ8A 2YMDA 2XNTA 2YKSA 3IGQA 2ZJUA 2BYSA 1UV6A 2Y56A 3RI5A 2XQ5A 3C79A 4XHEA 3EAMA 5CO5A 3WTHA 4BFQA 3P50A 4NZBA 2XNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG9 A;  3U8M A;  5BP0 A;  5AIN A;  3WTM A;  4X5T A;  3SH1 A;  3SQ9 A;  2XNV A;  4ZJT A;  5L47 A;  4Z90 A;  5BW2 A;  2W8G A;  2XYT A;  3U8L A;  4QH1 A;  4UM3 S;  2BJ0 A;  2XQ4 A;  4UM1 A;  3RIF A;  4ZR6 A;  3WTN A;  4HFC A;  3U8N A;  3UU5 A;  2WNC A;  2VL0 A;  4TNV A;  5LXB A;  3GUA A;  4TNW A;  3WTK A;  2BR7 A;  4B5D A;  4Z91 A;  2YN6 A;  5KZU A;  3TLW A;  2BYQ A;  3JAD A;  5AFJ A;  3RHW A;  4UXU A;  2BR8 A;  5AFN A;  5JME A;  5IUX A;  3U8J A;  5HEH A;  4LMK A;  1UW6 A;  3TLU A;  2Y57 A;  5HCJ A;  3TLS A;  1I9B A;  5L4E A;  4ZK4 A;  4WV9 A;  2BYP A;  5FJV A;  4QH4 A;  4NPP A;  3RIA A;  2BYN A;  2BG9 C;  2XQ3 A;  3PMZ A;  5AFM B;  3WTL A;  3ZKR A;  3RQW A;  5HEU A;  3TLT A;  5J5H A;  2X00 D;  4IL9 A;  5CFB A;  4A97 A;  3WIP A;  3EI0 A;  3UU4 A;  4BQT A;  2XZ5 A;  5L4H A;  3SIO A;  3ZDH A;  5AFK A;  4TWF A;  3RQU A;  2PGZ A;  3TLV A;  3ZDG A;  4HQP A;  4IL4 A;  5HCM A;  3UUB A;  2XQA A;  2XZ6 A;  2UZ6 A;  3LSV A;  3WTJ A;  3UQ4 A;  4ZZB A;  5AFM A;  2C9T A;  2WNJ A;  2XYS A;  4HFH A;  5TVC A;  4UM3 A;  4F8H A;  3SQ6 A;  2YME A;  4ZZC A;  5J0Z A;  4TWH A;  3JAE A;  2XQ9 A;  4QH5 A;  3P4W A;  3UU8 A;  4ILA A;  5HEG A;  4AFH A;  5LG3 A;  5J5F A;  5SYO A;  4IRE A;  4XK9 A;  5HEO A;  2BG9 E;  2XQ6 A;  4LMJ A;  4QAC A;  4QAA A;  2X00 A;  4QAB A;  3UU3 A;  4DBM A;  2Y7Y A;  3UU6 A;  4EZ1 A;  4ILC A;  5J5G A;  3C84 A;  4AFG A;  2Y58 A;  5KE4 A;  4ILB A;  5AFL A;  4COF A;  3EHZ A;  4FRR A;  4A98 A;  3WTO A;  4LML A;  3WTI A;  2WN9 A;  1UX2 A;  4UM3 P;  2XQ7 A;  4AFT A;  3U8K A;  2W8F A;  4UY2 A;  4ALX A;  2YOE A;  4PIR A;  3JAF A;  4D01 A;  3UQ7 A;  4HFB A;  4ZK1 A;  2WNL A;  2ZJV A;  2PH9 A;  3PEO A;  5HEJ A;  2QC1 B;  5BRX A;  4ZJS A;  3T4M A;  2BYR A;  5AFH A;  5J5I A;  4HFI A;  4HFD A;  4ZRU A;  4HFE A;  4TWD A;  2WZY A;  2BG9 B;  2Y54 A;  2XQ8 A;  2YMD A;  2XNT A;  2YKS A;  3IGQ A;  2ZJU A;  2BYS A;  1UV6 A;  2Y56 A;  3RI5 A;  2XQ5 A;  3C79 A;  4XHE A;  3EAM A;  5CO5 A;  3WTH A;  4BFQ A;  3P50 A;  4NZB A;  2XNU A; 
#chains in the Genus database with same CATH topology
 2BG9 A;  3U8M A;  5BP0 A;  5AIN A;  3WTM A;  4X5T A;  3SH1 A;  3SQ9 A;  2XNV A;  4ZJT A;  5L47 A;  4Z90 A;  5BW2 A;  2W8G A;  2XYT A;  3U8L A;  4QH1 A;  4UM3 S;  2BJ0 A;  2XQ4 A;  4UM1 A;  3RIF A;  4ZR6 A;  3WTN A;  4HFC A;  3U8N A;  3UU5 A;  2WNC A;  2VL0 A;  4TNV A;  5LXB A;  3GUA A;  4TNW A;  3WTK A;  2BR7 A;  4B5D A;  4Z91 A;  2YN6 A;  5KZU A;  3TLW A;  2BYQ A;  3JAD A;  5AFJ A;  3RHW A;  4UXU A;  2BR8 A;  5AFN A;  5JME A;  5IUX A;  3U8J A;  5HEH A;  4LMK A;  1UW6 A;  3TLU A;  2Y57 A;  5HCJ A;  3TLS A;  1I9B A;  5L4E A;  4ZK4 A;  4WV9 A;  2BYP A;  5FJV A;  4QH4 A;  4NPP A;  3RIA A;  2BYN A;  2BG9 C;  2XQ3 A;  3PMZ A;  5AFM B;  3WTL A;  3ZKR A;  3RQW A;  5HEU A;  3TLT A;  5J5H A;  2X00 D;  4IL9 A;  5CFB A;  4A97 A;  3WIP A;  3EI0 A;  3UU4 A;  4BQT A;  2XZ5 A;  5L4H A;  3SIO A;  3ZDH A;  5AFK A;  4TWF A;  3RQU A;  2PGZ A;  3TLV A;  3ZDG A;  4HQP A;  4IL4 A;  5HCM A;  3UUB A;  2XQA A;  2XZ6 A;  2UZ6 A;  3LSV A;  3WTJ A;  3UQ4 A;  4ZZB A;  5AFM A;  2C9T A;  2WNJ A;  2XYS A;  4HFH A;  5TVC A;  4UM3 A;  4F8H A;  3SQ6 A;  2YME A;  4ZZC A;  5J0Z A;  4TWH A;  3JAE A;  2XQ9 A;  4QH5 A;  3P4W A;  3UU8 A;  4ILA A;  5HEG A;  4AFH A;  5LG3 A;  5J5F A;  5SYO A;  4IRE A;  4XK9 A;  5HEO A;  2BG9 E;  2XQ6 A;  4LMJ A;  4QAC A;  4QAA A;  2X00 A;  4QAB A;  3UU3 A;  4DBM A;  2Y7Y A;  3UU6 A;  4EZ1 A;  4ILC A;  5J5G A;  3C84 A;  4AFG A;  2Y58 A;  5KE4 A;  4ILB A;  5AFL A;  4COF A;  3EHZ A;  4FRR A;  4A98 A;  3WTO A;  4LML A;  3WTI A;  2WN9 A;  1UX2 A;  4UM3 P;  2XQ7 A;  4AFT A;  3U8K A;  2W8F A;  4UY2 A;  4ALX A;  2YOE A;  4PIR A;  3JAF A;  4D01 A;  3UQ7 A;  4HFB A;  4ZK1 A;  2WNL A;  2ZJV A;  2PH9 A;  3PEO A;  5HEJ A;  2QC1 B;  5BRX A;  4ZJS A;  3T4M A;  2BYR A;  5AFH A;  5J5I A;  4HFI A;  4HFD A;  4ZRU A;  4HFE A;  4TWD A;  2WZY A;  2BG9 B;  2Y54 A;  2XQ8 A;  2YMD A;  2XNT A;  2YKS A;  3IGQ A;  2ZJU A;  2BYS A;  1UV6 A;  2Y56 A;  3RI5 A;  2XQ5 A;  3C79 A;  4XHE A;  3EAM A;  5CO5 A;  3WTH A;  4BFQ A;  3P50 A;  4NZB A;  2XNU A; 
#chains in the Genus database with same CATH homology
 2BG9 A;  3U8M A;  5BP0 A;  5AIN A;  3WTM A;  4X5T A;  3SH1 A;  3SQ9 A;  2XNV A;  4ZJT A;  5L47 A;  4Z90 A;  5BW2 A;  2W8G A;  2XYT A;  3U8L A;  4QH1 A;  4UM3 S;  2BJ0 A;  2XQ4 A;  4UM1 A;  3RIF A;  4ZR6 A;  3WTN A;  4HFC A;  3U8N A;  3UU5 A;  2WNC A;  2VL0 A;  4TNV A;  5LXB A;  3GUA A;  4TNW A;  3WTK A;  2BR7 A;  4B5D A;  4Z91 A;  2YN6 A;  5KZU A;  3TLW A;  2BYQ A;  3JAD A;  5AFJ A;  3RHW A;  4UXU A;  2BR8 A;  5AFN A;  5JME A;  5IUX A;  3U8J A;  5HEH A;  4LMK A;  1UW6 A;  3TLU A;  2Y57 A;  5HCJ A;  3TLS A;  1I9B A;  5L4E A;  4ZK4 A;  4WV9 A;  2BYP A;  5FJV A;  4QH4 A;  4NPP A;  3RIA A;  2BYN A;  2BG9 C;  2XQ3 A;  3PMZ A;  5AFM B;  3WTL A;  3ZKR A;  3RQW A;  5HEU A;  3TLT A;  5J5H A;  2X00 D;  4IL9 A;  5CFB A;  4A97 A;  3WIP A;  3EI0 A;  3UU4 A;  4BQT A;  2XZ5 A;  5L4H A;  3SIO A;  3ZDH A;  5AFK A;  4TWF A;  3RQU A;  2PGZ A;  3TLV A;  3ZDG A;  4HQP A;  4IL4 A;  5HCM A;  3UUB A;  2XQA A;  2XZ6 A;  2UZ6 A;  3LSV A;  3WTJ A;  3UQ4 A;  4ZZB A;  5AFM A;  2C9T A;  2WNJ A;  2XYS A;  4HFH A;  5TVC A;  4UM3 A;  4F8H A;  3SQ6 A;  2YME A;  4ZZC A;  5J0Z A;  4TWH A;  3JAE A;  2XQ9 A;  4QH5 A;  3P4W A;  3UU8 A;  4ILA A;  5HEG A;  4AFH A;  5LG3 A;  5J5F A;  5SYO A;  4IRE A;  4XK9 A;  5HEO A;  2BG9 E;  2XQ6 A;  4LMJ A;  4QAC A;  4QAA A;  2X00 A;  4QAB A;  3UU3 A;  4DBM A;  2Y7Y A;  3UU6 A;  4EZ1 A;  4ILC A;  5J5G A;  3C84 A;  4AFG A;  2Y58 A;  5KE4 A;  4ILB A;  5AFL A;  4COF A;  3EHZ A;  4FRR A;  4A98 A;  3WTO A;  4LML A;  3WTI A;  2WN9 A;  1UX2 A;  4UM3 P;  2XQ7 A;  4AFT A;  3U8K A;  2W8F A;  4UY2 A;  4ALX A;  2YOE A;  4PIR A;  3JAF A;  4D01 A;  3UQ7 A;  4HFB A;  4ZK1 A;  2WNL A;  2ZJV A;  2PH9 A;  3PEO A;  5HEJ A;  2QC1 B;  5BRX A;  4ZJS A;  3T4M A;  2BYR A;  5AFH A;  5J5I A;  4HFI A;  4HFD A;  4ZRU A;  4HFE A;  4TWD A;  2WZY A;  2BG9 B;  2Y54 A;  2XQ8 A;  2YMD A;  2XNT A;  2YKS A;  3IGQ A;  2ZJU A;  2BYS A;  1UV6 A;  2Y56 A;  3RI5 A;  2XQ5 A;  3C79 A;  4XHE A;  3EAM A;  5CO5 A;  3WTH A;  4BFQ A;  3P50 A;  4NZB A;  2XNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...