2BYQA

Crystal structure of aplysia californica achbp in complex with epibatidine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structures of Aplysia Achbp Complexes with Nicotinic Agonists and Antagonists Reveal Distinctive Binding Interfaces and Conformations.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 51
structure length 214
sequence length 214
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2byqA00
3UU6A 4ZZCA 3UU5A 2Y57A 2PH9A 2XQ3A 2BR7A 2XYTA 3C84A 4UM3S 5JMEA 4HFBA 2BJ0A 1UV6A 5AFMA 3GUAA 3IGQA 5HEOA 4HFCA 3SIOA 3TLVA 3UQ4A 3ZDHA 3RQUA 5HEGA 3JAFA 4NPPA 5LXBA 2BG9A 5L4HA 4TNVA 2XYSA 3UU3A 5LG3A 5AFKA 5L47A 1I9BA 3RHWA 4IREA 3WTHA 4WV9A 2Y54A 2ZJUA 2WNJA 3JADA 4Z91A 2BG9C 2XNVA 2VL0A 5HEHA 2WN9A 2QC1B 3U8LA 2W8GA 2XQ8A 5AFMB 3EAMA 2XNUA 5AFNA 3U8MA 4UM3A 4ZZBA 2YOEA 5BRXA 2BR8A 2XQ7A 2BG9B 4TWFA 3WTNA 3P4WA 3TLUA 5FJVA 4QABA 4Z90A 4A97A 2WNLA 3P50A 3WTIA 4IL4A 2WNCA 2BYRA 5HEJA 5HCMA 3RIAA 2BYSA 5L4EA 5CFBA 4COFA 4ZK4A 2YN6A 4F8HA 2YMEA 2XQ4A 3UU4A 5AFHA 2BYPA 2BG9E 4ILBA 2XQAA 2Y58A 3SH1A 4EZ1A 4FRRA 5TVCA 2XQ5A 5AINA 3EHZA 2XQ6A 2XZ5A 3JAEA 4IL9A 4UXUA 5AFLA 4ILCA 4AFHA 4ZK1A 2XQ9A 5J5HA 4HFHA 3C79A 4XK9A 1UW6A 3UUBA 3PMZA 2XNTA 4NZBA 5J5GA 3TLWA 4AFTA 4ZR6A 4A98A 2UZ6A 5AFJA 3WIPA 4UY2A 5HEUA 2W8FA 3TLSA 4ALXA 5IUXA 4HFDA 4X5TA 5J0ZA 4QH5A 2BYQA 2X00D 4XHEA 3RI5A 3WTMA 3UQ7A 4LMJA 4BFQA 3U8KA 4QAAA 2XZ6A 2X00A 4QH4A 4DBMA 4TWDA 4D01A 3ZKRA 4B5DA 5BP0A 3ZDGA 5HCJA 2ZJVA 4QH1A 3SQ9A 4QACA 2Y56A 3T4MA 3TLTA 4HFIA 5SYOA 4TWHA 3WTOA 4UM3P 4PIRA 3U8NA 3WTLA 5J5IA 4HFEA 4HQPA 3WTKA 2PGZA 3PEOA 5J5FA 4LMKA 3RQWA 4ZJSA 2WZYA 2YMDA 2BYNA 2YKSA 4ILAA 5KZUA 4BQTA 5CO5A 3EI0A 4TNWA 3U8JA 4ZJTA 3UU8A 2C9TA 3LSVA 3SQ6A 2Y7YA 4UM1A 4AFGA 3RIFA 5KE4A 4ZRUA 1UX2A 3WTJA 5BW2A 4LMLA
chains in the Genus database with same CATH superfamily
3UU6A 4ZZCA 3UU5A 2Y57A 2PH9A 2XQ3A 2BR7A 2XYTA 3C84A 4UM3S 5JMEA 4HFBA 2BJ0A 1UV6A 5AFMA 3GUAA 3IGQA 5HEOA 4HFCA 3SIOA 3TLVA 3UQ4A 3ZDHA 3RQUA 5HEGA 3JAFA 4NPPA 5LXBA 2BG9A 5L4HA 4TNVA 2XYSA 3UU3A 5LG3A 5AFKA 5L47A 1I9BA 3RHWA 4IREA 3WTHA 4WV9A 2Y54A 2ZJUA 2WNJA 3JADA 4Z91A 2BG9C 2XNVA 2VL0A 5HEHA 2WN9A 2QC1B 3U8LA 2W8GA 2XQ8A 5AFMB 3EAMA 2XNUA 5AFNA 3U8MA 4UM3A 4ZZBA 2YOEA 5BRXA 2BR8A 2XQ7A 2BG9B 4TWFA 3WTNA 3P4WA 3TLUA 5FJVA 4QABA 4Z90A 4A97A 2WNLA 3P50A 3WTIA 4IL4A 2WNCA 2BYRA 5HEJA 5HCMA 3RIAA 2BYSA 5L4EA 5CFBA 4COFA 4ZK4A 2YN6A 4F8HA 2YMEA 2XQ4A 3UU4A 5AFHA 2BYPA 2BG9E 4ILBA 2XQAA 2Y58A 3SH1A 4EZ1A 4FRRA 5TVCA 2XQ5A 5AINA 3EHZA 2XQ6A 2XZ5A 3JAEA 4IL9A 4UXUA 5AFLA 4ILCA 4AFHA 4ZK1A 2XQ9A 5J5HA 4HFHA 3C79A 4XK9A 1UW6A 3UUBA 3PMZA 2XNTA 4NZBA 5J5GA 3TLWA 4AFTA 4ZR6A 4A98A 2UZ6A 5AFJA 3WIPA 4UY2A 5HEUA 2W8FA 3TLSA 4ALXA 5IUXA 4HFDA 4X5TA 5J0ZA 4QH5A 2BYQA 2X00D 4XHEA 3RI5A 3WTMA 3UQ7A 4LMJA 4BFQA 3U8KA 4QAAA 2XZ6A 2X00A 4QH4A 4DBMA 4TWDA 4D01A 3ZKRA 4B5DA 5BP0A 3ZDGA 5HCJA 2ZJVA 4QH1A 3SQ9A 4QACA 2Y56A 3T4MA 3TLTA 4HFIA 5SYOA 4TWHA 3WTOA 4UM3P 4PIRA 3U8NA 3WTLA 5J5IA 4HFEA 4HQPA 3WTKA 2PGZA 3PEOA 5J5FA 4LMKA 3RQWA 4ZJSA 2WZYA 2YMDA 2BYNA 2YKSA 4ILAA 5KZUA 4BQTA 5CO5A 3EI0A 4TNWA 3U8JA 4ZJTA 3UU8A 2C9TA 3LSVA 3SQ6A 2Y7YA 4UM1A 4AFGA 3RIFA 5KE4A 4ZRUA 1UX2A 3WTJA 5BW2A 4LMLA
chains in the Genus database with same CATH topology
3UU6A 4ZZCA 3UU5A 2Y57A 2PH9A 2XQ3A 2BR7A 2XYTA 3C84A 4UM3S 5JMEA 4HFBA 2BJ0A 1UV6A 5AFMA 3GUAA 3IGQA 5HEOA 4HFCA 3SIOA 3TLVA 3UQ4A 3ZDHA 3RQUA 5HEGA 3JAFA 4NPPA 5LXBA 2BG9A 5L4HA 4TNVA 2XYSA 3UU3A 5LG3A 5AFKA 5L47A 1I9BA 3RHWA 4IREA 3WTHA 4WV9A 2Y54A 2ZJUA 2WNJA 3JADA 4Z91A 2BG9C 2XNVA 2VL0A 5HEHA 2WN9A 2QC1B 3U8LA 2W8GA 2XQ8A 5AFMB 3EAMA 2XNUA 5AFNA 3U8MA 4UM3A 4ZZBA 2YOEA 5BRXA 2BR8A 2XQ7A 2BG9B 4TWFA 3WTNA 3P4WA 3TLUA 5FJVA 4QABA 4Z90A 4A97A 2WNLA 3P50A 3WTIA 4IL4A 2WNCA 2BYRA 5HEJA 5HCMA 3RIAA 2BYSA 5L4EA 5CFBA 4COFA 4ZK4A 2YN6A 4F8HA 2YMEA 2XQ4A 3UU4A 5AFHA 2BYPA 2BG9E 4ILBA 2XQAA 2Y58A 3SH1A 4EZ1A 4FRRA 5TVCA 2XQ5A 5AINA 3EHZA 2XQ6A 2XZ5A 3JAEA 4IL9A 4UXUA 5AFLA 4ILCA 4AFHA 4ZK1A 2XQ9A 5J5HA 4HFHA 3C79A 4XK9A 1UW6A 3UUBA 3PMZA 2XNTA 4NZBA 5J5GA 3TLWA 4AFTA 4ZR6A 4A98A 2UZ6A 5AFJA 3WIPA 4UY2A 5HEUA 2W8FA 3TLSA 4ALXA 5IUXA 4HFDA 4X5TA 5J0ZA 4QH5A 2BYQA 2X00D 4XHEA 3RI5A 3WTMA 3UQ7A 4LMJA 4BFQA 3U8KA 4QAAA 2XZ6A 2X00A 4QH4A 4DBMA 4TWDA 4D01A 3ZKRA 4B5DA 5BP0A 3ZDGA 5HCJA 2ZJVA 4QH1A 3SQ9A 4QACA 2Y56A 3T4MA 3TLTA 4HFIA 5SYOA 4TWHA 3WTOA 4UM3P 4PIRA 3U8NA 3WTLA 5J5IA 4HFEA 4HQPA 3WTKA 2PGZA 3PEOA 5J5FA 4LMKA 3RQWA 4ZJSA 2WZYA 2YMDA 2BYNA 2YKSA 4ILAA 5KZUA 4BQTA 5CO5A 3EI0A 4TNWA 3U8JA 4ZJTA 3UU8A 2C9TA 3LSVA 3SQ6A 2Y7YA 4UM1A 4AFGA 3RIFA 5KE4A 4ZRUA 1UX2A 3WTJA 5BW2A 4LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU6 A;  4ZZC A;  3UU5 A;  2Y57 A;  2PH9 A;  2XQ3 A;  2BR7 A;  2XYT A;  3C84 A;  4UM3 S;  5JME A;  4HFB A;  2BJ0 A;  1UV6 A;  5AFM A;  3GUA A;  3IGQ A;  5HEO A;  4HFC A;  3SIO A;  3TLV A;  3UQ4 A;  3ZDH A;  3RQU A;  5HEG A;  3JAF A;  4NPP A;  5LXB A;  2BG9 A;  5L4H A;  4TNV A;  2XYS A;  3UU3 A;  5LG3 A;  5AFK A;  5L47 A;  1I9B A;  3RHW A;  4IRE A;  3WTH A;  4WV9 A;  2Y54 A;  2ZJU A;  2WNJ A;  3JAD A;  4Z91 A;  2BG9 C;  2XNV A;  2VL0 A;  5HEH A;  2WN9 A;  2QC1 B;  3U8L A;  2W8G A;  2XQ8 A;  5AFM B;  3EAM A;  2XNU A;  5AFN A;  3U8M A;  4UM3 A;  4ZZB A;  2YOE A;  5BRX A;  2BR8 A;  2XQ7 A;  2BG9 B;  4TWF A;  3WTN A;  3P4W A;  3TLU A;  5FJV A;  4QAB A;  4Z90 A;  4A97 A;  2WNL A;  3P50 A;  3WTI A;  4IL4 A;  2WNC A;  2BYR A;  5HEJ A;  5HCM A;  3RIA A;  2BYS A;  5L4E A;  5CFB A;  4COF A;  4ZK4 A;  2YN6 A;  4F8H A;  2YME A;  2XQ4 A;  3UU4 A;  5AFH A;  2BYP A;  2BG9 E;  4ILB A;  2XQA A;  2Y58 A;  3SH1 A;  4EZ1 A;  4FRR A;  5TVC A;  2XQ5 A;  5AIN A;  3EHZ A;  2XQ6 A;  2XZ5 A;  3JAE A;  4IL9 A;  4UXU A;  5AFL A;  4ILC A;  4AFH A;  4ZK1 A;  2XQ9 A;  5J5H A;  4HFH A;  3C79 A;  4XK9 A;  1UW6 A;  3UUB A;  3PMZ A;  2XNT A;  4NZB A;  5J5G A;  3TLW A;  4AFT A;  4ZR6 A;  4A98 A;  2UZ6 A;  5AFJ A;  3WIP A;  4UY2 A;  5HEU A;  2W8F A;  3TLS A;  4ALX A;  5IUX A;  4HFD A;  4X5T A;  5J0Z A;  4QH5 A;  2BYQ A;  2X00 D;  4XHE A;  3RI5 A;  3WTM A;  3UQ7 A;  4LMJ A;  4BFQ A;  3U8K A;  4QAA A;  2XZ6 A;  2X00 A;  4QH4 A;  4DBM A;  4TWD A;  4D01 A;  3ZKR A;  4B5D A;  5BP0 A;  3ZDG A;  5HCJ A;  2ZJV A;  4QH1 A;  3SQ9 A;  4QAC A;  2Y56 A;  3T4M A;  3TLT A;  4HFI A;  5SYO A;  4TWH A;  3WTO A;  4UM3 P;  4PIR A;  3U8N A;  3WTL A;  5J5I A;  4HFE A;  4HQP A;  3WTK A;  2PGZ A;  3PEO A;  5J5F A;  4LMK A;  3RQW A;  4ZJS A;  2WZY A;  2YMD A;  2BYN A;  2YKS A;  4ILA A;  5KZU A;  4BQT A;  5CO5 A;  3EI0 A;  4TNW A;  3U8J A;  4ZJT A;  3UU8 A;  2C9T A;  3LSV A;  3SQ6 A;  2Y7Y A;  4UM1 A;  4AFG A;  3RIF A;  5KE4 A;  4ZRU A;  1UX2 A;  3WTJ A;  5BW2 A;  4LML A; 
#chains in the Genus database with same CATH topology
 3UU6 A;  4ZZC A;  3UU5 A;  2Y57 A;  2PH9 A;  2XQ3 A;  2BR7 A;  2XYT A;  3C84 A;  4UM3 S;  5JME A;  4HFB A;  2BJ0 A;  1UV6 A;  5AFM A;  3GUA A;  3IGQ A;  5HEO A;  4HFC A;  3SIO A;  3TLV A;  3UQ4 A;  3ZDH A;  3RQU A;  5HEG A;  3JAF A;  4NPP A;  5LXB A;  2BG9 A;  5L4H A;  4TNV A;  2XYS A;  3UU3 A;  5LG3 A;  5AFK A;  5L47 A;  1I9B A;  3RHW A;  4IRE A;  3WTH A;  4WV9 A;  2Y54 A;  2ZJU A;  2WNJ A;  3JAD A;  4Z91 A;  2BG9 C;  2XNV A;  2VL0 A;  5HEH A;  2WN9 A;  2QC1 B;  3U8L A;  2W8G A;  2XQ8 A;  5AFM B;  3EAM A;  2XNU A;  5AFN A;  3U8M A;  4UM3 A;  4ZZB A;  2YOE A;  5BRX A;  2BR8 A;  2XQ7 A;  2BG9 B;  4TWF A;  3WTN A;  3P4W A;  3TLU A;  5FJV A;  4QAB A;  4Z90 A;  4A97 A;  2WNL A;  3P50 A;  3WTI A;  4IL4 A;  2WNC A;  2BYR A;  5HEJ A;  5HCM A;  3RIA A;  2BYS A;  5L4E A;  5CFB A;  4COF A;  4ZK4 A;  2YN6 A;  4F8H A;  2YME A;  2XQ4 A;  3UU4 A;  5AFH A;  2BYP A;  2BG9 E;  4ILB A;  2XQA A;  2Y58 A;  3SH1 A;  4EZ1 A;  4FRR A;  5TVC A;  2XQ5 A;  5AIN A;  3EHZ A;  2XQ6 A;  2XZ5 A;  3JAE A;  4IL9 A;  4UXU A;  5AFL A;  4ILC A;  4AFH A;  4ZK1 A;  2XQ9 A;  5J5H A;  4HFH A;  3C79 A;  4XK9 A;  1UW6 A;  3UUB A;  3PMZ A;  2XNT A;  4NZB A;  5J5G A;  3TLW A;  4AFT A;  4ZR6 A;  4A98 A;  2UZ6 A;  5AFJ A;  3WIP A;  4UY2 A;  5HEU A;  2W8F A;  3TLS A;  4ALX A;  5IUX A;  4HFD A;  4X5T A;  5J0Z A;  4QH5 A;  2BYQ A;  2X00 D;  4XHE A;  3RI5 A;  3WTM A;  3UQ7 A;  4LMJ A;  4BFQ A;  3U8K A;  4QAA A;  2XZ6 A;  2X00 A;  4QH4 A;  4DBM A;  4TWD A;  4D01 A;  3ZKR A;  4B5D A;  5BP0 A;  3ZDG A;  5HCJ A;  2ZJV A;  4QH1 A;  3SQ9 A;  4QAC A;  2Y56 A;  3T4M A;  3TLT A;  4HFI A;  5SYO A;  4TWH A;  3WTO A;  4UM3 P;  4PIR A;  3U8N A;  3WTL A;  5J5I A;  4HFE A;  4HQP A;  3WTK A;  2PGZ A;  3PEO A;  5J5F A;  4LMK A;  3RQW A;  4ZJS A;  2WZY A;  2YMD A;  2BYN A;  2YKS A;  4ILA A;  5KZU A;  4BQT A;  5CO5 A;  3EI0 A;  4TNW A;  3U8J A;  4ZJT A;  3UU8 A;  2C9T A;  3LSV A;  3SQ6 A;  2Y7Y A;  4UM1 A;  4AFG A;  3RIF A;  5KE4 A;  4ZRU A;  1UX2 A;  3WTJ A;  5BW2 A;  4LML A; 
#chains in the Genus database with same CATH homology
 3UU6 A;  4ZZC A;  3UU5 A;  2Y57 A;  2PH9 A;  2XQ3 A;  2BR7 A;  2XYT A;  3C84 A;  4UM3 S;  5JME A;  4HFB A;  2BJ0 A;  1UV6 A;  5AFM A;  3GUA A;  3IGQ A;  5HEO A;  4HFC A;  3SIO A;  3TLV A;  3UQ4 A;  3ZDH A;  3RQU A;  5HEG A;  3JAF A;  4NPP A;  5LXB A;  2BG9 A;  5L4H A;  4TNV A;  2XYS A;  3UU3 A;  5LG3 A;  5AFK A;  5L47 A;  1I9B A;  3RHW A;  4IRE A;  3WTH A;  4WV9 A;  2Y54 A;  2ZJU A;  2WNJ A;  3JAD A;  4Z91 A;  2BG9 C;  2XNV A;  2VL0 A;  5HEH A;  2WN9 A;  2QC1 B;  3U8L A;  2W8G A;  2XQ8 A;  5AFM B;  3EAM A;  2XNU A;  5AFN A;  3U8M A;  4UM3 A;  4ZZB A;  2YOE A;  5BRX A;  2BR8 A;  2XQ7 A;  2BG9 B;  4TWF A;  3WTN A;  3P4W A;  3TLU A;  5FJV A;  4QAB A;  4Z90 A;  4A97 A;  2WNL A;  3P50 A;  3WTI A;  4IL4 A;  2WNC A;  2BYR A;  5HEJ A;  5HCM A;  3RIA A;  2BYS A;  5L4E A;  5CFB A;  4COF A;  4ZK4 A;  2YN6 A;  4F8H A;  2YME A;  2XQ4 A;  3UU4 A;  5AFH A;  2BYP A;  2BG9 E;  4ILB A;  2XQA A;  2Y58 A;  3SH1 A;  4EZ1 A;  4FRR A;  5TVC A;  2XQ5 A;  5AIN A;  3EHZ A;  2XQ6 A;  2XZ5 A;  3JAE A;  4IL9 A;  4UXU A;  5AFL A;  4ILC A;  4AFH A;  4ZK1 A;  2XQ9 A;  5J5H A;  4HFH A;  3C79 A;  4XK9 A;  1UW6 A;  3UUB A;  3PMZ A;  2XNT A;  4NZB A;  5J5G A;  3TLW A;  4AFT A;  4ZR6 A;  4A98 A;  2UZ6 A;  5AFJ A;  3WIP A;  4UY2 A;  5HEU A;  2W8F A;  3TLS A;  4ALX A;  5IUX A;  4HFD A;  4X5T A;  5J0Z A;  4QH5 A;  2BYQ A;  2X00 D;  4XHE A;  3RI5 A;  3WTM A;  3UQ7 A;  4LMJ A;  4BFQ A;  3U8K A;  4QAA A;  2XZ6 A;  2X00 A;  4QH4 A;  4DBM A;  4TWD A;  4D01 A;  3ZKR A;  4B5D A;  5BP0 A;  3ZDG A;  5HCJ A;  2ZJV A;  4QH1 A;  3SQ9 A;  4QAC A;  2Y56 A;  3T4M A;  3TLT A;  4HFI A;  5SYO A;  4TWH A;  3WTO A;  4UM3 P;  4PIR A;  3U8N A;  3WTL A;  5J5I A;  4HFE A;  4HQP A;  3WTK A;  2PGZ A;  3PEO A;  5J5F A;  4LMK A;  3RQW A;  4ZJS A;  2WZY A;  2YMD A;  2BYN A;  2YKS A;  4ILA A;  5KZU A;  4BQT A;  5CO5 A;  3EI0 A;  4TNW A;  3U8J A;  4ZJT A;  3UU8 A;  2C9T A;  3LSV A;  3SQ6 A;  2Y7Y A;  4UM1 A;  4AFG A;  3RIF A;  5KE4 A;  4ZRU A;  1UX2 A;  3WTJ A;  5BW2 A;  4LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...