4ILBA

The pentameric ligand-gated ion channel glic a237f in complex with rubidium
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 95
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ilbA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ilbA01
5AINA 2XNUA 5JMEA 3RHWA 2LKHA 4HFHA 4HQPA 3WTIA 4NZBA 4QABA 4BFQA 2X00A 4ILCA 2BYPA 2XQ7A 4XK9A 4IL4A 4UM1A 3WTOA 3JAEA 2XQ9A 3PEOA 5HCJA 4PIRA 3UUBA 4BQTA 4ALXA 2BG9C 3EI0A 4XHEA 4F8HA 3TLTA 4UM3S 4ZR6A 4UY2A 4UM3P 1OEDB 3WTKA 5L4HA 4TWFA 2BJ0A 4A97A 2LKGA 1OEDC 2WNLA 4QACA 5HCMA 5AFMA 2W8FA 4UXUA 2Y58A 5HEOA 2LM2A 2XQ3A 3C79A 5AFHA 5L4EA 4ZJSA 3UU3A 3ZDGA 2BYQA 4TWDA 2WNCA 3SQ6A 2XQ8A 3WTNA 1UW6A 2BYNA 2BG9B 3T4MA 3JAFA 2UZ6A 5BRXA 4ZZBA 2YN6A 4HFCA 5J5FA 1UV6A 3UU4A 2Y57A 2PGZA 5J5GA 5AFMB 5BW2A 3WTLA 4IREA 3EAMA 3WTHA 3SQ9A 2BR7A 3RIFA 4LMLA 2XQAA 5LG3A 4LMKA 2XQ5A 2BYSA 2Y54A 5BP0A 3RQUA 3SH1A 2WN9A 5HEHA 5FJVA 3ZKRA 2XQ4A 3UU8A 4HFDA 2WZYA 2XZ6A 5TVCA 2BG9E 4LMJA 5AFNA 4D01A 5LXBA 2QC1B 4WV9A 2BYRA 4DBMA 2BG9A 4TNWA 2XYSA 3WTMA 3WIPA 3U8LA 4Z90A 4AFGA 4ZK1A 3GUAA 4AFHA 2XZ5A 5AFLA 4AFTA 3TLVA 3RIAA 5AFJA 4QH1A 5CO5A 3EHZA 4ZK4A 4COFA 4NPPA 3TLUA 2XNVA 2YMEA 2C9TA 4FRRA 2W8GA 4Z91A 3TLWA 2VL0A 3RQWA 3LSVA 5L47A 3UQ7A 5AFKA 4ILAA 2XNTA 4A98A 4TNVA 3UU6A 4ZRUA 2PH9A 4ILBA 2YKSA 1OEDA 2BR8A 3UU5A 2ZJVA 3P50A 5CFBA 5SYOA 3RI5A 2YMDA 4X5TA 1OEDE 4HFIA 4ZJTA 3P4WA 5HEUA 3U8NA 2XQ6A 3TLSA 3WTJA 2KSRA 4EZ1A 3IGQA 4UM3A 4IL9A 2M6IA 5IUXA 2WNJA 3PMZA 4HFEA 5J5HA 1I9BA 4QH4A 2MAWA 3SIOA 5HEJA 5KE4A 3C84A 3U8MA 5J0ZA 2XYTA 2X00D 3ZDHA 2ZJUA 2YOEA 3UQ4A 4ZZCA 4QH5A 2Y56A 2M6BA 4QAAA 4TWHA 2Y7YA 3U8JA 5KZUA 5HEGA 1UX2A 5J5IA 3U8KA 4B5DA 4HFBA 3JADA 2LLYA
chains in the Genus database with same CATH superfamily
4DBRA 3WTIA 5AQUB 4ILCA 2HN1A 3KBUA 1BR1A 4NXMT 4F8HA 2CHOA 4UY2A 1G73A 4A97A 2I59A 2W8FA 5AFHA 4UF0A 3E22E 1N36T 1UW6A 1T98A 2YN6A 4QXHB 3MA9A 2WM9A 3ZKRA 1H7CA 1XNQT 4LF8T 5CA0E 5FNVE 2MOZA 3O1IA 2EHOD 4OYJA 4DR6T 2A72A 3L8RA 4DVDA 1WR0A 3HR0A 4PW8A 4X65T 1W9RA 3H3MA 3AA1B 4COFA 1KNZA 3RH3A 2V7KA 4EV6A 3QUJA 4ANJA 2YU1A 2CMRA 3UQ7A 5AQVB 4A98A 4ZRUA 5ADXL 4DR4T 2Y48B 1IBMT 1OEDE 5JDLA 3VHLA 4HFIA 1XZYA 3MACA 3LK2B 2A3DA 1D1BA 3I9YA 2V7JA 3U3IA 3VR8A 4HEAA 4QH4A 2PTFA 3C84A 5J0ZA 4CXXA 3BK9A 4ZZCA 2M6BA 2DNXA 3U8KA 4CQIA 3KBTA 3O9XA 3ESLA 3RHWA 3AXJB 2ACXA 1AJ3A 1YQ4A 3LBXB 2VWAA 2WDQA 3W15B 4O2BE 3TLTA 2BBHA 4ASKA 3ZT7A 4O2AE 5HEOA 3C4XA 3C79A 2DCFA 4UV9B 5L4EA 4JI5T 1SA0E 2BKOA 3PUYF 3KINB 4ZZBA 2Y57A 3MK7C 1J5WA 2JMHA 1IJ5A 1SE7A 5AQOB 3KFWX 3HKEE 3VR9A 2ZM6T 5J2UE 4WW0A 5HEHA 5FJVA 5FXZA 1N33T 3HL6A 2BKPA 5FXXA 2NTYA 1X79A 3UUMA 3NRYA 2XZEA 3WTMA 1UGOA 2V5DA 4AFHA 5AQMB 4L0RA 5AFLA 4QHOA 1FIOA 3AE9A 4UVCB 4G63A 2LSIA 1ZKEA 4H9OC 2BZBA 3K1SA 3ZMTB 2QGSA 4EEDA 4ILAA 2V6XA 1ZOYA 4IDPA 2MPKA 4GK0E 4JI0T 5KXJA 3P4WA 3AEAA 1VOMA 4HFEA 1VCSA 3E0ZA 3RC8A 2X00D 4OFZA 4DR1T 2Y7YA 2CXFA 4JI3T 4U7IA 2LT3A 3UTKA 2W66A 5JDNA 2XNUA 2ACZA 4DR5T 3CQXC 4NZBA 3KV9A 3LJCA 4IL4A 2E5VA 4HWIB 4ALXA 3UFGA 2XQYA 4ZR6A 5FYMA 2QVAA 4WZXA 5F5WA 1WLXA 4DV2T 3T1YT 4QX8B 3A7MA 4QXBB 1WR6A 1MMAA 5FKYA 5FVLA 3I0QA 4NUVA 4PJJA 5J5GA 5C2TA 3RIFA 5LG3A 2N9DA 4LMKA 2WDRA 4YXDA 2LJLA 2NW8A 2QYWA 2VURA 2CM0A 2D0UA 3I0OA 2HH7A 2LM9A 4DNDA 4HFDA 4LMJA 4PFOA 4LF9T 2JJ9A 2BG9A 1IAPA 3U8LA 3PUSA 3AAIA 3AEBA 2XZ5A 4U31A 5EK4A 2WB5A 4NPPA 4U3CA 4E7SA 5AQKB 3PE0A 4QWNB 3RQWA 4ZI7E 5L3EB 3CPZA 2GK9A 4ZI3C 3RYCE 3UU5A 2ZJVA 1QSDA 3QB5K 4HE8A 1YQ3A 5HEUA 3PDYA 2WWUA 4HFVA 2VQET 2JIWA 5IWAT 1G8XA 3AAAB 2E9XA 3KDSE 3O1JA 5J2TE 2X0YA 1ZHCA 3ZYKA 3RIUA 2FJAA 3PUWF 1WRDA 4WBNE 4UVBB 4ZHQE 4YHHT 4LF7T 2C0SA 3UUBA 3VKGA 1US7B 4XHEA 4B3RT 1OEDB 4EXTA 2LKGA 3GMIA 4O4JE 5JDFA 4UXUA 5KX5E 3A5XA 4GKJT 4DMWA 2P9BA 2FJBA 1D1AA 4M1PA 5F8PA 2IUBA 5LHIB 2CBIA 5LG4A 3PJAJ 2Y8DA 4ADZA 1XDPA 3NKZA 4H9QC 5AFUL 2VKDA 3N2OA 3FZFB 3ZEFB 1XNRT 5KMGP 3N2KE 3K3QC 4AFGA 1IZNB 2LSKA 2PFVA 2XM1A 4K0KT 5AQGB 4AFTA 4QH1A 4DBQA 3F31A 1UURA 2YDQA 3P4PA 4UELA 1HFAA 3PU3A 4EEBA 2C9TA 2F4VT 2K3WA 2XNTA 5L3DB 2J47A 2KNDA 2XAJB 3N5LA 4UM3A 2IAKA 4QX7B 1KF6A 3PMZA 4IE0A 3AE3A 3PTRB 5KE4A 2BVMA 5E0OA 5HXEA 4PK6A 4X64T 5FY7A 3ZDHA 3UQ4A 3U8JA 3OKQA 3FXDB 3ZPOA 4QABA 2M67A 1V9DA 5HXRA 2BYPA 2RA1A 4UM1A 2BS3A 2K24A 5F3JA 4U72A 3O4XE 4P0AA 2CRBA 4JYAT 2JQHA 5JR9B 4JI4T 2JQ9A 2X68A 3L39A 1DU2A 3EVYA 5JDMA 3NBXX 4LMLA 4PAGA 3RPUA 2LSJA 4Z8XA 2CPTA 2WDVA 2HPJA 3ZMSB 3FXEB 5L3FB 3RKOA 3EUHA 2UXNB 3EABA 2VASA 1UX5A 3C51A 4ZI2D 3QOFA 3ONXA 4GK5E 4MLKA 2VQFT 2BBJA 1EZ3A 3RIUC 5LB7B 4HTEA 3ZJ1A 2VL8A 5FXVA 4ILUA 2VL0A 3P4SA 4L9IA 2LSGA 4NUUA 3RI5A 2CCQA 3WAKA 2YDSA 3SOLA 2W4XA 1J1JA 5ABEA 3U8NA 3UULA 5L2LA 3SIOA 2MAWA 5LOVE 2ZJUA 4QH5A 5HYAA 3ZMUB 3HKDE 4WBOA 2VKJA 5CB4E 3FBLA 2K9AA 5HWYA 4EB6E 3L09A 4IGUA 3T1HT 3EI0A 3P8CD 4ZI3D 2XUEA 4UM3P 5LGNB 2LHNA 3R84B 1HCIA 5AQLB 2XQ3A 2WU5A 3UU3A 4C91A 1ZEEA 4AQGA 4TWDA 3BQLA 1R8IA 2X51A 2UZ6A 3C64A 3ZMVB 4HFCA 4P09A 4H9NC 3HKCE 4I4TE 3RRWA 1NAFA 1CUNA 2X67A 3SH1A 3UU8A 1WYBA 3ABVA 5JR9A 3NZQA 3S4UA 3AE8A 4KI0F 4ZK1A 4O4IE 1HX1B 3C4ZA 5AFJA 3EHZA 1MMGA 2V6YA 4ZK4A 3N9NA 4AKHA 2XAHB 5FVKA 2DWKA 2R6GF 3WI3A 3H3AA 1MIWA 4JLEA 4IDQA 3LFMA 2YMDA 4HGAA 2UUCT 4EZ1A 2M6IA 2L8KA 3JC6D 5DJQC 3N9QA 3KV6A 2EHOC 2VVNA 4JEUB 2E5LT 2Y56A 5HEGA 3K8PC 5AINA 1YKEB 4XK9A 2KT9A 3T8OA 3ZMZB 3L3PA 5C3JA 4OK0A 1FMWA 3CIRA 1UX4A 2XY8B 3KVBA 3LK42 5AFMA 4CN1A 4LFBT 3BQIA 3ZT6A 4Q25A 3CX6B 2FJDA 4EOZB 2BYNA 1HF8A 2X9XA 2UUAT 3P4RA 3IF8B 3MKDA 2PGZA 2VKOA 2BVLA 1HG2A 1OXZA 5LGUB 2BKNA 4OYKA 2Q9QC 2A9UA 4QXCB 3AAEB 1XMQT 2XQ4A 2WZIA 1W09A 4DV4T 5AFNA 2W63A 4ZS3A 4DBMA 5FP3A 4PNIA 2KZ7B 2XAQB 1IJ6A 3N2GE 1YW0A 4AQFC 5LP6E 2AXDS 2MTQA 5A1LA 3ANWA 2DLRA 4EZHA 5AFKA 3VRAA 2HN2A 2D5UA 2UXXB 2KINB 5LYJE 5HXSA 4U2ZA 5IYZE 4TV8E 4EYUA 4X66T 2I0MA 4TV9E 3ZN0B 2BS2A 3DTOA 5M4YA 2YEVC 3CX8B 4LFAT 3AVSA 3IEEA 2YOEA 3JC6C 5J5IA 4AKGA 4NXNT 4HFBA 2XAFB 4B5DA 2LLYA 4U2YA 1BR0A 2LKHA 3OJAA 1T7SA 4X62T 2IC9A 4JUYA 4IHJE 5FL1A 2XQ9A 3ZCIA 4PIRA 2W61A 2ZM8A 3A8YC 3D0TA 4YJ2E 4PK5A 4A56A 2N1GA 2D9DA 3AA6B 4BJNA 2WNCA 4J2CA 3RYIE 2BDEA 1UV6A 2EHOA 3KVAA 2LOPA 1YD8G 3ZT5A 5DQVA 3AE2A 4HN9A 5L3BB 4DV1T 3OPCA 2XSAA 3LDQB 5LA6E 1E1HB 5JRCB 4OX9T 5LXBA 2BYRA 2XYSA 4IE4A 3UFEA 4C90A 4UXNB 4KMCA 2D2SA 4CI1B 3RX6A 3UU6A 4F6RC 4ILBA 5LJNA 2CLYC 2L9QA 1YKHB 4ZJTA 3IGQA 3I9WA 4MHCA 2X9YA 4ZS2A 1T72A 3HI2A 4MFRA 2MYSA 1UUSA 2ODVA 2X9HA 2JPFA 1D0YA 3O1HA 1KK7A 2UU9T 1UK5A 3PUGA 1MMDA 5FXWA 3WTOA 3UT5E 4H9SE 1KFYA 4I50E 5HWXA 5LJMA 2C5IT 4CXWA 5HCMA 4YFSA 4EZ4A 2BS4A 3ZDGA 2CE7A 2W67A 2IIUA 3AB3B 3DP7A 5AQJB 2RPAA 2XQ5A 5JDQA 3B13A 3RQUA 2WN9A 4X1IE 1FMVA 3ZCJA 2XZ6A 3RGLA 2E9XD 4OHFA 2UXBT 3OVUA 3FZMB 1M62A 5GONE 2KXPB 2C5KT 4JBWF 4KUMB 3LBXA 2YMEA 4FRRA 1D1CA 3AXJA 5EK3A 3TLWA 3CVRA 1Y64B 2LRLA 2YKSA 4AKRB 5JDGA 5SYOA 4I55E 2H7OA 2CEAA 2SPCA 2DWGA 3ZLIA 2DHRA 3OBVE 5HEJA 4GOUA 2XYTA 2IC6A 3N9MA 4UV8B 2V26A 4QAAA 3FZLB 3PUQA 1UX2A 3SS1A 3ONJA 5L3CB 2ES0A 3KV4A 4HFHA 3LG7A 4I0UA 4B3TT 5H6RB 1UCUA 3ONLC 4JV5T 1HNWT 4BQTA 3UUNA 2YINA 1WFDA 3SFDA 4ZXLA 4A5XA 2WNLA 2IMLA 1MIYA 2WP9A 2CLYB 2Y58A 3CKDA 4N78D 1KNRA 4IE5A 2WY2A 2XQ8A 4GYSA 4KX6A 4DR2T 2KLQA 2HHHT 5JH7E 2N2NA 1FEWA 2J62A 5AQFB 2V7LA 5ABHA 2BYSA 3CQCB 1LKXA 4UEMA 2LSYA 4DV7T 4ZOLE 3Q5XA 4DV3T 3MJXA 4DR3T 1XWMA 4IDZA 1HG5A 2H3RA 1BR4A 3WAJA 4DV0T 2J1DG 3ZC0A 4KHPT 1Y01A 3QK6A 3VKHA 2V5CA 5L47A 2IDOB 2B1EA 2ZM0A 3IHRA 4YY3T 4GIWA 4E7ZA 4HWCA 3K3OA 2WZHA 4GYRA 5L3GB 3AEFA 4DUYT 1O3XA 3RC3A 3TKLB 2X0LB 3Q2MA 4LF6T 3AECA 5KZUA 4H9PC 4QKNA 2WAUA 4CN6A 2WQYA 3NRXA 3PEOA 1MMNA 2YK0A 1SHZC 2PG8A 3AE1A 3Q5WA 2C5JA 3KV5A 1OEDC 2JMKA 3RYHE 2I6HA 4JI2T 3CK6A 4EIWA 2UUBT 3AA7B 4DMVA 2BYQA 3IBPA 3WTNA 4UR9A 2D0TA 2NOXA 2KMFA 5LHGB 5JRCA 4YTPA 3ZSTA 3WTLA 3FHNA 3WTHA 1D0XA 2WCAA 2XQAA 1XMOT 3AEGA 3QB5A 4HWDA 3AVRA 1WYCA 3RF1A 3C98B 2EHOB 1M7KA 3PUXF 2VK9A 1E7PA 4K0UA 4AXPA 5AQTB 2YDRA 2CBJA 3J7Yq 1VRBA 2X9WA 2W8GA 4Z91A 1YXRA 3RLFF 2LRKA 4YTNA 4JI8T 4O4HE 3GA8A 4U74A 2XQ6A 1BR2A 2LE8A 3FZHB 5C8YE 3HKBE 5J5HA 1GQEA 2FBWA 1HNZT 2ZM2A 3MZKB 4AI6A 4XAXB 4H63V 1XDOA 3F2EA 5JMEA 3N9LA 4LFCT 2X00A 2XQ7A 3JAEA 4JEHB 4AKLA 4AISA 1VCTA 3ETUA 3OYXA 4KBMB 4TWFA 2LHRA 4DV6T 2K5BB 3CMLA 2WS3A 3CX7B 2WBLA 4YTMA 5JVDE 3NWIA 3SQ6A 4NIQA 2MBGA 2JQKA 4FJOA 3T4MA 2IW5B 3Q5EA 3UU4A 4YSZA 4HWHA 4WNKA 4H9RC 1MNEA 3GN5A 5FL0A 2CXLA 4CXYA 2CXDA 3G06A 4AQYT 5TVCA 2WSSV 4YLHA 2BG9E 5HXCA 2JRKA 4BAYB 4IDNA 2VVSA 2CHNA 3PURA 3PJAA 3TLUA 4HKAA 2ZLYA 2WWVA 2PH9A 1L0VA 4TZ4C 2V1DB 3RKGA 4X5TA 1S35A 2V7IA 3RYFE 4DUZT 2CWYA 3NVOA 2AE9A 2NR4A 3H37A 2DL1A 2OV9A 2NW7A 3U8MA 2XM2A 5FY0A 2X66A 4TX5A 1MNDA 4XBFB 2NP9A 3VU7H 3ZC1A 3BQKA 4EGWA 2BG9C 2VB6A 5L4HA 2BJ0A 2UXDT 3ANWB 4IT4A 5ABGA 2W00A 1J5ET 4PFPA 4B3ST 3M3ZB 5H6QB 2BG9B 5BW2A 5J1GA 3M65A 4IREA 1U5PA 3ZYLA 3ZJ2A 4ISTA 4H63H 1QLBA 2Y6XA 4YSXA 4TNWA 1Z8UA 2X0HA 1QUUA 1OWAA 4CI2B 4CZZB 2QRXA 2QA7A 3PUAA 3Q9DA 2Q9QA 2V8SV 2KWHA 2J4GA 5LHHB 1OEDA 5JR9C 2XPKA 5CJ5A 5FY1A 4G2AA 5CGMA 1I6ZA 1FJGT 3FBZA 3WTJA 4IL9A 4DV5T 4HWFA 4EAHA 5BMVE 2LOSA 5LNKA 2E9XB 5AQSB 4KHZF 5DABA 3AE4A 4YJ3E 3AEEA 3FB2A 4TN7B 3OTOT 3AEDA 3B57A 3VRBA 3V5SA 3LK3B 3WTKA 2YU2A 4P1NA 5AQNB 2Q9QD 2LM2A 3E08A 1LRZA 4ZJSA 3ETVA 4U7YA 4DIDB 4ZI2C 4B6XA 1HS7A 3GN5B 1X9BA 2CA5A 4AKIA 3JAFA 5AQIB 5BRXA 4X1KE 2G0UA 5AFMB 3AA0B 2H7VC 1WCRA 3HA4A 5LMNT 2BR7A 2OA5A 5AQQB 2Y54A 2IHR1 2OLTA 4KP3C 5BP0A 1D0ZA 1KNPA 1NENA 4D01A 4WV9A 2H89A 3QC9A 1B7TA 5ABFB 3ZYMA 4X1YE 4XZCA 3F57A 4ZEYA 3N9OA 2XNVA 2DI4A 4O4LE 2XAGB 4L5GA 1IBKT 5BR8T 4GKKT 5CFBA 2NW9A 2E8IA 2ZMAA 3TLSA 4U33A 4DO0A 4V1Av 4I43B 4AQFA 2V6YB 1CHUA 5LBQB 3PU8A 1S94A 2L3LA 3K3NA 2W62A 3MXZA 4IIJE 4UVAB 2NTXA 4MALA 4LF4T 4O8SA 4BJMA 1HNXT 2XASB 5LCYA 5HCJA 3PV0F 3R6NA 2WMOA 2FJEA 1IBLT 1W0AA 2B76A 5TAOA 2XSBA 1W0BA 4YSYA 3EDVA 5KDMC 5AQPB 1T8BA 3SWHA 4PK4A 2CWOA 3SRZA 5AQHB 5J5FA 5LXTE 3PUZF 3SQ9A 4UIGA 4LF5T 4AIUA 2H88A 3X1DA 4IE7A 3GWHA 4CN4A 5JDHA 2WZYA 1NWMX 3V5UA 5HAXA 2XJ7A 3I1AA 5LGTB 2RP4A 3WIPA 2K48A 4Z90A 5JREA 3GUAA 5EK2A 3JCFA 2HPLA 3RIAA 3EDUA 1JNRA 1LVFA 4CI3B 5DQWA 4MBQA 5LMUT 3ZN1B 3N9PA 4YT0A 1MIVA 1LVKA 5ABFA 4TUYE 3LSVA 5FMNA 3C50A 5EZYE 2BR8A 3P50A 5JTGA 3OYZA 3ZSSA 3Q5DA 2KSRA 2A2FX 2KWIB 2PJQA 3DJBA 2V7MA 4EYYR 1I9BA 1NEKA 2UXCT 2Q9QB 1SUMB 1ZV4X 5IHYA 1Z0PA 3JADA 3IA3A 4WYVA 4HQPA 4BFQA 4UF0B 2LEHA 3B5MA 4PJNA 1HR0T 4DR7T 3J9X1 1N32T 4UM3S 1KEYA 1U4QA 4IDOA 4QACA 4PJLA 2W2UA 3AE6A 3SFEA 3QNUA 5JQGE 5AQRB 3AE7A 3NZPA 4ISSA 1HX8A 1I94T 4YHJA 4JI7T 4B3MT 3EAMA 2FUPA 1E2AA 3U78A 5ETWA 4ERRA 2E9XC 3CWZB 3RRCA 3CQGB 3C4WA 1JNZA 1ZP0A 2QC1B 1N34T 3PUVF 2Z6EA 2E2AA 4IE6A 2W0GA 2JQQA 3FZKB 3UUXB 2VKHA 3AE5A 2WMNA 3TLVA 5CO5A 4FI5A 4JI1T 1HTJF 3P4QA 2PBIA 4P0BA 4JI6T 4TNVA 2XTLA 5HXHA 3P7IA 5IUXA 4PJMA 2WNJA 4BA9A 5LBMA 4X20E 2NWBA 4TWHA 2ODUA 2WU2A 2XHEB 5CA1E
chains in the Genus database with same CATH topology
5AINA 2XNUA 5JMEA 3RHWA 2LKHA 4HFHA 4HQPA 3WTIA 4NZBA 4QABA 4BFQA 2X00A 4ILCA 2BYPA 2XQ7A 4XK9A 4IL4A 4UM1A 3WTOA 3JAEA 2XQ9A 3PEOA 5HCJA 4PIRA 3UUBA 4BQTA 4ALXA 2BG9C 3EI0A 4XHEA 4F8HA 3TLTA 4UM3S 4ZR6A 4UY2A 4UM3P 1OEDB 3WTKA 5L4HA 4TWFA 2BJ0A 4A97A 2LKGA 1OEDC 2WNLA 4QACA 5HCMA 5AFMA 2W8FA 4UXUA 2Y58A 5HEOA 2LM2A 2XQ3A 3C79A 5AFHA 5L4EA 4ZJSA 3UU3A 3ZDGA 2BYQA 4TWDA 2WNCA 3SQ6A 2XQ8A 3WTNA 1UW6A 2BYNA 2BG9B 3T4MA 3JAFA 2UZ6A 5BRXA 4ZZBA 2YN6A 4HFCA 5J5FA 1UV6A 3UU4A 2Y57A 2PGZA 5J5GA 5AFMB 5BW2A 3WTLA 4IREA 3EAMA 3WTHA 3SQ9A 2BR7A 3RIFA 4LMLA 2XQAA 5LG3A 4LMKA 2XQ5A 2BYSA 2Y54A 5BP0A 3RQUA 3SH1A 2WN9A 5HEHA 5FJVA 3ZKRA 2XQ4A 3UU8A 4HFDA 2WZYA 2XZ6A 5TVCA 2BG9E 4LMJA 5AFNA 4D01A 5LXBA 2QC1B 4WV9A 2BYRA 4DBMA 2BG9A 4TNWA 2XYSA 3WTMA 3WIPA 3U8LA 4Z90A 4AFGA 4ZK1A 3GUAA 4AFHA 2XZ5A 5AFLA 4AFTA 3TLVA 3RIAA 5AFJA 4QH1A 5CO5A 3EHZA 4ZK4A 4COFA 4NPPA 3TLUA 2XNVA 2YMEA 2C9TA 4FRRA 2W8GA 4Z91A 3TLWA 2VL0A 3RQWA 3LSVA 5L47A 3UQ7A 5AFKA 4ILAA 2XNTA 4A98A 4TNVA 3UU6A 4ZRUA 2PH9A 4ILBA 2YKSA 1OEDA 2BR8A 3UU5A 2ZJVA 3P50A 5CFBA 5SYOA 3RI5A 2YMDA 4X5TA 1OEDE 4HFIA 4ZJTA 3P4WA 5HEUA 3U8NA 2XQ6A 3TLSA 3WTJA 2KSRA 4EZ1A 3IGQA 4UM3A 4IL9A 2M6IA 5IUXA 2WNJA 3PMZA 4HFEA 5J5HA 1I9BA 4QH4A 2MAWA 3SIOA 5HEJA 5KE4A 3C84A 3U8MA 5J0ZA 2XYTA 2X00D 3ZDHA 2ZJUA 2YOEA 3UQ4A 4ZZCA 4QH5A 2Y56A 2M6BA 4QAAA 4TWHA 2Y7YA 3U8JA 5KZUA 5HEGA 1UX2A 5J5IA 3U8KA 4B5DA 4HFBA 3JADA 2LLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIN A;  2XNU A;  5JME A;  3RHW A;  2LKH A;  4HFH A;  4HQP A;  3WTI A;  4NZB A;  4QAB A;  4BFQ A;  2X00 A;  4ILC A;  2BYP A;  2XQ7 A;  4XK9 A;  4IL4 A;  4UM1 A;  3WTO A;  3JAE A;  2XQ9 A;  3PEO A;  5HCJ A;  4PIR A;  3UUB A;  4BQT A;  4ALX A;  2BG9 C;  3EI0 A;  4XHE A;  4F8H A;  3TLT A;  4UM3 S;  4ZR6 A;  4UY2 A;  4UM3 P;  1OED B;  3WTK A;  5L4H A;  4TWF A;  2BJ0 A;  4A97 A;  2LKG A;  1OED C;  2WNL A;  4QAC A;  5HCM A;  5AFM A;  2W8F A;  4UXU A;  2Y58 A;  5HEO A;  2LM2 A;  2XQ3 A;  3C79 A;  5AFH A;  5L4E A;  4ZJS A;  3UU3 A;  3ZDG A;  2BYQ A;  4TWD A;  2WNC A;  3SQ6 A;  2XQ8 A;  3WTN A;  1UW6 A;  2BYN A;  2BG9 B;  3T4M A;  3JAF A;  2UZ6 A;  5BRX A;  4ZZB A;  2YN6 A;  4HFC A;  5J5F A;  1UV6 A;  3UU4 A;  2Y57 A;  2PGZ A;  5J5G A;  5AFM B;  5BW2 A;  3WTL A;  4IRE A;  3EAM A;  3WTH A;  3SQ9 A;  2BR7 A;  3RIF A;  4LML A;  2XQA A;  5LG3 A;  4LMK A;  2XQ5 A;  2BYS A;  2Y54 A;  5BP0 A;  3RQU A;  3SH1 A;  2WN9 A;  5HEH A;  5FJV A;  3ZKR A;  2XQ4 A;  3UU8 A;  4HFD A;  2WZY A;  2XZ6 A;  5TVC A;  2BG9 E;  4LMJ A;  5AFN A;  4D01 A;  5LXB A;  2QC1 B;  4WV9 A;  2BYR A;  4DBM A;  2BG9 A;  4TNW A;  2XYS A;  3WTM A;  3WIP A;  3U8L A;  4Z90 A;  4AFG A;  4ZK1 A;  3GUA A;  4AFH A;  2XZ5 A;  5AFL A;  4AFT A;  3TLV A;  3RIA A;  5AFJ A;  4QH1 A;  5CO5 A;  3EHZ A;  4ZK4 A;  4COF A;  4NPP A;  3TLU A;  2XNV A;  2YME A;  2C9T A;  4FRR A;  2W8G A;  4Z91 A;  3TLW A;  2VL0 A;  3RQW A;  3LSV A;  5L47 A;  3UQ7 A;  5AFK A;  4ILA A;  2XNT A;  4A98 A;  4TNV A;  3UU6 A;  4ZRU A;  2PH9 A;  4ILB A;  2YKS A;  1OED A;  2BR8 A;  3UU5 A;  2ZJV A;  3P50 A;  5CFB A;  5SYO A;  3RI5 A;  2YMD A;  4X5T A;  1OED E;  4HFI A;  4ZJT A;  3P4W A;  5HEU A;  3U8N A;  2XQ6 A;  3TLS A;  3WTJ A;  2KSR A;  4EZ1 A;  3IGQ A;  4UM3 A;  4IL9 A;  2M6I A;  5IUX A;  2WNJ A;  3PMZ A;  4HFE A;  5J5H A;  1I9B A;  4QH4 A;  2MAW A;  3SIO A;  5HEJ A;  5KE4 A;  3C84 A;  3U8M A;  5J0Z A;  2XYT A;  2X00 D;  3ZDH A;  2ZJU A;  2YOE A;  3UQ4 A;  4ZZC A;  4QH5 A;  2Y56 A;  2M6B A;  4QAA A;  4TWH A;  2Y7Y A;  3U8J A;  5KZU A;  5HEG A;  1UX2 A;  5J5I A;  3U8K A;  4B5D A;  4HFB A;  3JAD A;  2LLY A; 
#chains in the Genus database with same CATH topology
 4DBR A;  3WTI A;  5AQU B;  4ILC A;  2HN1 A;  3KBU A;  1BR1 A;  4NXM T;  4F8H A;  2CHO A;  4UY2 A;  1G73 A;  4A97 A;  2I59 A;  2W8F A;  5AFH A;  4UF0 A;  3E22 E;  1N36 T;  1UW6 A;  1T98 A;  2YN6 A;  4QXH B;  3MA9 A;  2WM9 A;  3ZKR A;  1H7C A;  1XNQ T;  4LF8 T;  5CA0 E;  5FNV E;  2MOZ A;  3O1I A;  2EHO D;  4OYJ A;  4DR6 T;  2A72 A;  3L8R A;  4DVD A;  1WR0 A;  3HR0 A;  4PW8 A;  4X65 T;  1W9R A;  3H3M A;  3AA1 B;  4COF A;  1KNZ A;  3RH3 A;  2V7K A;  4EV6 A;  3QUJ A;  4ANJ A;  2YU1 A;  2CMR A;  3UQ7 A;  5AQV B;  4A98 A;  4ZRU A;  5ADX L;  4DR4 T;  2Y48 B;  1IBM T;  1OED E;  5JDL A;  3VHL A;  4HFI A;  1XZY A;  3MAC A;  3LK2 B;  2A3D A;  1D1B A;  3I9Y A;  2V7J A;  3U3I A;  3VR8 A;  4HEA A;  4QH4 A;  2PTF A;  3C84 A;  5J0Z A;  4CXX A;  3BK9 A;  4ZZC A;  2M6B A;  2DNX A;  3U8K A;  4CQI A;  3KBT A;  3O9X A;  3ESL A;  3RHW A;  3AXJ B;  2ACX A;  1AJ3 A;  1YQ4 A;  3LBX B;  2VWA A;  2WDQ A;  3W15 B;  4O2B E;  3TLT A;  2BBH A;  4ASK A;  3ZT7 A;  4O2A E;  5HEO A;  3C4X A;  3C79 A;  2DCF A;  4UV9 B;  5L4E A;  4JI5 T;  1SA0 E;  2BKO A;  3PUY F;  3KIN B;  4ZZB A;  2Y57 A;  3MK7 C;  1J5W A;  2JMH A;  1IJ5 A;  1SE7 A;  5AQO B;  3KFW X;  3HKE E;  3VR9 A;  2ZM6 T;  5J2U E;  4WW0 A;  5HEH A;  5FJV A;  5FXZ A;  1N33 T;  3HL6 A;  2BKP A;  5FXX A;  2NTY A;  1X79 A;  3UUM A;  3NRY A;  2XZE A;  3WTM A;  1UGO A;  2V5D A;  4AFH A;  5AQM B;  4L0R A;  5AFL A;  4QHO A;  1FIO A;  3AE9 A;  4UVC B;  4G63 A;  2LSI A;  1ZKE A;  4H9O C;  2BZB A;  3K1S A;  3ZMT B;  2QGS A;  4EED A;  4ILA A;  2V6X A;  1ZOY A;  4IDP A;  2MPK A;  4GK0 E;  4JI0 T;  5KXJ A;  3P4W A;  3AEA A;  1VOM A;  4HFE A;  1VCS A;  3E0Z A;  3RC8 A;  2X00 D;  4OFZ A;  4DR1 T;  2Y7Y A;  2CXF A;  4JI3 T;  4U7I A;  2LT3 A;  3UTK A;  2W66 A;  5JDN A;  2XNU A;  2ACZ A;  4DR5 T;  3CQX C;  4NZB A;  3KV9 A;  3LJC A;  4IL4 A;  2E5V A;  4HWI B;  4ALX A;  3UFG A;  2XQY A;  4ZR6 A;  5FYM A;  2QVA A;  4WZX A;  5F5W A;  1WLX A;  4DV2 T;  3T1Y T;  4QX8 B;  3A7M A;  4QXB B;  1WR6 A;  1MMA A;  5FKY A;  5FVL A;  3I0Q A;  4NUV A;  4PJJ A;  5J5G A;  5C2T A;  3RIF A;  5LG3 A;  2N9D A;  4LMK A;  2WDR A;  4YXD A;  2LJL A;  2NW8 A;  2QYW A;  2VUR A;  2CM0 A;  2D0U A;  3I0O A;  2HH7 A;  2LM9 A;  4DND A;  4HFD A;  4LMJ A;  4PFO A;  4LF9 T;  2JJ9 A;  2BG9 A;  1IAP A;  3U8L A;  3PUS A;  3AAI A;  3AEB A;  2XZ5 A;  4U31 A;  5EK4 A;  2WB5 A;  4NPP A;  4U3C A;  4E7S A;  5AQK B;  3PE0 A;  4QWN B;  3RQW A;  4ZI7 E;  5L3E B;  3CPZ A;  2GK9 A;  4ZI3 C;  3RYC E;  3UU5 A;  2ZJV A;  1QSD A;  3QB5 K;  4HE8 A;  1YQ3 A;  5HEU A;  3PDY A;  2WWU A;  4HFV A;  2VQE T;  2JIW A;  5IWA T;  1G8X A;  3AAA B;  2E9X A;  3KDS E;  3O1J A;  5J2T E;  2X0Y A;  1ZHC A;  3ZYK A;  3RIU A;  2FJA A;  3PUW F;  1WRD A;  4WBN E;  4UVB B;  4ZHQ E;  4YHH T;  4LF7 T;  2C0S A;  3UUB A;  3VKG A;  1US7 B;  4XHE A;  4B3R T;  1OED B;  4EXT A;  2LKG A;  3GMI A;  4O4J E;  5JDF A;  4UXU A;  5KX5 E;  3A5X A;  4GKJ T;  4DMW A;  2P9B A;  2FJB A;  1D1A A;  4M1P A;  5F8P A;  2IUB A;  5LHI B;  2CBI A;  5LG4 A;  3PJA J;  2Y8D A;  4ADZ A;  1XDP A;  3NKZ A;  4H9Q C;  5AFU L;  2VKD A;  3N2O A;  3FZF B;  3ZEF B;  1XNR T;  5KMG P;  3N2K E;  3K3Q C;  4AFG A;  1IZN B;  2LSK A;  2PFV A;  2XM1 A;  4K0K T;  5AQG B;  4AFT A;  4QH1 A;  4DBQ A;  3F31 A;  1UUR A;  2YDQ A;  3P4P A;  4UEL A;  1HFA A;  3PU3 A;  4EEB A;  2C9T A;  2F4V T;  2K3W A;  2XNT A;  5L3D B;  2J47 A;  2KND A;  2XAJ B;  3N5L A;  4UM3 A;  2IAK A;  4QX7 B;  1KF6 A;  3PMZ A;  4IE0 A;  3AE3 A;  3PTR B;  5KE4 A;  2BVM A;  5E0O A;  5HXE A;  4PK6 A;  4X64 T;  5FY7 A;  3ZDH A;  3UQ4 A;  3U8J A;  3OKQ A;  3FXD B;  3ZPO A;  4QAB A;  2M67 A;  1V9D A;  5HXR A;  2BYP A;  2RA1 A;  4UM1 A;  2BS3 A;  2K24 A;  5F3J A;  4U72 A;  3O4X E;  4P0A A;  2CRB A;  4JYA T;  2JQH A;  5JR9 B;  4JI4 T;  2JQ9 A;  2X68 A;  3L39 A;  1DU2 A;  3EVY A;  5JDM A;  3NBX X;  4LML A;  4PAG A;  3RPU A;  2LSJ A;  4Z8X A;  2CPT A;  2WDV A;  2HPJ A;  3ZMS B;  3FXE B;  5L3F B;  3RKO A;  3EUH A;  2UXN B;  3EAB A;  2VAS A;  1UX5 A;  3C51 A;  4ZI2 D;  3QOF A;  3ONX A;  4GK5 E;  4MLK A;  2VQF T;  2BBJ A;  1EZ3 A;  3RIU C;  5LB7 B;  4HTE A;  3ZJ1 A;  2VL8 A;  5FXV A;  4ILU A;  2VL0 A;  3P4S A;  4L9I A;  2LSG A;  4NUU A;  3RI5 A;  2CCQ A;  3WAK A;  2YDS A;  3SOL A;  2W4X A;  1J1J A;  5ABE A;  3U8N A;  3UUL A;  5L2L A;  3SIO A;  2MAW A;  5LOV E;  2ZJU A;  4QH5 A;  5HYA A;  3ZMU B;  3HKD E;  4WBO A;  2VKJ A;  5CB4 E;  3FBL A;  2K9A A;  5HWY A;  4EB6 E;  3L09 A;  4IGU A;  3T1H T;  3EI0 A;  3P8C D;  4ZI3 D;  2XUE A;  4UM3 P;  5LGN B;  2LHN A;  3R84 B;  1HCI A;  5AQL B;  2XQ3 A;  2WU5 A;  3UU3 A;  4C91 A;  1ZEE A;  4AQG A;  4TWD A;  3BQL A;  1R8I A;  2X51 A;  2UZ6 A;  3C64 A;  3ZMV B;  4HFC A;  4P09 A;  4H9N C;  3HKC E;  4I4T E;  3RRW A;  1NAF A;  1CUN A;  2X67 A;  3SH1 A;  3UU8 A;  1WYB A;  3ABV A;  5JR9 A;  3NZQ A;  3S4U A;  3AE8 A;  4KI0 F;  4ZK1 A;  4O4I E;  1HX1 B;  3C4Z A;  5AFJ A;  3EHZ A;  1MMG A;  2V6Y A;  4ZK4 A;  3N9N A;  4AKH A;  2XAH B;  5FVK A;  2DWK A;  2R6G F;  3WI3 A;  3H3A A;  1MIW A;  4JLE A;  4IDQ A;  3LFM A;  2YMD A;  4HGA A;  2UUC T;  4EZ1 A;  2M6I A;  2L8K A;  3JC6 D;  5DJQ C;  3N9Q A;  3KV6 A;  2EHO C;  2VVN A;  4JEU B;  2E5L T;  2Y56 A;  5HEG A;  3K8P C;  5AIN A;  1YKE B;  4XK9 A;  2KT9 A;  3T8O A;  3ZMZ B;  3L3P A;  5C3J A;  4OK0 A;  1FMW A;  3CIR A;  1UX4 A;  2XY8 B;  3KVB A;  3LK4 2;  5AFM A;  4CN1 A;  4LFB T;  3BQI A;  3ZT6 A;  4Q25 A;  3CX6 B;  2FJD A;  4EOZ B;  2BYN A;  1HF8 A;  2X9X A;  2UUA T;  3P4R A;  3IF8 B;  3MKD A;  2PGZ A;  2VKO A;  2BVL A;  1HG2 A;  1OXZ A;  5LGU B;  2BKN A;  4OYK A;  2Q9Q C;  2A9U A;  4QXC B;  3AAE B;  1XMQ T;  2XQ4 A;  2WZI A;  1W09 A;  4DV4 T;  5AFN A;  2W63 A;  4ZS3 A;  4DBM A;  5FP3 A;  4PNI A;  2KZ7 B;  2XAQ B;  1IJ6 A;  3N2G E;  1YW0 A;  4AQF C;  5LP6 E;  2AXD S;  2MTQ A;  5A1L A;  3ANW A;  2DLR A;  4EZH A;  5AFK A;  3VRA A;  2HN2 A;  2D5U A;  2UXX B;  2KIN B;  5LYJ E;  5HXS A;  4U2Z A;  5IYZ E;  4TV8 E;  4EYU A;  4X66 T;  2I0M A;  4TV9 E;  3ZN0 B;  2BS2 A;  3DTO A;  5M4Y A;  2YEV C;  3CX8 B;  4LFA T;  3AVS A;  3IEE A;  2YOE A;  3JC6 C;  5J5I A;  4AKG A;  4NXN T;  4HFB A;  2XAF B;  4B5D A;  2LLY A;  4U2Y A;  1BR0 A;  2LKH A;  3OJA A;  1T7S A;  4X62 T;  2IC9 A;  4JUY A;  4IHJ E;  5FL1 A;  2XQ9 A;  3ZCI A;  4PIR A;  2W61 A;  2ZM8 A;  3A8Y C;  3D0T A;  4YJ2 E;  4PK5 A;  4A56 A;  2N1G A;  2D9D A;  3AA6 B;  4BJN A;  2WNC A;  4J2C A;  3RYI E;  2BDE A;  1UV6 A;  2EHO A;  3KVA A;  2LOP A;  1YD8 G;  3ZT5 A;  5DQV A;  3AE2 A;  4HN9 A;  5L3B B;  4DV1 T;  3OPC A;  2XSA A;  3LDQ B;  5LA6 E;  1E1H B;  5JRC B;  4OX9 T;  5LXB A;  2BYR A;  2XYS A;  4IE4 A;  3UFE A;  4C90 A;  4UXN B;  4KMC A;  2D2S A;  4CI1 B;  3RX6 A;  3UU6 A;  4F6R C;  4ILB A;  5LJN A;  2CLY C;  2L9Q A;  1YKH B;  4ZJT A;  3IGQ A;  3I9W A;  4MHC A;  2X9Y A;  4ZS2 A;  1T72 A;  3HI2 A;  4MFR A;  2MYS A;  1UUS A;  2ODV A;  2X9H A;  2JPF A;  1D0Y A;  3O1H A;  1KK7 A;  2UU9 T;  1UK5 A;  3PUG A;  1MMD A;  5FXW A;  3WTO A;  3UT5 E;  4H9S E;  1KFY A;  4I50 E;  5HWX A;  5LJM A;  2C5I T;  4CXW A;  5HCM A;  4YFS A;  4EZ4 A;  2BS4 A;  3ZDG A;  2CE7 A;  2W67 A;  2IIU A;  3AB3 B;  3DP7 A;  5AQJ B;  2RPA A;  2XQ5 A;  5JDQ A;  3B13 A;  3RQU A;  2WN9 A;  4X1I E;  1FMV A;  3ZCJ A;  2XZ6 A;  3RGL A;  2E9X D;  4OHF A;  2UXB T;  3OVU A;  3FZM B;  1M62 A;  5GON E;  2KXP B;  2C5K T;  4JBW F;  4KUM B;  3LBX A;  2YME A;  4FRR A;  1D1C A;  3AXJ A;  5EK3 A;  3TLW A;  3CVR A;  1Y64 B;  2LRL A;  2YKS A;  4AKR B;  5JDG A;  5SYO A;  4I55 E;  2H7O A;  2CEA A;  2SPC A;  2DWG A;  3ZLI A;  2DHR A;  3OBV E;  5HEJ A;  4GOU A;  2XYT A;  2IC6 A;  3N9M A;  4UV8 B;  2V26 A;  4QAA A;  3FZL B;  3PUQ A;  1UX2 A;  3SS1 A;  3ONJ A;  5L3C B;  2ES0 A;  3KV4 A;  4HFH A;  3LG7 A;  4I0U A;  4B3T T;  5H6R B;  1UCU A;  3ONL C;  4JV5 T;  1HNW T;  4BQT A;  3UUN A;  2YIN A;  1WFD A;  3SFD A;  4ZXL A;  4A5X A;  2WNL A;  2IML A;  1MIY A;  2WP9 A;  2CLY B;  2Y58 A;  3CKD A;  4N78 D;  1KNR A;  4IE5 A;  2WY2 A;  2XQ8 A;  4GYS A;  4KX6 A;  4DR2 T;  2KLQ A;  2HHH T;  5JH7 E;  2N2N A;  1FEW A;  2J62 A;  5AQF B;  2V7L A;  5ABH A;  2BYS A;  3CQC B;  1LKX A;  4UEM A;  2LSY A;  4DV7 T;  4ZOL E;  3Q5X A;  4DV3 T;  3MJX A;  4DR3 T;  1XWM A;  4IDZ A;  1HG5 A;  2H3R A;  1BR4 A;  3WAJ A;  4DV0 T;  2J1D G;  3ZC0 A;  4KHP T;  1Y01 A;  3QK6 A;  3VKH A;  2V5C A;  5L47 A;  2IDO B;  2B1E A;  2ZM0 A;  3IHR A;  4YY3 T;  4GIW A;  4E7Z A;  4HWC A;  3K3O A;  2WZH A;  4GYR A;  5L3G B;  3AEF A;  4DUY T;  1O3X A;  3RC3 A;  3TKL B;  2X0L B;  3Q2M A;  4LF6 T;  3AEC A;  5KZU A;  4H9P C;  4QKN A;  2WAU A;  4CN6 A;  2WQY A;  3NRX A;  3PEO A;  1MMN A;  2YK0 A;  1SHZ C;  2PG8 A;  3AE1 A;  3Q5W A;  2C5J A;  3KV5 A;  1OED C;  2JMK A;  3RYH E;  2I6H A;  4JI2 T;  3CK6 A;  4EIW A;  2UUB T;  3AA7 B;  4DMV A;  2BYQ A;  3IBP A;  3WTN A;  4UR9 A;  2D0T A;  2NOX A;  2KMF A;  5LHG B;  5JRC A;  4YTP A;  3ZST A;  3WTL A;  3FHN A;  3WTH A;  1D0X A;  2WCA A;  2XQA A;  1XMO T;  3AEG A;  3QB5 A;  4HWD A;  3AVR A;  1WYC A;  3RF1 A;  3C98 B;  2EHO B;  1M7K A;  3PUX F;  2VK9 A;  1E7P A;  4K0U A;  4AXP A;  5AQT B;  2YDR A;  2CBJ A;  3J7Y q;  1VRB A;  2X9W A;  2W8G A;  4Z91 A;  1YXR A;  3RLF F;  2LRK A;  4YTN A;  4JI8 T;  4O4H E;  3GA8 A;  4U74 A;  2XQ6 A;  1BR2 A;  2LE8 A;  3FZH B;  5C8Y E;  3HKB E;  5J5H A;  1GQE A;  2FBW A;  1HNZ T;  2ZM2 A;  3MZK B;  4AI6 A;  4XAX B;  4H63 V;  1XDO A;  3F2E A;  5JME A;  3N9L A;  4LFC T;  2X00 A;  2XQ7 A;  3JAE A;  4JEH B;  4AKL A;  4AIS A;  1VCT A;  3ETU A;  3OYX A;  4KBM B;  4TWF A;  2LHR A;  4DV6 T;  2K5B B;  3CML A;  2WS3 A;  3CX7 B;  2WBL A;  4YTM A;  5JVD E;  3NWI A;  3SQ6 A;  4NIQ A;  2MBG A;  2JQK A;  4FJO A;  3T4M A;  2IW5 B;  3Q5E A;  3UU4 A;  4YSZ A;  4HWH A;  4WNK A;  4H9R C;  1MNE A;  3GN5 A;  5FL0 A;  2CXL A;  4CXY A;  2CXD A;  3G06 A;  4AQY T;  5TVC A;  2WSS V;  4YLH A;  2BG9 E;  5HXC A;  2JRK A;  4BAY B;  4IDN A;  2VVS A;  2CHN A;  3PUR A;  3PJA A;  3TLU A;  4HKA A;  2ZLY A;  2WWV A;  2PH9 A;  1L0V A;  4TZ4 C;  2V1D B;  3RKG A;  4X5T A;  1S35 A;  2V7I A;  3RYF E;  4DUZ T;  2CWY A;  3NVO A;  2AE9 A;  2NR4 A;  3H37 A;  2DL1 A;  2OV9 A;  2NW7 A;  3U8M A;  2XM2 A;  5FY0 A;  2X66 A;  4TX5 A;  1MND A;  4XBF B;  2NP9 A;  3VU7 H;  3ZC1 A;  3BQK A;  4EGW A;  2BG9 C;  2VB6 A;  5L4H A;  2BJ0 A;  2UXD T;  3ANW B;  4IT4 A;  5ABG A;  2W00 A;  1J5E T;  4PFP A;  4B3S T;  3M3Z B;  5H6Q B;  2BG9 B;  5BW2 A;  5J1G A;  3M65 A;  4IRE A;  1U5P A;  3ZYL A;  3ZJ2 A;  4IST A;  4H63 H;  1QLB A;  2Y6X A;  4YSX A;  4TNW A;  1Z8U A;  2X0H A;  1QUU A;  1OWA A;  4CI2 B;  4CZZ B;  2QRX A;  2QA7 A;  3PUA A;  3Q9D A;  2Q9Q A;  2V8S V;  2KWH A;  2J4G A;  5LHH B;  1OED A;  5JR9 C;  2XPK A;  5CJ5 A;  5FY1 A;  4G2A A;  5CGM A;  1I6Z A;  1FJG T;  3FBZ A;  3WTJ A;  4IL9 A;  4DV5 T;  4HWF A;  4EAH A;  5BMV E;  2LOS A;  5LNK A;  2E9X B;  5AQS B;  4KHZ F;  5DAB A;  3AE4 A;  4YJ3 E;  3AEE A;  3FB2 A;  4TN7 B;  3OTO T;  3AED A;  3B57 A;  3VRB A;  3V5S A;  3LK3 B;  3WTK A;  2YU2 A;  4P1N A;  5AQN B;  2Q9Q D;  2LM2 A;  3E08 A;  1LRZ A;  4ZJS A;  3ETV A;  4U7Y A;  4DID B;  4ZI2 C;  4B6X A;  1HS7 A;  3GN5 B;  1X9B A;  2CA5 A;  4AKI A;  3JAF A;  5AQI B;  5BRX A;  4X1K E;  2G0U A;  5AFM B;  3AA0 B;  2H7V C;  1WCR A;  3HA4 A;  5LMN T;  2BR7 A;  2OA5 A;  5AQQ B;  2Y54 A;  2IHR 1;  2OLT A;  4KP3 C;  5BP0 A;  1D0Z A;  1KNP A;  1NEN A;  4D01 A;  4WV9 A;  2H89 A;  3QC9 A;  1B7T A;  5ABF B;  3ZYM A;  4X1Y E;  4XZC A;  3F57 A;  4ZEY A;  3N9O A;  2XNV A;  2DI4 A;  4O4L E;  2XAG B;  4L5G A;  1IBK T;  5BR8 T;  4GKK T;  5CFB A;  2NW9 A;  2E8I A;  2ZMA A;  3TLS A;  4U33 A;  4DO0 A;  4V1A v;  4I43 B;  4AQF A;  2V6Y B;  1CHU A;  5LBQ B;  3PU8 A;  1S94 A;  2L3L A;  3K3N A;  2W62 A;  3MXZ A;  4IIJ E;  4UVA B;  2NTX A;  4MAL A;  4LF4 T;  4O8S A;  4BJM A;  1HNX T;  2XAS B;  5LCY A;  5HCJ A;  3PV0 F;  3R6N A;  2WMO A;  2FJE A;  1IBL T;  1W0A A;  2B76 A;  5TAO A;  2XSB A;  1W0B A;  4YSY A;  3EDV A;  5KDM C;  5AQP B;  1T8B A;  3SWH A;  4PK4 A;  2CWO A;  3SRZ A;  5AQH B;  5J5F A;  5LXT E;  3PUZ F;  3SQ9 A;  4UIG A;  4LF5 T;  4AIU A;  2H88 A;  3X1D A;  4IE7 A;  3GWH A;  4CN4 A;  5JDH A;  2WZY A;  1NWM X;  3V5U A;  5HAX A;  2XJ7 A;  3I1A A;  5LGT B;  2RP4 A;  3WIP A;  2K48 A;  4Z90 A;  5JRE A;  3GUA A;  5EK2 A;  3JCF A;  2HPL A;  3RIA A;  3EDU A;  1JNR A;  1LVF A;  4CI3 B;  5DQW A;  4MBQ A;  5LMU T;  3ZN1 B;  3N9P A;  4YT0 A;  1MIV A;  1LVK A;  5ABF A;  4TUY E;  3LSV A;  5FMN A;  3C50 A;  5EZY E;  2BR8 A;  3P50 A;  5JTG A;  3OYZ A;  3ZSS A;  3Q5D A;  2KSR A;  2A2F X;  2KWI B;  2PJQ A;  3DJB A;  2V7M A;  4EYY R;  1I9B A;  1NEK A;  2UXC T;  2Q9Q B;  1SUM B;  1ZV4 X;  5IHY A;  1Z0P A;  3JAD A;  3IA3 A;  4WYV A;  4HQP A;  4BFQ A;  4UF0 B;  2LEH A;  3B5M A;  4PJN A;  1HR0 T;  4DR7 T;  3J9X 1;  1N32 T;  4UM3 S;  1KEY A;  1U4Q A;  4IDO A;  4QAC A;  4PJL A;  2W2U A;  3AE6 A;  3SFE A;  3QNU A;  5JQG E;  5AQR B;  3AE7 A;  3NZP A;  4ISS A;  1HX8 A;  1I94 T;  4YHJ A;  4JI7 T;  4B3M T;  3EAM A;  2FUP A;  1E2A A;  3U78 A;  5ETW A;  4ERR A;  2E9X C;  3CWZ B;  3RRC A;  3CQG B;  3C4W A;  1JNZ A;  1ZP0 A;  2QC1 B;  1N34 T;  3PUV F;  2Z6E A;  2E2A A;  4IE6 A;  2W0G A;  2JQQ A;  3FZK B;  3UUX B;  2VKH A;  3AE5 A;  2WMN A;  3TLV A;  5CO5 A;  4FI5 A;  4JI1 T;  1HTJ F;  3P4Q A;  2PBI A;  4P0B A;  4JI6 T;  4TNV A;  2XTL A;  5HXH A;  3P7I A;  5IUX A;  4PJM A;  2WNJ A;  4BA9 A;  5LBM A;  4X20 E;  2NWB A;  4TWH A;  2ODU A;  2WU2 A;  2XHE B;  5CA1 E; 
#chains in the Genus database with same CATH homology
 5AIN A;  2XNU A;  5JME A;  3RHW A;  2LKH A;  4HFH A;  4HQP A;  3WTI A;  4NZB A;  4QAB A;  4BFQ A;  2X00 A;  4ILC A;  2BYP A;  2XQ7 A;  4XK9 A;  4IL4 A;  4UM1 A;  3WTO A;  3JAE A;  2XQ9 A;  3PEO A;  5HCJ A;  4PIR A;  3UUB A;  4BQT A;  4ALX A;  2BG9 C;  3EI0 A;  4XHE A;  4F8H A;  3TLT A;  4UM3 S;  4ZR6 A;  4UY2 A;  4UM3 P;  1OED B;  3WTK A;  5L4H A;  4TWF A;  2BJ0 A;  4A97 A;  2LKG A;  1OED C;  2WNL A;  4QAC A;  5HCM A;  5AFM A;  2W8F A;  4UXU A;  2Y58 A;  5HEO A;  2LM2 A;  2XQ3 A;  3C79 A;  5AFH A;  5L4E A;  4ZJS A;  3UU3 A;  3ZDG A;  2BYQ A;  4TWD A;  2WNC A;  3SQ6 A;  2XQ8 A;  3WTN A;  1UW6 A;  2BYN A;  2BG9 B;  3T4M A;  3JAF A;  2UZ6 A;  5BRX A;  4ZZB A;  2YN6 A;  4HFC A;  5J5F A;  1UV6 A;  3UU4 A;  2Y57 A;  2PGZ A;  5J5G A;  5AFM B;  5BW2 A;  3WTL A;  4IRE A;  3EAM A;  3WTH A;  3SQ9 A;  2BR7 A;  3RIF A;  4LML A;  2XQA A;  5LG3 A;  4LMK A;  2XQ5 A;  2BYS A;  2Y54 A;  5BP0 A;  3RQU A;  3SH1 A;  2WN9 A;  5HEH A;  5FJV A;  3ZKR A;  2XQ4 A;  3UU8 A;  4HFD A;  2WZY A;  2XZ6 A;  5TVC A;  2BG9 E;  4LMJ A;  5AFN A;  4D01 A;  5LXB A;  2QC1 B;  4WV9 A;  2BYR A;  4DBM A;  2BG9 A;  4TNW A;  2XYS A;  3WTM A;  3WIP A;  3U8L A;  4Z90 A;  4AFG A;  4ZK1 A;  3GUA A;  4AFH A;  2XZ5 A;  5AFL A;  4AFT A;  3TLV A;  3RIA A;  5AFJ A;  4QH1 A;  5CO5 A;  3EHZ A;  4ZK4 A;  4COF A;  4NPP A;  3TLU A;  2XNV A;  2YME A;  2C9T A;  4FRR A;  2W8G A;  4Z91 A;  3TLW A;  2VL0 A;  3RQW A;  3LSV A;  5L47 A;  3UQ7 A;  5AFK A;  4ILA A;  2XNT A;  4A98 A;  4TNV A;  3UU6 A;  4ZRU A;  2PH9 A;  4ILB A;  2YKS A;  1OED A;  2BR8 A;  3UU5 A;  2ZJV A;  3P50 A;  5CFB A;  5SYO A;  3RI5 A;  2YMD A;  4X5T A;  1OED E;  4HFI A;  4ZJT A;  3P4W A;  5HEU A;  3U8N A;  2XQ6 A;  3TLS A;  3WTJ A;  2KSR A;  4EZ1 A;  3IGQ A;  4UM3 A;  4IL9 A;  2M6I A;  5IUX A;  2WNJ A;  3PMZ A;  4HFE A;  5J5H A;  1I9B A;  4QH4 A;  2MAW A;  3SIO A;  5HEJ A;  5KE4 A;  3C84 A;  3U8M A;  5J0Z A;  2XYT A;  2X00 D;  3ZDH A;  2ZJU A;  2YOE A;  3UQ4 A;  4ZZC A;  4QH5 A;  2Y56 A;  2M6B A;  4QAA A;  4TWH A;  2Y7Y A;  3U8J A;  5KZU A;  5HEG A;  1UX2 A;  5J5I A;  3U8K A;  4B5D A;  4HFB A;  3JAD A;  2LLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...