4ILBA

The pentameric ligand-gated ion channel glic a237f in complex with rubidium
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 95
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ilbA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ilbA01
4UM3S 3ZKRA 3IGQA 4ZJTA 3GUAA 3UU5A 5IUXA 5BP0A 3U8LA 5HCMA 3SQ9A 4IL9A 4AFTA 5J5FA 5KZUA 2BYRA 3UUBA 2YOEA 5TVCA 2X00A 2LM2A 3EAMA 4ALXA 3SIOA 5AFNA 2Y56A 5L4EA 3UU4A 2ZJUA 3U8JA 1UW6A 2YN6A 4PIRA 3LSVA 3ZDHA 3TLVA 4UXUA 5JMEA 4HFBA 5CFBA 3WTOA 4BQTA 2XQ5A 2YMEA 2X00D 4ZK4A 3T4MA 3RIFA 3UU8A 2M6IA 2XQAA 3P4WA 3PMZA 1I9BA 3JAFA 1UX2A 4EZ1A 5LG3A 3WTLA 4ILAA 4D01A 1UV6A 3U8KA 4XK9A 5HEOA 5AFMB 5BW2A 4IREA 2XNTA 2Y57A 4TWHA 3P50A 3JAEA 2XNUA 4QH1A 2XYSA 4HFIA 5J5GA 4ZZBA 1OEDC 3TLTA 4A97A 4BFQA 4ZR6A 3WTNA 4X5TA 4AFHA 5J5IA 3RIAA 2BYPA 4HFHA 3UU3A 2WNJA 5FJVA 2XQ4A 4Z90A 3EI0A 2WZYA 4ZK1A 3WTIA 2M6BA 2Y58A 2XZ5A 4QABA 5AINA 2C9TA 2XQ7A 2W8GA 2MAWA 4TNWA 4ILBA 4HFCA 3C84A 3WIPA 3TLWA 3EHZA 3U8NA 4UM3P 5AFJA 2BG9B 2BG9E 5HCJA 3ZDGA 2W8FA 5AFLA 3SQ6A 4XHEA 2BYQA 5HEUA 5CO5A 3WTJA 2Y54A 4HFDA 4DBMA 5BRXA 4QACA 3JADA 2BG9A 2BR7A 4NZBA 4TNVA 4TWFA 2XNVA 2XQ6A 4AFGA 4A98A 2LLYA 2XQ9A 2BYNA 2XZ6A 3WTHA 2LKHA 4COFA 5J0ZA 2XYTA 3RHWA 5AFKA 4UM3A 4UM1A 4QH4A 2WN9A 2VL0A 5L47A 3TLSA 4ZZCA 1OEDB 3TLUA 2PGZA 1OEDE 2YKSA 4WV9A 5HEHA 4B5DA 3WTKA 4LMKA 4LMLA 2KSRA 5HEJA 2WNLA 2Y7YA 2ZJVA 4FRRA 4UY2A 2BJ0A 2QC1B 5J5HA 3RI5A 5AFMA 4HFEA 4QH5A 4HQPA 3WTMA 4NPPA 3PEOA 5HEGA 3C79A 2YMDA 4ILCA 3UQ7A 4F8HA 3UQ4A 5LXBA 3U8MA 5KE4A 5L4HA 5SYOA 3SH1A 5AFHA 3RQUA 2BG9C 2PH9A 4QAAA 4TWDA 3RQWA 1OEDA 2LKGA 4Z91A 2XQ8A 2XQ3A 4IL4A 2BYSA 2UZ6A 2BR8A 4ZJSA 4LMJA 4ZRUA 3UU6A 2WNCA
chains in the Genus database with same CATH superfamily
3B5MA 2X51A 1MNEA 2OA5A 1ZOYA 2GK9A 5LOVE 3ZJ1A 3DTOA 2VKHA 4IDZA 4G2AA 3RYFE 2EHOA 3UFGA 5AFNA 1M62A 2MOZA 3G06A 2EHOC 3ZJ2A 4PNIA 2VQFT 3P4WA 4JI6T 4H9OC 3JAFA 1UX2A 4D01A 4QH1A 1NAFA 1OEDC 5H6RB 4X5TA 3MZKB 2WDQA 5EK4A 3SWHA 4LF6T 2WZYA 3FBZA 2LJLA 3IHRA 3UT5E 5L3CB 2N1GA 2JIWA 3WIPA 4X64T 4MLKA 4ERRA 4X65T 4LF5T 1UURA 2LLYA 2XQ9A 4AXPA 4UM3A 5AQMB 3IEEA 3ZLIA 4DV3T 3L8RA 4I43B 3M3ZB 3CKDA 2E2AA 2XPKA 2Y7YA 3PUGA 4DMVA 3PEOA 2NP9A 4F8HA 2CBJA 3VRBA 2PFVA 3AA1B 1IJ5A 4KI0F 4HWHA 2XQ3A 5LA6E 3ZMTB 3UU6A 1J1JA 3F57A 3ZMSB 4CI1B 4EIWA 4IHJE 4X1YE 4DV7T 2MYSA 5AQGB 2ZJUA 2YN6A 3LSVA 5LG4A 3U78A 4HFBA 4BA9A 4BQTA 4BAYB 3N9MA 4UIGA 5FNVE 1FJGT 1T98A 1G73A 3C50A 4O2AE 5LGUB 4JLEA 4UXNB 3PJAJ 4NUUA 3WTIA 3NRXA 3RKOA 2LSIA 4HN9A 2V6YB 2C9TA 2XSBA 1T8BA 4UM3P 5AFJA 1WYCA 1L0VA 3ZDGA 3SQ6A 2WP9A 5CJ5A 1KNRA 5J2UE 3UTKA 1LVFA 3HKCE 3D0TA 3AECA 5KMGP 2WU5A 3AAEB 3PUSA 3PJAA 1CHUA 1HG2A 3ZYKA 4DV0T 4M1PA 2ACXA 5LYJE 3ZEFB 2YKSA 4YSZA 2PGZA 3FB2A 2IHR1 3ZSTA 3N9NA 4LMLA 2ZM2A 5KDMC 3LG7A 4KUMB 3PUZF 4J2CA 2LHNA 3AE3A 3C79A 2Y6XA 2D2SA 3OVUA 5L4HA 3PUQA 4GK0E 5ADXL 4P09A 4Z91A 2LSGA 1AJ3A 3J9X1 4I0UA 4V1Av 4ZRUA 3VRAA 3KDSE 2B76A 2WMNA 3AB3B 3CQGB 4DV1T 4WNKA 1ZHCA 4IDPA 5CA1E 2VL8A 1WFDA 3V5UA 5J2TE 5L2LA 1O3XA 4JV5T 3P4QA 3V5SA 2UXNB 2W2UA 5LB7B 4YSYA 2MPKA 5LG3A 4ILAA 2JQKA 3PUXF 2XNTA 5ABFB 3KV4A 3RF1A 1N34T 2JQQA 1D0ZA 4YXDA 1HNZT 4DR4T 1YD8G 2BBJA 4ZI3D 1LVKA 4CXXA 3S4UA 2CHOA 2XZ5A 2IMLA 2WS3A 4IE5A 4ANJA 2W66A 4YLHA 2DHRA 2LRKA 4CI2B 2XUEA 4UV9B 3AA6B 5DJQC 2W8FA 3KBUA 4CQIA 2KWHA 4DBMA 3FZHB 3HKEE 4TWFA 4YJ2E 3NWIA 3CWZB 4TX5A 2CA5A 1BR1A 5LHGB 3ZCIA 3L3PA 4OX9T 2XAFB 2XAQB 1CUNA 4H9NC 5HWYA 3NZQA 1IZNB 2XJ7A 4ILCA 4QHOA 5LBMA 1XZYA 4H9QC 3T1HT 2EHOB 3I0QA 3ZKRA 2M67A 3RYIE 2HHHT 4AI6A 4JEUB 2XAJB 3AA0B 5AFUL 3O9XA 3SIOA 1J5WA 3CX8B 3SS1A 5L4EA 4LF7T 5M4YA 2BS3A 1XMQT 5E0OA 5CFBA 1S35A 1NEKA 3WTLA 4X1KE 2V6YA 4YJ3E 3ETVA 5LJNA 2I6HA 3TLTA 2K24A 4MALA 1T7SA 4HWIB 5HXRA 4HKAA 4CN1A 4BJNA 2M6BA 4PK4A 2XQ7A 5EK2A 3RRWA 5L3DB 3LBXA 1US7B 5HYAA 5BRXA 1FEWA 2RPAA 4NXNT 3O1IA 3RHWA 3H3AA 1V9DA 4DBQA 4H63H 4HFVA 4HTEA 1MIVA 3AVSA 3K3OA 2K5BB 4H9RC 3AEEA 4AKHA 4MFRA 2BS4A 3FZLB 3UQ7A 3ZMVB 5LXBA 5JH7E 2V7JA 4OFZA 5AQHB 3QNUA 4ADZA 4YTPA 3PV0F 4DV4T 2OLTA 2V26A 3AEDA 2CXDA 2DWGA 5LCYA 2YOEA 4DBRA 4ISTA 3Q5DA 3CX6B 4L0RA 1KF6A 2G0UA 3L39A 4ZK4A 3AE9A 2SPCA 3ZC1A 3N2KE 2DL1A 4TN7B 2W0GA 2Y57A 4P0BA 3JCFA 1BR0A 2XNUA 2H88A 5J5GA 2CPTA 3O4XE 4JI8T 1M7KA 1NWMX 2X0HA 4ZI3C 1E2AA 3FZMB 5ABFA 5JRCB 1U5PA 5JR9A 4ILBA 3K1SA 2PG8A 5JDQA 4U72A 5ABEA 1UGOA 2BKOA 4ISSA 3PURA 4YSXA 2BR7A 4IE4A 4PAGA 2XZ6A 5J0ZA 4QH4A 2J4GA 2YDRA 4ZZCA 5EK3A 2D0TA 5J1GA 2V7KA 2KNDA 3R6NA 4ASKA 3LBXB 3OPCA 1X79A 3P4SA 1FMWA 4U7YA 3HI2A 4YTNA 3C4WA 5FVKA 3RIUA 4XZCA 2BG9C 5FL1A 5AQLB 1I94T 1HNWT 4QAAA 3RQWA 3PU8A 2XQ8A 2BZBA 3UU5A 3ANWB 3KV9A 4IDQA 4DV6T 1UCUA 4YTMA 4QXHB 2W67A 3UUBA 2HPLA 4AQFA 4ALXA 1OWAA 2CWYA 2V1DB 3UU4A 4O4HE 5HWXA 3U8JA 4PIRA 4UXUA 5EZYE 4WYVA 2NTYA 2YDQA 2IAKA 4KHZF 3RH3A 3WAJA 3CK6A 3EDUA 5AQRB 1HTJF 2H3RA 4PK6A 4TV9E 5FXZA 2BYPA 2D0UA 2XQ4A 4GK5E 4DMWA 1IBLT 3GWHA 3HA4A 3IF8B 5FXWA 3U8NA 5JDMA 2BG9B 4O4IE 2YINA 5JDGA 3WTJA 1NENA 4LFBT 3PU3A 3HKBE 3W15B 2D5UA 2VB6A 2LSJA 4OHFA 3ZMUB 1HFAA 4OK0A 1VCSA 2A2FX 4WV9A 3N2OA 2DLRA 2YU2A 2FBWA 1E1HB 3NZPA 4LF4T 4GKKT 2Y8DA 4GKJT 5JQGE 5BMVE 1ZKEA 4JI2T 2CCQA 2JJ9A 2XHEB 2FJDA 3A7MA 3A5XA 2JMHA 4UM3S 2VASA 1MMAA 2WU2A 3NBXX 4AFTA 3QB5K 3AE2A 2BYRA 5TVCA 3R84B 2Q9QB 4Q25A 3O1JA 1T72A 2VKJA 3PUAA 2E8IA 5ABGA 3ZC0A 3ABVA 3UU8A 3PMZA 4G63A 2X0YA 4EZ1A 4IREA 3I1AA 2LHRA 4UF0A 3FZFB 2CEAA 3LJCA 2IUBA 4I50E 1XDOA 4CN6A 2RP4A 2HH7A 2NOXA 5FYMA 4DIDB 2YDSA 4ZOLE 3ZN1B 4L5GA 2MBGA 5AFKA 3B57A 1YKEB 1X9BA 4DR7T 4KMCA 2OV9A 3C4ZA 4GIWA 4LMKA 2X9WA 2WNLA 4ZI2C 3F31A 5JDLA 2QC1B 3ZN0B 3WTMA 5HEGA 3AE1A 3NKZA 1UUSA 2CE7A 3P8CD 4WZXA 2ES0A 3L09A 1MIWA 1QUUA 5AQIB 3IGQA 3MA9A 3HR0A 2WB5A 1WR6A 5J5FA 2I0MA 2LM2A 2ZM6T 2Y56A 2LOPA 2WM9A 3TLVA 2XM2A 5AFMB 5HEOA 3N9LA 2V7MA 4U2YA 3RKGA 2JRKA 5BR8T 5JDNA 3RIUC 2KWIB 4QKNA 1HF8A 3BQKA 1IBMT 4X20E 1KNPA 4CXYA 2C5IT 2C5KT 5FY7A 3CQXC 4N78D 4PJMA 3N2GE 2CRBA 3AAIA 3KV5A 2W00A 4UEMA 5AFLA 3CVRA 5CO5A 4QACA 1VOMA 1IBKT 2XNVA 5LGTB 3O1HA 2XYTA 2X9HA 4UM1A 4DV5T 4QXBB 1HNXT 2WN9A 4C91A 3LFMA 4JI4T 4L9IA 2C5JA 3TLUA 2UXBT 3P7IA 2X68A 4EV6A 3QC9A 1Z0PA 3WI3A 3AEBA 2X0LB 3ZT7A 2XQYA 4DR2T 3VKGA 2IIUA 2HN2A 4EYUA 2QYWA 1KEYA 4EAHA 3VU7H 4JI0T 3T8OA 2LKGA 5A1LA 1LKXA 4LMJA 4U33A 3PE0A 2WNCA 3AXJA 4ZJTA 2CM0A 2ZLYA 5BP0A 2K3WA 1E7PA 4IDOA 3MK7C 4ZI7E 4GYSA 2IW5B 3KBTA 3OJAA 3H37A 2ACZA 3EAMA 4P0AA 5KX5E 2Q9QA 3AE7A 4IT4A 4QX8B 3ZDHA 4DUZT 3WTOA 3T4MA 4KX6A 4EYYR 2C0SA 2LEHA 1H7CA 3JAEA 4FJOA 1YXRA 2WWVA 1WYBA 3KVBA 1LRZA 1R8IA 2VK9A 2X67A 4HFHA 3KVAA 4ZK1A 1YQ4A 3QOFA 4QABA 2JQHA 2W8GA 5JDHA 2UXCT 3TLWA 1KK7A 3AE8A 2E9XA 3VR8A 4B3ST 4UVBB 1UX5A 4HWCA 4UV8B 1J5ET 3AXJB 2KXPB 2VL0A 2LSKA 5AQKB 4B3MT 2VURA 4HEAA 5LHIB 5FXVA 1GQEA 2VVSA 5KE4A 5AFHA 3RQUA 2N9DA 1OEDA 5C8YE 1W9RA 4ZJSA 3GA8A 1I6ZA 3KV6A 1KNZA 1W0AA 5IUXA 2BS2A 3RPUA 3SQ9A 4IL9A 2E5LT 2X00A 2V7IA 3QK6A 4ZHQE 2XQ5A 5AQVB 5LGNB 4ZI2D 4HE8A 2UUCT 5BW2A 2WCAA 2LSYA 2JPFA 2XYSA 1MIYA 2CLYC 3AE5A 3WTNA 3OBVE 5IWAT 3RC8A 4CN4A 2AE9A 4IE0A 2LOSA 5JVDE 2XAGB 1HS7A 2Q9QC 4B3RT 2IC9A 2L3LA 5FY0A 4EOZB 3RC3A 1W09A 4NXMT 4CZZB 5DQVA 4X66T 4GOUA 3I9YA 3ONLC 3NVOA 2CMRA 3F2EA 4UY2A 2KMFA 5H6QB 1BR2A 1HX1B 2NW9A 4AQGA 3UQ4A 1D1BA 4ZXLA 3ETUA 5AQQB 5LMNT 4KHPT 4MHCA 2FJBA 4IL4A 3JC6D 2HPJA 2VKOA 1JNRA 3IA3A 2XSAA 3N9OA 2Z6EA 4AKRB 5CB4E 1D1CA 2WSSV 4ZS3A 3C64A 5CA0E 1N32T 3B13A 5LMUT 1XNRT 4HWFA 1XMOT 3N5LA 3OTOT 5HXCA 4X1IE 1UV6A 1SE7A 3BQIA 4U74A 4ZZBA 2VWAA 4A97A 4AFHA 3RIAA 2WNJA 2LRLA 4CI3B 4UVAB 3GMIA 2UUAT 4UF0B 4AQYT 1XNQT 4H9PC 3Q5EA 1JNZA 2MAWA 5HAXA 4AKGA 2XAHB 2Y48B 2BG9E 2V8SV 1MMGA 4DO0A 2V5CA 2YEVC 3DP7A 2UU9T 4JYAT 3C4XA 3VHLA 4TNVA 2NWBA 4YT0A 4WBNE 4A98A 2LKHA 5F3JA 5DQWA 2RA1A 4DVDA 4Z8XA 2NTXA 4WW0A 2W4XA 2QGSA 2WZHA 4TUYE 4ZS2A 2A9UA 4KP3C 3WTKA 2KSRA 4TV8E 3UUMA 4EB6E 4QH5A 1WLXA 4DR3T 2J1DG 4XBFB 3U8MA 3EABA 1UX4A 4FI5A 3SH1A 2KLQA 5ABHA 4DV2T 3E22E 3ONJA 4ILUA 3FHNA 2FJAA 2BR8A 2Q9QD 2KZ7B 5AQTB 2K48A 2WZIA 1MNDA 2BVMA 3U8LA 4DR6T 2UUBT 2CWOA 5AQOB 1IJ6A 5L3BB 2X66A 3PUVF 3HL6A 4QXCB 5AQSB 5JTGA 1WCRA 3I0OA 2X00D 1B7TA 2XQAA 2CBIA 3CX7B 1YQ3A 5HXSA 1EZ3A 4HFIA 1XWMA 4JUYA 4ZR6A 5C3JA 3ZSSA 4EEBA 2H89A 2QA7A 2XM1A 3ZT5A 5LJMA 2IDOB 2BVLA 5LXTE 5KXJA 2MTQA 4A56A 2Y54A 4LF8T 3RYCE 3JADA 2XTLA 4OYJA 3CPZA 4NZBA 3ANWA 4U3CA 1WR0A 4NUVA 4F6RC 2JQ9A 5L47A 4NIQA 3TLSA 2KT9A 1OEDB 3A8YC 3K3QC 2L8KA 4EZ4A 2LT3A 2HN1A 3RYHE 4FRRA 1MMDA 5J5HA 4KBMB 4NPPA 3P4PA 5LBQB 4JEHB 1D0XA 4PJNA 4U2ZA 3CMLA 5FVLA 5FL0A 3EVYA 3IBPA 2W63A 2LM9A 4I4TE 4O4JE 3SFDA 3TKLB 3NRYA 5HCMA 5F8PA 4EGWA 4PFPA 2E9XB 2ZM8A 3SOLA 4X62T 1HG5A 5AQJB 2WDRA 3Q9DA 1VRBA 2W62A 4XAXB 5JRCA 4K0UA 2EHOD 3K3NA 1HX8A 2DCFA 3AA7B 2M6IA 3RIFA 2WAUA 3AE4A 4XK9A 3AEGA 3ZYLA 1QLBA 4DUYT 3X1DA 3MKDA 5IYZE 4HGAA 3RLFF 3P4RA 4PJJA 5LP6E 5AINA 3OYZA 4IGUA 3ZCJA 3EHZA 5HXHA 4CXWA 2J47A 2DNXA 4XHEA 2BYQA 4UELA 3PUYF 2V7LA 3K8PC 2XQ6A 4ZEYA 2V5DA 5L3GB 2ODUA 2V6XA 3N9PA 3C98B 2P9BA 3GN5B 3E0ZA 2QVAA 1OEDE 2E5VA 3CQCB 2A3DA 2YK0A 1W0BA 2CHNA 5HEJA 2ZJVA 4UVCB 3PDYA 4HFEA 4OYKA 4HQPA 4EXTA 2F4VT 4LF9T 3AVRA 4LFAT 2PH9A 2WWUA 3N9QA 4U31A 2BKPA 2XASB 2WBLA 2B1EA 1SUMB 2NW7A 4H9SE 4PJLA 4E7SA 1MMNA 2YU1A 5FMNA 3Q5XA 3UUNA 4B3TT 4IE6A 3VKHA 2H7OA 1VCTA 2PJQA 5FKYA 2YMEA 3C51A 4JI5T 1I9BA 4JBWF 4DNDA 1XDPA 3HKDE 5CGMA 3P50A 1IAPA 5LNKA 2R6GF 4BFQA 2CLYB 4H63V 2E9XC 4AQFC 4PW8A 4Z90A 4YHJA 5FXXA 2Y58A 2J62A 3MJXA 3PTRB 2AXDS 4WBOA 1QSDA 3KINB 1ZP0A 4MBQA 5HEUA 3UUXB 4TZ4C 2BG9A 3WTHA 4YY3T 4HWDA 4COFA 3U3IA 2I59A 3UFEA 3LK3B 2PBIA 4YHHT 4O4LE 5JR9B 3RI5A 3MXZA 2WQYA 3UULA 2PTFA 1SA0E 4QX7B 3E08A 2X9XA 2DWKA 1Z8UA 4I55E 3ONXA 1ZV4X 4TWDA 2FUPA 4AKLA 1HCIA 3BK9A 3GN5A 4EZHA 5AQNB 2K9AA 2VKDA 2H7VC 5L3FB 3GUAA 4AKIA 4PK5A 1UK5A 5KZUA 1ZEEA 2ZM0A 1KFYA 4E7ZA 3QB5A 4IDNA 5HXEA 1S94A 1UW6A 2CXFA 2DI4A 3EDVA 4JI7T 2VQET 1DU2A 4A5XA 3U8KA 2A72A 4QWNB 3WAKA 2E9XD 4O8SA 3RX6A 5J5IA 3ZPOA 5AQFB 3OKQA 1FIOA 5GONE 1BR4A 2KINB 1Y01A 5FJVA 5IHYA 3FXDB 3EI0A 5JR9C 3OYXA 1SHZC 2VVNA 3FXEB 5LHHB 1OXZA 3ZT6A 5HCJA 2CXLA 5L3EB 4C90A 1G8XA 1FMVA 4IE7A 1WRDA 2L9QA 2BYNA 3T1YT 3DJBA 4GYRA 5C2TA 3Q2MA 2BBHA 3Q5WA 4LFCT 4O2BE 2UXDT 3EUHA 4B5DA 3ZYMA 4IIJE 2D9DA 1YW0A 1YKHB 2FJEA 4K0KT 3AAAB 2W61A 3PUWF 4DR1T 4BJMA 2NR4A 2UXXB 3VR9A 4JI3T 2BYSA 4U7IA 3QUJA 3M65A 2LE8A 4UR9A 3I9WA 4AIUA 5JDFA 1Y64B 2N2NA 3BQLA 5TAOA 2BKNA 1D1AA 3AEAA 5JMEA 3FBLA 3AEFA 3CIRA 5DABA 2X9YA 3LDQB 3MACA 2IC6A 4TWHA 3J7Yq 3RGLA 5FP3A 4AISA 5AQUB 3UU3A 2WY2A 3LK2B 3FZKB 3H3MA 3JC6C 3AE6A 4TNWA 5FY1A 4HFCA 4YFSA 3C84A 3LK42 5AQPB 4JI1T 1N33T 2ZMAA 2NW8A 4HFDA 4PFOA 4AFGA 1N36T 5F5WA 5ETWA 1U4QA 4EEDA 3RRCA 5JREA 5HEHA 3ZMZB 2QRXA 3ESLA 3SRZA 4DR5T 2BJ0A 4P1NA 1D0YA 5AFMA 4B6XA 2XZEA 2YMDA 3SFEA 2JMKA 5SYOA 2WMOA 1HR0T 3KFWX 2WDVA 2ODVA 2UZ6A 2BDEA 2XY8B
chains in the Genus database with same CATH topology
4UM3S 3ZKRA 3IGQA 4ZJTA 3GUAA 3UU5A 5IUXA 5BP0A 3U8LA 5HCMA 3SQ9A 4IL9A 4AFTA 5J5FA 5KZUA 2BYRA 3UUBA 2YOEA 5TVCA 2X00A 2LM2A 3EAMA 4ALXA 3SIOA 5AFNA 2Y56A 5L4EA 3UU4A 2ZJUA 3U8JA 1UW6A 2YN6A 4PIRA 3LSVA 3ZDHA 3TLVA 4UXUA 5JMEA 4HFBA 5CFBA 3WTOA 4BQTA 2XQ5A 2YMEA 2X00D 4ZK4A 3T4MA 3RIFA 3UU8A 2M6IA 2XQAA 3P4WA 3PMZA 1I9BA 3JAFA 1UX2A 4EZ1A 5LG3A 3WTLA 4ILAA 4D01A 1UV6A 3U8KA 4XK9A 5HEOA 5AFMB 5BW2A 4IREA 2XNTA 2Y57A 4TWHA 3P50A 3JAEA 2XNUA 4QH1A 2XYSA 4HFIA 5J5GA 4ZZBA 1OEDC 3TLTA 4A97A 4BFQA 4ZR6A 3WTNA 4X5TA 4AFHA 5J5IA 3RIAA 2BYPA 4HFHA 3UU3A 2WNJA 5FJVA 2XQ4A 4Z90A 3EI0A 2WZYA 4ZK1A 3WTIA 2M6BA 2Y58A 2XZ5A 4QABA 5AINA 2C9TA 2XQ7A 2W8GA 2MAWA 4TNWA 4ILBA 4HFCA 3C84A 3WIPA 3TLWA 3EHZA 3U8NA 4UM3P 5AFJA 2BG9B 2BG9E 5HCJA 3ZDGA 2W8FA 5AFLA 3SQ6A 4XHEA 2BYQA 5HEUA 5CO5A 3WTJA 2Y54A 4HFDA 4DBMA 5BRXA 4QACA 3JADA 2BG9A 2BR7A 4NZBA 4TNVA 4TWFA 2XNVA 2XQ6A 4AFGA 4A98A 2LLYA 2XQ9A 2BYNA 2XZ6A 3WTHA 2LKHA 4COFA 5J0ZA 2XYTA 3RHWA 5AFKA 4UM3A 4UM1A 4QH4A 2WN9A 2VL0A 5L47A 3TLSA 4ZZCA 1OEDB 3TLUA 2PGZA 1OEDE 2YKSA 4WV9A 5HEHA 4B5DA 3WTKA 4LMKA 4LMLA 2KSRA 5HEJA 2WNLA 2Y7YA 2ZJVA 4FRRA 4UY2A 2BJ0A 2QC1B 5J5HA 3RI5A 5AFMA 4HFEA 4QH5A 4HQPA 3WTMA 4NPPA 3PEOA 5HEGA 3C79A 2YMDA 4ILCA 3UQ7A 4F8HA 3UQ4A 5LXBA 3U8MA 5KE4A 5L4HA 5SYOA 3SH1A 5AFHA 3RQUA 2BG9C 2PH9A 4QAAA 4TWDA 3RQWA 1OEDA 2LKGA 4Z91A 2XQ8A 2XQ3A 4IL4A 2BYSA 2UZ6A 2BR8A 4ZJSA 4LMJA 4ZRUA 3UU6A 2WNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM3 S;  3ZKR A;  3IGQ A;  4ZJT A;  3GUA A;  3UU5 A;  5IUX A;  5BP0 A;  3U8L A;  5HCM A;  3SQ9 A;  4IL9 A;  4AFT A;  5J5F A;  5KZU A;  2BYR A;  3UUB A;  2YOE A;  5TVC A;  2X00 A;  2LM2 A;  3EAM A;  4ALX A;  3SIO A;  5AFN A;  2Y56 A;  5L4E A;  3UU4 A;  2ZJU A;  3U8J A;  1UW6 A;  2YN6 A;  4PIR A;  3LSV A;  3ZDH A;  3TLV A;  4UXU A;  5JME A;  4HFB A;  5CFB A;  3WTO A;  4BQT A;  2XQ5 A;  2YME A;  2X00 D;  4ZK4 A;  3T4M A;  3RIF A;  3UU8 A;  2M6I A;  2XQA A;  3P4W A;  3PMZ A;  1I9B A;  3JAF A;  1UX2 A;  4EZ1 A;  5LG3 A;  3WTL A;  4ILA A;  4D01 A;  1UV6 A;  3U8K A;  4XK9 A;  5HEO A;  5AFM B;  5BW2 A;  4IRE A;  2XNT A;  2Y57 A;  4TWH A;  3P50 A;  3JAE A;  2XNU A;  4QH1 A;  2XYS A;  4HFI A;  5J5G A;  4ZZB A;  1OED C;  3TLT A;  4A97 A;  4BFQ A;  4ZR6 A;  3WTN A;  4X5T A;  4AFH A;  5J5I A;  3RIA A;  2BYP A;  4HFH A;  3UU3 A;  2WNJ A;  5FJV A;  2XQ4 A;  4Z90 A;  3EI0 A;  2WZY A;  4ZK1 A;  3WTI A;  2M6B A;  2Y58 A;  2XZ5 A;  4QAB A;  5AIN A;  2C9T A;  2XQ7 A;  2W8G A;  2MAW A;  4TNW A;  4ILB A;  4HFC A;  3C84 A;  3WIP A;  3TLW A;  3EHZ A;  3U8N A;  4UM3 P;  5AFJ A;  2BG9 B;  2BG9 E;  5HCJ A;  3ZDG A;  2W8F A;  5AFL A;  3SQ6 A;  4XHE A;  2BYQ A;  5HEU A;  5CO5 A;  3WTJ A;  2Y54 A;  4HFD A;  4DBM A;  5BRX A;  4QAC A;  3JAD A;  2BG9 A;  2BR7 A;  4NZB A;  4TNV A;  4TWF A;  2XNV A;  2XQ6 A;  4AFG A;  4A98 A;  2LLY A;  2XQ9 A;  2BYN A;  2XZ6 A;  3WTH A;  2LKH A;  4COF A;  5J0Z A;  2XYT A;  3RHW A;  5AFK A;  4UM3 A;  4UM1 A;  4QH4 A;  2WN9 A;  2VL0 A;  5L47 A;  3TLS A;  4ZZC A;  1OED B;  3TLU A;  2PGZ A;  1OED E;  2YKS A;  4WV9 A;  5HEH A;  4B5D A;  3WTK A;  4LMK A;  4LML A;  2KSR A;  5HEJ A;  2WNL A;  2Y7Y A;  2ZJV A;  4FRR A;  4UY2 A;  2BJ0 A;  2QC1 B;  5J5H A;  3RI5 A;  5AFM A;  4HFE A;  4QH5 A;  4HQP A;  3WTM A;  4NPP A;  3PEO A;  5HEG A;  3C79 A;  2YMD A;  4ILC A;  3UQ7 A;  4F8H A;  3UQ4 A;  5LXB A;  3U8M A;  5KE4 A;  5L4H A;  5SYO A;  3SH1 A;  5AFH A;  3RQU A;  2BG9 C;  2PH9 A;  4QAA A;  4TWD A;  3RQW A;  1OED A;  2LKG A;  4Z91 A;  2XQ8 A;  2XQ3 A;  4IL4 A;  2BYS A;  2UZ6 A;  2BR8 A;  4ZJS A;  4LMJ A;  4ZRU A;  3UU6 A;  2WNC A; 
#chains in the Genus database with same CATH topology
 3B5M A;  2X51 A;  1MNE A;  2OA5 A;  1ZOY A;  2GK9 A;  5LOV E;  3ZJ1 A;  3DTO A;  2VKH A;  4IDZ A;  4G2A A;  3RYF E;  2EHO A;  3UFG A;  5AFN A;  1M62 A;  2MOZ A;  3G06 A;  2EHO C;  3ZJ2 A;  4PNI A;  2VQF T;  3P4W A;  4JI6 T;  4H9O C;  3JAF A;  1UX2 A;  4D01 A;  4QH1 A;  1NAF A;  1OED C;  5H6R B;  4X5T A;  3MZK B;  2WDQ A;  5EK4 A;  3SWH A;  4LF6 T;  2WZY A;  3FBZ A;  2LJL A;  3IHR A;  3UT5 E;  5L3C B;  2N1G A;  2JIW A;  3WIP A;  4X64 T;  4MLK A;  4ERR A;  4X65 T;  4LF5 T;  1UUR A;  2LLY A;  2XQ9 A;  4AXP A;  4UM3 A;  5AQM B;  3IEE A;  3ZLI A;  4DV3 T;  3L8R A;  4I43 B;  3M3Z B;  3CKD A;  2E2A A;  2XPK A;  2Y7Y A;  3PUG A;  4DMV A;  3PEO A;  2NP9 A;  4F8H A;  2CBJ A;  3VRB A;  2PFV A;  3AA1 B;  1IJ5 A;  4KI0 F;  4HWH A;  2XQ3 A;  5LA6 E;  3ZMT B;  3UU6 A;  1J1J A;  3F57 A;  3ZMS B;  4CI1 B;  4EIW A;  4IHJ E;  4X1Y E;  4DV7 T;  2MYS A;  5AQG B;  2ZJU A;  2YN6 A;  3LSV A;  5LG4 A;  3U78 A;  4HFB A;  4BA9 A;  4BQT A;  4BAY B;  3N9M A;  4UIG A;  5FNV E;  1FJG T;  1T98 A;  1G73 A;  3C50 A;  4O2A E;  5LGU B;  4JLE A;  4UXN B;  3PJA J;  4NUU A;  3WTI A;  3NRX A;  3RKO A;  2LSI A;  4HN9 A;  2V6Y B;  2C9T A;  2XSB A;  1T8B A;  4UM3 P;  5AFJ A;  1WYC A;  1L0V A;  3ZDG A;  3SQ6 A;  2WP9 A;  5CJ5 A;  1KNR A;  5J2U E;  3UTK A;  1LVF A;  3HKC E;  3D0T A;  3AEC A;  5KMG P;  2WU5 A;  3AAE B;  3PUS A;  3PJA A;  1CHU A;  1HG2 A;  3ZYK A;  4DV0 T;  4M1P A;  2ACX A;  5LYJ E;  3ZEF B;  2YKS A;  4YSZ A;  2PGZ A;  3FB2 A;  2IHR 1;  3ZST A;  3N9N A;  4LML A;  2ZM2 A;  5KDM C;  3LG7 A;  4KUM B;  3PUZ F;  4J2C A;  2LHN A;  3AE3 A;  3C79 A;  2Y6X A;  2D2S A;  3OVU A;  5L4H A;  3PUQ A;  4GK0 E;  5ADX L;  4P09 A;  4Z91 A;  2LSG A;  1AJ3 A;  3J9X 1;  4I0U A;  4V1A v;  4ZRU A;  3VRA A;  3KDS E;  2B76 A;  2WMN A;  3AB3 B;  3CQG B;  4DV1 T;  4WNK A;  1ZHC A;  4IDP A;  5CA1 E;  2VL8 A;  1WFD A;  3V5U A;  5J2T E;  5L2L A;  1O3X A;  4JV5 T;  3P4Q A;  3V5S A;  2UXN B;  2W2U A;  5LB7 B;  4YSY A;  2MPK A;  5LG3 A;  4ILA A;  2JQK A;  3PUX F;  2XNT A;  5ABF B;  3KV4 A;  3RF1 A;  1N34 T;  2JQQ A;  1D0Z A;  4YXD A;  1HNZ T;  4DR4 T;  1YD8 G;  2BBJ A;  4ZI3 D;  1LVK A;  4CXX A;  3S4U A;  2CHO A;  2XZ5 A;  2IML A;  2WS3 A;  4IE5 A;  4ANJ A;  2W66 A;  4YLH A;  2DHR A;  2LRK A;  4CI2 B;  2XUE A;  4UV9 B;  3AA6 B;  5DJQ C;  2W8F A;  3KBU A;  4CQI A;  2KWH A;  4DBM A;  3FZH B;  3HKE E;  4TWF A;  4YJ2 E;  3NWI A;  3CWZ B;  4TX5 A;  2CA5 A;  1BR1 A;  5LHG B;  3ZCI A;  3L3P A;  4OX9 T;  2XAF B;  2XAQ B;  1CUN A;  4H9N C;  5HWY A;  3NZQ A;  1IZN B;  2XJ7 A;  4ILC A;  4QHO A;  5LBM A;  1XZY A;  4H9Q C;  3T1H T;  2EHO B;  3I0Q A;  3ZKR A;  2M67 A;  3RYI E;  2HHH T;  4AI6 A;  4JEU B;  2XAJ B;  3AA0 B;  5AFU L;  3O9X A;  3SIO A;  1J5W A;  3CX8 B;  3SS1 A;  5L4E A;  4LF7 T;  5M4Y A;  2BS3 A;  1XMQ T;  5E0O A;  5CFB A;  1S35 A;  1NEK A;  3WTL A;  4X1K E;  2V6Y A;  4YJ3 E;  3ETV A;  5LJN A;  2I6H A;  3TLT A;  2K24 A;  4MAL A;  1T7S A;  4HWI B;  5HXR A;  4HKA A;  4CN1 A;  4BJN A;  2M6B A;  4PK4 A;  2XQ7 A;  5EK2 A;  3RRW A;  5L3D B;  3LBX A;  1US7 B;  5HYA A;  5BRX A;  1FEW A;  2RPA A;  4NXN T;  3O1I A;  3RHW A;  3H3A A;  1V9D A;  4DBQ A;  4H63 H;  4HFV A;  4HTE A;  1MIV A;  3AVS A;  3K3O A;  2K5B B;  4H9R C;  3AEE A;  4AKH A;  4MFR A;  2BS4 A;  3FZL B;  3UQ7 A;  3ZMV B;  5LXB A;  5JH7 E;  2V7J A;  4OFZ A;  5AQH B;  3QNU A;  4ADZ A;  4YTP A;  3PV0 F;  4DV4 T;  2OLT A;  2V26 A;  3AED A;  2CXD A;  2DWG A;  5LCY A;  2YOE A;  4DBR A;  4IST A;  3Q5D A;  3CX6 B;  4L0R A;  1KF6 A;  2G0U A;  3L39 A;  4ZK4 A;  3AE9 A;  2SPC A;  3ZC1 A;  3N2K E;  2DL1 A;  4TN7 B;  2W0G A;  2Y57 A;  4P0B A;  3JCF A;  1BR0 A;  2XNU A;  2H88 A;  5J5G A;  2CPT A;  3O4X E;  4JI8 T;  1M7K A;  1NWM X;  2X0H A;  4ZI3 C;  1E2A A;  3FZM B;  5ABF A;  5JRC B;  1U5P A;  5JR9 A;  4ILB A;  3K1S A;  2PG8 A;  5JDQ A;  4U72 A;  5ABE A;  1UGO A;  2BKO A;  4ISS A;  3PUR A;  4YSX A;  2BR7 A;  4IE4 A;  4PAG A;  2XZ6 A;  5J0Z A;  4QH4 A;  2J4G A;  2YDR A;  4ZZC A;  5EK3 A;  2D0T A;  5J1G A;  2V7K A;  2KND A;  3R6N A;  4ASK A;  3LBX B;  3OPC A;  1X79 A;  3P4S A;  1FMW A;  4U7Y A;  3HI2 A;  4YTN A;  3C4W A;  5FVK A;  3RIU A;  4XZC A;  2BG9 C;  5FL1 A;  5AQL B;  1I94 T;  1HNW T;  4QAA A;  3RQW A;  3PU8 A;  2XQ8 A;  2BZB A;  3UU5 A;  3ANW B;  3KV9 A;  4IDQ A;  4DV6 T;  1UCU A;  4YTM A;  4QXH B;  2W67 A;  3UUB A;  2HPL A;  4AQF A;  4ALX A;  1OWA A;  2CWY A;  2V1D B;  3UU4 A;  4O4H E;  5HWX A;  3U8J A;  4PIR A;  4UXU A;  5EZY E;  4WYV A;  2NTY A;  2YDQ A;  2IAK A;  4KHZ F;  3RH3 A;  3WAJ A;  3CK6 A;  3EDU A;  5AQR B;  1HTJ F;  2H3R A;  4PK6 A;  4TV9 E;  5FXZ A;  2BYP A;  2D0U A;  2XQ4 A;  4GK5 E;  4DMW A;  1IBL T;  3GWH A;  3HA4 A;  3IF8 B;  5FXW A;  3U8N A;  5JDM A;  2BG9 B;  4O4I E;  2YIN A;  5JDG A;  3WTJ A;  1NEN A;  4LFB T;  3PU3 A;  3HKB E;  3W15 B;  2D5U A;  2VB6 A;  2LSJ A;  4OHF A;  3ZMU B;  1HFA A;  4OK0 A;  1VCS A;  2A2F X;  4WV9 A;  3N2O A;  2DLR A;  2YU2 A;  2FBW A;  1E1H B;  3NZP A;  4LF4 T;  4GKK T;  2Y8D A;  4GKJ T;  5JQG E;  5BMV E;  1ZKE A;  4JI2 T;  2CCQ A;  2JJ9 A;  2XHE B;  2FJD A;  3A7M A;  3A5X A;  2JMH A;  4UM3 S;  2VAS A;  1MMA A;  2WU2 A;  3NBX X;  4AFT A;  3QB5 K;  3AE2 A;  2BYR A;  5TVC A;  3R84 B;  2Q9Q B;  4Q25 A;  3O1J A;  1T72 A;  2VKJ A;  3PUA A;  2E8I A;  5ABG A;  3ZC0 A;  3ABV A;  3UU8 A;  3PMZ A;  4G63 A;  2X0Y A;  4EZ1 A;  4IRE A;  3I1A A;  2LHR A;  4UF0 A;  3FZF B;  2CEA A;  3LJC A;  2IUB A;  4I50 E;  1XDO A;  4CN6 A;  2RP4 A;  2HH7 A;  2NOX A;  5FYM A;  4DID B;  2YDS A;  4ZOL E;  3ZN1 B;  4L5G A;  2MBG A;  5AFK A;  3B57 A;  1YKE B;  1X9B A;  4DR7 T;  4KMC A;  2OV9 A;  3C4Z A;  4GIW A;  4LMK A;  2X9W A;  2WNL A;  4ZI2 C;  3F31 A;  5JDL A;  2QC1 B;  3ZN0 B;  3WTM A;  5HEG A;  3AE1 A;  3NKZ A;  1UUS A;  2CE7 A;  3P8C D;  4WZX A;  2ES0 A;  3L09 A;  1MIW A;  1QUU A;  5AQI B;  3IGQ A;  3MA9 A;  3HR0 A;  2WB5 A;  1WR6 A;  5J5F A;  2I0M A;  2LM2 A;  2ZM6 T;  2Y56 A;  2LOP A;  2WM9 A;  3TLV A;  2XM2 A;  5AFM B;  5HEO A;  3N9L A;  2V7M A;  4U2Y A;  3RKG A;  2JRK A;  5BR8 T;  5JDN A;  3RIU C;  2KWI B;  4QKN A;  1HF8 A;  3BQK A;  1IBM T;  4X20 E;  1KNP A;  4CXY A;  2C5I T;  2C5K T;  5FY7 A;  3CQX C;  4N78 D;  4PJM A;  3N2G E;  2CRB A;  3AAI A;  3KV5 A;  2W00 A;  4UEM A;  5AFL A;  3CVR A;  5CO5 A;  4QAC A;  1VOM A;  1IBK T;  2XNV A;  5LGT B;  3O1H A;  2XYT A;  2X9H A;  4UM1 A;  4DV5 T;  4QXB B;  1HNX T;  2WN9 A;  4C91 A;  3LFM A;  4JI4 T;  4L9I A;  2C5J A;  3TLU A;  2UXB T;  3P7I A;  2X68 A;  4EV6 A;  3QC9 A;  1Z0P A;  3WI3 A;  3AEB A;  2X0L B;  3ZT7 A;  2XQY A;  4DR2 T;  3VKG A;  2IIU A;  2HN2 A;  4EYU A;  2QYW A;  1KEY A;  4EAH A;  3VU7 H;  4JI0 T;  3T8O A;  2LKG A;  5A1L A;  1LKX A;  4LMJ A;  4U33 A;  3PE0 A;  2WNC A;  3AXJ A;  4ZJT A;  2CM0 A;  2ZLY A;  5BP0 A;  2K3W A;  1E7P A;  4IDO A;  3MK7 C;  4ZI7 E;  4GYS A;  2IW5 B;  3KBT A;  3OJA A;  3H37 A;  2ACZ A;  3EAM A;  4P0A A;  5KX5 E;  2Q9Q A;  3AE7 A;  4IT4 A;  4QX8 B;  3ZDH A;  4DUZ T;  3WTO A;  3T4M A;  4KX6 A;  4EYY R;  2C0S A;  2LEH A;  1H7C A;  3JAE A;  4FJO A;  1YXR A;  2WWV A;  1WYB A;  3KVB A;  1LRZ A;  1R8I A;  2VK9 A;  2X67 A;  4HFH A;  3KVA A;  4ZK1 A;  1YQ4 A;  3QOF A;  4QAB A;  2JQH A;  2W8G A;  5JDH A;  2UXC T;  3TLW A;  1KK7 A;  3AE8 A;  2E9X A;  3VR8 A;  4B3S T;  4UVB B;  1UX5 A;  4HWC A;  4UV8 B;  1J5E T;  3AXJ B;  2KXP B;  2VL0 A;  2LSK A;  5AQK B;  4B3M T;  2VUR A;  4HEA A;  5LHI B;  5FXV A;  1GQE A;  2VVS A;  5KE4 A;  5AFH A;  3RQU A;  2N9D A;  1OED A;  5C8Y E;  1W9R A;  4ZJS A;  3GA8 A;  1I6Z A;  3KV6 A;  1KNZ A;  1W0A A;  5IUX A;  2BS2 A;  3RPU A;  3SQ9 A;  4IL9 A;  2E5L T;  2X00 A;  2V7I A;  3QK6 A;  4ZHQ E;  2XQ5 A;  5AQV B;  5LGN B;  4ZI2 D;  4HE8 A;  2UUC T;  5BW2 A;  2WCA A;  2LSY A;  2JPF A;  2XYS A;  1MIY A;  2CLY C;  3AE5 A;  3WTN A;  3OBV E;  5IWA T;  3RC8 A;  4CN4 A;  2AE9 A;  4IE0 A;  2LOS A;  5JVD E;  2XAG B;  1HS7 A;  2Q9Q C;  4B3R T;  2IC9 A;  2L3L A;  5FY0 A;  4EOZ B;  3RC3 A;  1W09 A;  4NXM T;  4CZZ B;  5DQV A;  4X66 T;  4GOU A;  3I9Y A;  3ONL C;  3NVO A;  2CMR A;  3F2E A;  4UY2 A;  2KMF A;  5H6Q B;  1BR2 A;  1HX1 B;  2NW9 A;  4AQG A;  3UQ4 A;  1D1B A;  4ZXL A;  3ETU A;  5AQQ B;  5LMN T;  4KHP T;  4MHC A;  2FJB A;  4IL4 A;  3JC6 D;  2HPJ A;  2VKO A;  1JNR A;  3IA3 A;  2XSA A;  3N9O A;  2Z6E A;  4AKR B;  5CB4 E;  1D1C A;  2WSS V;  4ZS3 A;  3C64 A;  5CA0 E;  1N32 T;  3B13 A;  5LMU T;  1XNR T;  4HWF A;  1XMO T;  3N5L A;  3OTO T;  5HXC A;  4X1I E;  1UV6 A;  1SE7 A;  3BQI A;  4U74 A;  4ZZB A;  2VWA A;  4A97 A;  4AFH A;  3RIA A;  2WNJ A;  2LRL A;  4CI3 B;  4UVA B;  3GMI A;  2UUA T;  4UF0 B;  4AQY T;  1XNQ T;  4H9P C;  3Q5E A;  1JNZ A;  2MAW A;  5HAX A;  4AKG A;  2XAH B;  2Y48 B;  2BG9 E;  2V8S V;  1MMG A;  4DO0 A;  2V5C A;  2YEV C;  3DP7 A;  2UU9 T;  4JYA T;  3C4X A;  3VHL A;  4TNV A;  2NWB A;  4YT0 A;  4WBN E;  4A98 A;  2LKH A;  5F3J A;  5DQW A;  2RA1 A;  4DVD A;  4Z8X A;  2NTX A;  4WW0 A;  2W4X A;  2QGS A;  2WZH A;  4TUY E;  4ZS2 A;  2A9U A;  4KP3 C;  3WTK A;  2KSR A;  4TV8 E;  3UUM A;  4EB6 E;  4QH5 A;  1WLX A;  4DR3 T;  2J1D G;  4XBF B;  3U8M A;  3EAB A;  1UX4 A;  4FI5 A;  3SH1 A;  2KLQ A;  5ABH A;  4DV2 T;  3E22 E;  3ONJ A;  4ILU A;  3FHN A;  2FJA A;  2BR8 A;  2Q9Q D;  2KZ7 B;  5AQT B;  2K48 A;  2WZI A;  1MND A;  2BVM A;  3U8L A;  4DR6 T;  2UUB T;  2CWO A;  5AQO B;  1IJ6 A;  5L3B B;  2X66 A;  3PUV F;  3HL6 A;  4QXC B;  5AQS B;  5JTG A;  1WCR A;  3I0O A;  2X00 D;  1B7T A;  2XQA A;  2CBI A;  3CX7 B;  1YQ3 A;  5HXS A;  1EZ3 A;  4HFI A;  1XWM A;  4JUY A;  4ZR6 A;  5C3J A;  3ZSS A;  4EEB A;  2H89 A;  2QA7 A;  2XM1 A;  3ZT5 A;  5LJM A;  2IDO B;  2BVL A;  5LXT E;  5KXJ A;  2MTQ A;  4A56 A;  2Y54 A;  4LF8 T;  3RYC E;  3JAD A;  2XTL A;  4OYJ A;  3CPZ A;  4NZB A;  3ANW A;  4U3C A;  1WR0 A;  4NUV A;  4F6R C;  2JQ9 A;  5L47 A;  4NIQ A;  3TLS A;  2KT9 A;  1OED B;  3A8Y C;  3K3Q C;  2L8K A;  4EZ4 A;  2LT3 A;  2HN1 A;  3RYH E;  4FRR A;  1MMD A;  5J5H A;  4KBM B;  4NPP A;  3P4P A;  5LBQ B;  4JEH B;  1D0X A;  4PJN A;  4U2Z A;  3CML A;  5FVL A;  5FL0 A;  3EVY A;  3IBP A;  2W63 A;  2LM9 A;  4I4T E;  4O4J E;  3SFD A;  3TKL B;  3NRY A;  5HCM A;  5F8P A;  4EGW A;  4PFP A;  2E9X B;  2ZM8 A;  3SOL A;  4X62 T;  1HG5 A;  5AQJ B;  2WDR A;  3Q9D A;  1VRB A;  2W62 A;  4XAX B;  5JRC A;  4K0U A;  2EHO D;  3K3N A;  1HX8 A;  2DCF A;  3AA7 B;  2M6I A;  3RIF A;  2WAU A;  3AE4 A;  4XK9 A;  3AEG A;  3ZYL A;  1QLB A;  4DUY T;  3X1D A;  3MKD A;  5IYZ E;  4HGA A;  3RLF F;  3P4R A;  4PJJ A;  5LP6 E;  5AIN A;  3OYZ A;  4IGU A;  3ZCJ A;  3EHZ A;  5HXH A;  4CXW A;  2J47 A;  2DNX A;  4XHE A;  2BYQ A;  4UEL A;  3PUY F;  2V7L A;  3K8P C;  2XQ6 A;  4ZEY A;  2V5D A;  5L3G B;  2ODU A;  2V6X A;  3N9P A;  3C98 B;  2P9B A;  3GN5 B;  3E0Z A;  2QVA A;  1OED E;  2E5V A;  3CQC B;  2A3D A;  2YK0 A;  1W0B A;  2CHN A;  5HEJ A;  2ZJV A;  4UVC B;  3PDY A;  4HFE A;  4OYK A;  4HQP A;  4EXT A;  2F4V T;  4LF9 T;  3AVR A;  4LFA T;  2PH9 A;  2WWU A;  3N9Q A;  4U31 A;  2BKP A;  2XAS B;  2WBL A;  2B1E A;  1SUM B;  2NW7 A;  4H9S E;  4PJL A;  4E7S A;  1MMN A;  2YU1 A;  5FMN A;  3Q5X A;  3UUN A;  4B3T T;  4IE6 A;  3VKH A;  2H7O A;  1VCT A;  2PJQ A;  5FKY A;  2YME A;  3C51 A;  4JI5 T;  1I9B A;  4JBW F;  4DND A;  1XDP A;  3HKD E;  5CGM A;  3P50 A;  1IAP A;  5LNK A;  2R6G F;  4BFQ A;  2CLY B;  4H63 V;  2E9X C;  4AQF C;  4PW8 A;  4Z90 A;  4YHJ A;  5FXX A;  2Y58 A;  2J62 A;  3MJX A;  3PTR B;  2AXD S;  4WBO A;  1QSD A;  3KIN B;  1ZP0 A;  4MBQ A;  5HEU A;  3UUX B;  4TZ4 C;  2BG9 A;  3WTH A;  4YY3 T;  4HWD A;  4COF A;  3U3I A;  2I59 A;  3UFE A;  3LK3 B;  2PBI A;  4YHH T;  4O4L E;  5JR9 B;  3RI5 A;  3MXZ A;  2WQY A;  3UUL A;  2PTF A;  1SA0 E;  4QX7 B;  3E08 A;  2X9X A;  2DWK A;  1Z8U A;  4I55 E;  3ONX A;  1ZV4 X;  4TWD A;  2FUP A;  4AKL A;  1HCI A;  3BK9 A;  3GN5 A;  4EZH A;  5AQN B;  2K9A A;  2VKD A;  2H7V C;  5L3F B;  3GUA A;  4AKI A;  4PK5 A;  1UK5 A;  5KZU A;  1ZEE A;  2ZM0 A;  1KFY A;  4E7Z A;  3QB5 A;  4IDN A;  5HXE A;  1S94 A;  1UW6 A;  2CXF A;  2DI4 A;  3EDV A;  4JI7 T;  2VQE T;  1DU2 A;  4A5X A;  3U8K A;  2A72 A;  4QWN B;  3WAK A;  2E9X D;  4O8S A;  3RX6 A;  5J5I A;  3ZPO A;  5AQF B;  3OKQ A;  1FIO A;  5GON E;  1BR4 A;  2KIN B;  1Y01 A;  5FJV A;  5IHY A;  3FXD B;  3EI0 A;  5JR9 C;  3OYX A;  1SHZ C;  2VVN A;  3FXE B;  5LHH B;  1OXZ A;  3ZT6 A;  5HCJ A;  2CXL A;  5L3E B;  4C90 A;  1G8X A;  1FMV A;  4IE7 A;  1WRD A;  2L9Q A;  2BYN A;  3T1Y T;  3DJB A;  4GYR A;  5C2T A;  3Q2M A;  2BBH A;  3Q5W A;  4LFC T;  4O2B E;  2UXD T;  3EUH A;  4B5D A;  3ZYM A;  4IIJ E;  2D9D A;  1YW0 A;  1YKH B;  2FJE A;  4K0K T;  3AAA B;  2W61 A;  3PUW F;  4DR1 T;  4BJM A;  2NR4 A;  2UXX B;  3VR9 A;  4JI3 T;  2BYS A;  4U7I A;  3QUJ A;  3M65 A;  2LE8 A;  4UR9 A;  3I9W A;  4AIU A;  5JDF A;  1Y64 B;  2N2N A;  3BQL A;  5TAO A;  2BKN A;  1D1A A;  3AEA A;  5JME A;  3FBL A;  3AEF A;  3CIR A;  5DAB A;  2X9Y A;  3LDQ B;  3MAC A;  2IC6 A;  4TWH A;  3J7Y q;  3RGL A;  5FP3 A;  4AIS A;  5AQU B;  3UU3 A;  2WY2 A;  3LK2 B;  3FZK B;  3H3M A;  3JC6 C;  3AE6 A;  4TNW A;  5FY1 A;  4HFC A;  4YFS A;  3C84 A;  3LK4 2;  5AQP B;  4JI1 T;  1N33 T;  2ZMA A;  2NW8 A;  4HFD A;  4PFO A;  4AFG A;  1N36 T;  5F5W A;  5ETW A;  1U4Q A;  4EED A;  3RRC A;  5JRE A;  5HEH A;  3ZMZ B;  2QRX A;  3ESL A;  3SRZ A;  4DR5 T;  2BJ0 A;  4P1N A;  1D0Y A;  5AFM A;  4B6X A;  2XZE A;  2YMD A;  3SFE A;  2JMK A;  5SYO A;  2WMO A;  1HR0 T;  3KFW X;  2WDV A;  2ODV A;  2UZ6 A;  2BDE A;  2XY8 B; 
#chains in the Genus database with same CATH homology
 4UM3 S;  3ZKR A;  3IGQ A;  4ZJT A;  3GUA A;  3UU5 A;  5IUX A;  5BP0 A;  3U8L A;  5HCM A;  3SQ9 A;  4IL9 A;  4AFT A;  5J5F A;  5KZU A;  2BYR A;  3UUB A;  2YOE A;  5TVC A;  2X00 A;  2LM2 A;  3EAM A;  4ALX A;  3SIO A;  5AFN A;  2Y56 A;  5L4E A;  3UU4 A;  2ZJU A;  3U8J A;  1UW6 A;  2YN6 A;  4PIR A;  3LSV A;  3ZDH A;  3TLV A;  4UXU A;  5JME A;  4HFB A;  5CFB A;  3WTO A;  4BQT A;  2XQ5 A;  2YME A;  2X00 D;  4ZK4 A;  3T4M A;  3RIF A;  3UU8 A;  2M6I A;  2XQA A;  3P4W A;  3PMZ A;  1I9B A;  3JAF A;  1UX2 A;  4EZ1 A;  5LG3 A;  3WTL A;  4ILA A;  4D01 A;  1UV6 A;  3U8K A;  4XK9 A;  5HEO A;  5AFM B;  5BW2 A;  4IRE A;  2XNT A;  2Y57 A;  4TWH A;  3P50 A;  3JAE A;  2XNU A;  4QH1 A;  2XYS A;  4HFI A;  5J5G A;  4ZZB A;  1OED C;  3TLT A;  4A97 A;  4BFQ A;  4ZR6 A;  3WTN A;  4X5T A;  4AFH A;  5J5I A;  3RIA A;  2BYP A;  4HFH A;  3UU3 A;  2WNJ A;  5FJV A;  2XQ4 A;  4Z90 A;  3EI0 A;  2WZY A;  4ZK1 A;  3WTI A;  2M6B A;  2Y58 A;  2XZ5 A;  4QAB A;  5AIN A;  2C9T A;  2XQ7 A;  2W8G A;  2MAW A;  4TNW A;  4ILB A;  4HFC A;  3C84 A;  3WIP A;  3TLW A;  3EHZ A;  3U8N A;  4UM3 P;  5AFJ A;  2BG9 B;  2BG9 E;  5HCJ A;  3ZDG A;  2W8F A;  5AFL A;  3SQ6 A;  4XHE A;  2BYQ A;  5HEU A;  5CO5 A;  3WTJ A;  2Y54 A;  4HFD A;  4DBM A;  5BRX A;  4QAC A;  3JAD A;  2BG9 A;  2BR7 A;  4NZB A;  4TNV A;  4TWF A;  2XNV A;  2XQ6 A;  4AFG A;  4A98 A;  2LLY A;  2XQ9 A;  2BYN A;  2XZ6 A;  3WTH A;  2LKH A;  4COF A;  5J0Z A;  2XYT A;  3RHW A;  5AFK A;  4UM3 A;  4UM1 A;  4QH4 A;  2WN9 A;  2VL0 A;  5L47 A;  3TLS A;  4ZZC A;  1OED B;  3TLU A;  2PGZ A;  1OED E;  2YKS A;  4WV9 A;  5HEH A;  4B5D A;  3WTK A;  4LMK A;  4LML A;  2KSR A;  5HEJ A;  2WNL A;  2Y7Y A;  2ZJV A;  4FRR A;  4UY2 A;  2BJ0 A;  2QC1 B;  5J5H A;  3RI5 A;  5AFM A;  4HFE A;  4QH5 A;  4HQP A;  3WTM A;  4NPP A;  3PEO A;  5HEG A;  3C79 A;  2YMD A;  4ILC A;  3UQ7 A;  4F8H A;  3UQ4 A;  5LXB A;  3U8M A;  5KE4 A;  5L4H A;  5SYO A;  3SH1 A;  5AFH A;  3RQU A;  2BG9 C;  2PH9 A;  4QAA A;  4TWD A;  3RQW A;  1OED A;  2LKG A;  4Z91 A;  2XQ8 A;  2XQ3 A;  4IL4 A;  2BYS A;  2UZ6 A;  2BR8 A;  4ZJS A;  4LMJ A;  4ZRU A;  3UU6 A;  2WNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...