4ILBA

The pentameric ligand-gated ion channel glic a237f in complex with rubidium
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 95
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4ilbA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4ilbA01
2ZJVA 2XYSA 3P4WA 5KZUA 2YMEA 3JAEA 2BYNA 4HFHA 4D01A 4PIRA 4QABA 4QH1A 4UM1A 1OEDC 4IL4A 4ZZCA 3PEOA 4ZZBA 2YKSA 2PGZA 3SH1A 5AFKA 4NPPA 2XQ5A 2YMDA 2XQAA 4ALXA 3WTLA 4UY2A 4QH5A 5BW2A 2YN6A 5TVCA 3WTOA 2XYTA 5AFJA 5KE4A 4ZK1A 2YOEA 4ILAA 4X5TA 1UW6A 2Y56A 4BFQA 4XK9A 3TLWA 5HEGA 3SIOA 3T4MA 3WTKA 3WIPA 4ZJTA 4IREA 2ZJUA 4IL9A 4ZRUA 1UV6A 4Z91A 4QAAA 5FJVA 4LMJA 5L47A 3UU3A 1UX2A 3ZKRA 1OEDE 2XQ6A 2VL0A 2BYRA 2KSRA 3P50A 3UU8A 5LG3A 2WNLA 4UXUA 3C79A 4HFIA 4LMLA 4COFA 3C84A 3UU5A 5BP0A 1I9BA 2XQ8A 2LKGA 2X00D 2WZYA 2WNJA 3EHZA 3RIAA 4ZJSA 2XNTA 5J0ZA 4FRRA 3TLSA 5BRXA 2W8FA 5HEUA 4F8HA 4BQTA 3RHWA 2BG9B 2XZ6A 5AFMA 4HFCA 4HQPA 5HCJA 2WNCA 2Y58A 2LKHA 2Y57A 5AFMB 1OEDB 2LLYA 5L4HA 3UQ4A 2BJ0A 4A98A 4NZBA 3JADA 3RQWA 4EZ1A 4ILBA 4TWHA 3ZDHA 2Y7YA 4AFHA 3UQ7A 4Z90A 2BYQA 4AFGA 5AFNA 2C9TA 2XQ7A 5J5HA 3WTJA 4UM3S 2XQ4A 2BR7A 4LMKA 3RQUA 4TWDA 2M6IA 4TNVA 2BYPA 3ZDGA 2XNUA 2BG9E 3UU6A 2BYSA 2PH9A 5SYOA 4B5DA 5L4EA 4TNWA 2XQ3A 4ILCA 4AFTA 5HEOA 2XNVA 2UZ6A 2BG9A 2M6BA 4A97A 3RI5A 4ZR6A 2MAWA 5CO5A 4ZK4A 3JAFA 2XZ5A 2BG9C 3RIFA 1OEDA 3IGQA 3UU4A 3WTMA 5J5GA 3WTNA 5J5IA 3U8MA 4HFDA 2W8GA 4QACA 5AFHA 5AFLA 2QC1B 2BR8A 3EI0A 4HFBA 2LM2A 2XQ9A 3TLTA 5JMEA 5LXBA 5HCMA 3WTIA 5J5FA 3U8NA 3EAMA 4UM3A 3WTHA 2Y54A 5IUXA 4QH4A 3SQ6A 5CFBA 5HEJA 5AINA 4HFEA 5HEHA 4UM3P 2X00A 3GUAA 4WV9A 3UUBA 3PMZA 3SQ9A 3U8JA 3TLVA 4DBMA 4XHEA 2WN9A 3U8LA 3TLUA 3U8KA 4TWFA 3LSVA
chains in the Genus database with same CATH superfamily
1XNRT 3NWIA 3CK6A 1MMGA 4QX7B 1NENA 5JDFA 3PUGA 3SH1A 2XY8B 3FHNA 3ZMUB 4H9QC 2YOEA 2YU1A 3SOLA 3AAAB 2IMLA 2UXNB 1ZKEA 4ZHQE 5FY0A 2XM1A 4DV2T 5ADXL 3PUYF 5JVDE 4LMLA 3OYZA 1OWAA 4ILUA 3UU5A 3OKQA 1YKEB 3HR0A 3O1JA 3ONXA 3VR9A 3LBXB 3N9NA 4CN4A 2BDEA 2BS3A 2Y6XA 4L5GA 2K5BB 3PJAA 4PJMA 3RQWA 2CCQA 2C5KT 3SFDA 4UXNB 3Q5WA 3RKOA 3KFWX 3ETVA 3ZDGA 4X62T 4MBQA 4TNWA 2XQ3A 4IDQA 3ZCIA 2BG9A 4YTMA 2PG8A 3BK9A 1UURA 2C5JA 5HXRA 1GQEA 4KHZF 3PDYA 1Y01A 1T7SA 2A2FX 5LJMA 1XNQT 3HL6A 3FXDB 1WR0A 2ACZA 4TZ4C 4IDZA 4DUZT 2QYWA 2WZIA 4DR6T 3RYCE 4I0UA 3AE7A 2FJEA 2D2SA 3U8LA 2KWIB 5J2UE 5BR8T 5LB7B 4U2ZA 4IL4A 2FJAA 4UY2A 2WM9A 4ZI7E 4H9OC 3PUZF 4JLEA 2VQET 3ZMSB 4IL9A 4K0KT 4Z91A 5HXCA 4LMJA 1HR0T 1OEDE 2KSRA 5M4YA 3ZT7A 2V7LA 5AQSB 5BP0A 4AQYT 3AE6A 2JIWA 2IW5B 2JMHA 3EHZA 3N2GE 4B3TT 5IWAT 4ZS2A 2XNTA 5JDLA 2L9QA 4ERRA 2W8FA 1IZNB 5FNVE 3HI2A 4HQPA 5CA1E 4DV4T 2K3WA 3RIUA 4ANJA 2PBIA 3KV9A 2DNXA 3ABVA 4DV7T 2CM0A 4LMKA 4TV8E 2BYPA 2WDRA 3E22E 2K48A 2PH9A 5FXVA 4C90A 3KV6A 3K3QC 2FBWA 1JNZA 1J5WA 3F2EA 3JAFA 5LMUT 2YEVC 3AEDA 2KWHA 2NTXA 2M67A 5LXBA 3U8NA 2IDOB 3Q9DA 4DNDA 5AQHB 2UUBT 4ZI3D 4KP3C 2C5IT 3NRYA 3VKGA 2BBJA 2V5DA 3K8PC 3EUHA 2YDRA 2D0TA 1E7PA 3ANWB 2CBIA 1HF8A 4YTNA 3AA6B 2YMDA 3N2KE 5HYAA 1BR1A 3RX6A 3JCFA 2Y48B 2MTQA 3ZSSA 3EABA 5KMGP 4HN9A 4ZOLE 5F8PA 2PTFA 5FY7A 3UU3A 3H37A 2VL0A 4PJJA 2ES0A 4DV5T 2NTYA 1X9BA 2IUBA 3W15B 4H9PC 2V7IA 4JUYA 4H63H 3VR8A 3AAIA 1MIVA 2WNCA 2MYSA 4OK0A 4LF9T 4PFOA 2Y7YA 2XUEA 4GK0E 2BYQA 2ZM6T 3UFGA 1G73A 2XNVA 4HWCA 4LF5T 4U7IA 3IGQA 1WRDA 5AFHA 5HWXA 1MMAA 3RIUC 4HFBA 5LA6E 5J5FA 2IC6A 3FZMB 4DBQA 3DTOA 4HFEA 5HEHA 3L3PA 5LGNB 1VRBA 1CHUA 4AXPA 5IYZE 4GKKT 3PUQA 4QH1A 4UM1A 5JDGA 4F6RC 2YKSA 3K3OA 3PUXF 1I94T 2YN6A 5TVCA 3WTOA 2XYTA 4A5XA 2E5VA 2VK9A 3A7MA 3MZKB 5AQUB 5EK2A 2BKOA 3ZC1A 3SS1A 2WNLA 2BS4A 3EDVA 4KUMB 5AQPB 2WDQA 4AQFA 3MXZA 4GYSA 1VCTA 5HEUA 4U74A 2BG9B 2MBGA 2VVSA 5CB4E 5HCJA 4FJOA 1YQ3A 4QX8B 4A98A 1B7TA 2WY2A 2X66A 1H7CA 4GKJT 5AFUL 3C4WA 3KV4A 1SA0E 1UK5A 5AQVB 3UU6A 4HWDA 1KNPA 3EDUA 2XHEB 5LG4A 2MAWA 5H6QB 2LOSA 5AFLA 4AI6A 1Z0PA 3HA4A 2CRBA 4WYVA 4UM3A 3UUXB 4X1IE 4XBFB 3U8JA 2X00A 3GN5B 1DU2A 5JR9A 1MIYA 3R84B 3HKCE 1R8IA 2N9DA 2JQQA 4KHPT 2G0UA 2DCFA 2YDQA 2CMRA 5AQQB 2CWOA 3ZT6A 1QUUA 4I55E 2B1EA 5LBMA 4KBMB 2UXDT 2XQ6A 2E5LT 1O3XA 1HX1B 3KV5A 2UXBT 4LFBT 5DABA 4OYJA 2K24A 1UX5A 4ASKA 2WB5A 2XZ6A 3ZMZB 2Y58A 5F5WA 3OTOT 2B76A 3D0TA 3IA3A 1L0VA 4DVDA 3MA9A 2M6IA 1HNWT 5JTGA 2QA7A 3QB5A 4AQFC 2M6BA 4ZR6A 3AA7B 3PUVF 1XWMA 3AE5A 2D0UA 3PV0F 5J5IA 3ZMTB 2ODVA 3C50A 5HAXA 2I0MA 1LRZA 2NW9A 3LK42 3N9LA 5AQLB 4JYAT 2QVAA 2R6GF 4UVCB 2BS2A 3GMIA 2X9XA 3EAMA 4LF4T 2BZBA 1WLXA 3UFEA 4CXXA 2KZ7B 1IAPA 3I1AA 5AQNB 4JI2T 2HPLA 4HKAA 5FXZA 2Q9QA 4NIQA 4ADZA 4YJ3E 2XQ5A 2FJBA 2V5CA 5BW2A 4QH5A 2NR4A 2IHR1 4EGWA 2LOPA 3ETUA 5LCYA 3PUWF 4QAAA 4Z8XA 4NXNT 5ETWA 3KVAA 2GK9A 3PTRB 4LF7T 4UR9A 5JR9C 5C2TA 4HFIA 2K9AA 4BJNA 1FIOA 3RIAA 2A3DA 3AXJA 2OA5A 5BRXA 4JI8T 2ZMAA 3P7IA 2LLYA 4TN7B 4CN6A 2BJ0A 4DR5T 4DBRA 4NZBA 4UV8B 4YSYA 4YHHT 4AQGA 4Q25A 5J5HA 2XQ4A 1SUMB 3K1SA 4YFSA 3NBXX 4AKLA 4B5DA 2EHOA 5BMVE 2NWBA 4IIJE 2RA1A 2HHHT 4ZK4A 4HWFA 1KNZA 2RP4A 1WCRA 4CXYA 2XQ9A 4DMWA 3CIRA 2VWAA 4X1YE 2E9XD 3ESLA 4HFVA 2VB6A 3O4XE 3AEFA 4K0UA 2WN9A 2BG9E 4BFQA 5LXTE 4EZ4A 4HEAA 3UUMA 4UF0A 3RYIE 3RRCA 2BVLA 4EIWA 4B3MT 4YLHA 2L3LA 3T1HT 5L3CB 3BQIA 2Z6EA 4O4JE 1XDPA 3FZFB 3NZPA 2Q9QC 4O4LE 3R6NA 5TAOA 2J1DG 4QWNB 3RH3A 5FL0A 2AE9A 2W2UA 3PUSA 4AKHA 4IE0A 2JQHA 4YTPA 1LVFA 4UELA 4WNKA 4YY3T 2LM9A 3LK2B 2HN1A 2WZHA 3LJCA 1G8XA 1IBKT 5FYMA 4AFGA 3P4PA 2BR7A 5L2LA 5EK4A 3CX7B 5SYOA 4ILCA 4NUVA 5FVLA 3PUAA 3KBUA 2WMOA 4LF6T 1HNZT 1OEDA 3S4UA 3QC9A 5KXJA 3PJAJ 2XQYA 3QB5K 2OLTA 4HE8A 2QC1B 4YXDA 1UUSA 5JRCA 4N78D 5JDQA 5AQGB 4G2AA 3K3NA 3CX8B 4WW0A 4UM3P 3PMZA 1ZHCA 4DV3T 2EHOC 3ZC0A 4H9SE 4CN1A 2YMEA 1QSDA 4ZI2C 3WAJA 4YSZA 4CI1B 5FY1A 4PK6A 2ODUA 4QXHB 2PJQA 4GOUA 4ISTA 5AQOB 1T98A 5LNKA 4ILAA 4PK4A 2NOXA 4IHJE 2J4GA 3N9PA 2L8KA 2V7JA 4IREA 5FKYA 3AEBA 3UULA 5HXEA 3UT5E 2LSKA 3IF8B 1ZV4X 5AQMB 5FL1A 3C79A 3JC6C 1UGOA 2SPCA 4IDPA 2J47A 4QKNA 2CPTA 2E8IA 3RHWA 2CXDA 2WU5A 3I0OA 4DV1T 1Z8UA 5AFMB 3PE0A 1U5PA 2X67A 2LSYA 5FVKA 2N1GA 3MJXA 3JADA 4JI5T 2BBHA 3VHLA 3N2OA 4LFAT 2UUCT 4V1Av 3AEAA 5AQRB 3KBTA 5ABFA 4IE7A 1ZP0A 4O4IE 4AFTA 1J5ET 2Q9QB 3IHRA 2QGSA 3WTNA 1UX4A 2BKNA 4PJLA 5A1LA 3EI0A 2V7KA 2WAUA 3ZYMA 3LDQB 1NAFA 3ZLIA 4IGUA 5EZYE 5AINA 2MPKA 3CQGB 3AE4A 3SQ9A 3L09A 2CEAA 2YDSA 4O2BE 2X0YA 2LEHA 3LSVA 2W66A 3JAEA 2LRLA 2VKHA 4HFHA 2UXCT 4DR1T 1OEDC 4ZZCA 3VU7H 2W0GA 2PGZA 4P0AA 3Q5XA 4YHJA 2CXFA 3RLFF 5LBQB 1UW6A 1BR4A 2CHOA 3AXJB 3NKZA 1ZOYA 3I9WA 4XZCA 1UV6A 3I9YA 4U3CA 3EVYA 3QOFA 4PAGA 1FJGT 5LP6E 3P50A 2V7MA 1I9BA 2XQ8A 4GYRA 3LBXA 4FRRA 3ZSTA 1MNDA 4QXBB 4JI0T 3P4SA 1WYBA 2DWKA 2C0SA 2XASB 3ZT5A 2V1DB 4QXCB 4Z90A 1N33T 4JBWF 2XQ7A 4WZXA 2LSIA 3F31A 2IIUA 4I50E 4MALA 4M1PA 4I43B 3VRBA 4IE6A 4L0RA 4OYKA 3UU4A 1WR6A 3QK6A 4HFDA 2W8GA 3T8OA 4ZXLA 4JI7T 4UF0B 2BR8A 4FI5A 3ZN1B 4EV6A 4NUUA 3PURA 3E0ZA 4TX5A 5CFBA 5HEJA 2UXXB 2X0HA 3N9QA 4BJMA 4EXTA 3UUBA 3GUAA 2ZJVA 2DLRA 2CLYC 5KZUA 5IHYA 2LT3A 1HTJF 3PEOA 2JJ9A 4PW8A 4NPPA 4U72A 2XQAA 1U4QA 2V8SV 2W61A 3PU3A 1M62A 3AB3B 2V6XA 4DR7T 3M65A 3ZKRA 2KLQA 2W4XA 5HXSA 2LKGA 2WZYA 5L3GB 3B13A 4ZJSA 5EK3A 1UCUA 2JQKA 5FXXA 4IDOA 2FJDA 4OFZA 5LHGB 4BQTA 1YW0A 2KXPB 1OEDB 5L4HA 5HXHA 2J62A 1HG5A 4EZ1A 5KX5E 1NEKA 3C4XA 3WTJA 4UM3S 5JRCB 3A8YC 4TNVA 4XAXB 2XNUA 3LG7A 4U7YA 1KK7A 2WMNA 3RI5A 4BA9A 3ZMVB 3AE2A 4JI3T 3B5MA 4ZI3C 4LFCT 2WP9A 1YKHB 2LM2A 2XAQB 2W00A 2Y8DA 2WSSV 3AAEB 4PNIA 2XZEA 1LVKA 3ZPOA 5DJQC 4P1NA 4D01A 2A9UA 3H3MA 1I6ZA 1T72A 3IEEA 3FZHB 4ALXA 3C4ZA 4X5TA 2Y56A 1VOMA 3SIOA 5HEGA 2IC9A 3GWHA 4UV9B 3V5UA 5LMNT 1MMDA 3RC3A 2LHNA 2WWUA 3UTKA 3OPCA 4DR2T 2YU2A 5LG3A 3OJAA 3AE3A 2KT9A 2WU2A 3DJBA 2LE8A 4DV0T 1D0ZA 3C64A 4NXMT 5JQGE 5E0OA 4PK5A 2DWGA 2I59A 4ILBA 4TWHA 5L3EB 3ZDHA 4BAYB 3J7Yq 2XSAA 3RQUA 3O1IA 5ABGA 4TUYE 3RKGA 5F3JA 5CO5A 5LHHB 1W0AA 2E2AA 3P4QA 3RIFA 3ZCJA 5C8YE 1KF6A 1BR2A 4LF8T 4CXWA 4EAHA 3TLTA 2VL8A 3G06A 3L39A 1YQ4A 4EOZB 2XAHB 3AA1B 4QH4A 3M3ZB 4DIDB 1LKXA 3X1DA 1CUNA 4DBMA 3TLUA 2VVNA 3SFEA 3U8KA 4E7ZA 1WYCA 5LOVE 2BYNA 1D1AA 4TV9E 4KI0F 3LFMA 4CZZB 2YINA 4HWIB 1OXZA 2VKDA 5CA0E 5AQTB 1SE7A 3TLWA 4H63V 4ZRUA 1D0XA 5FJVA 2XAJB 3DP7A 1YD8G 2CE7A 2HPJA 4B3ST 1MMNA 4UVBB 3O1HA 5LGTB 4AIUA 4KX6A 4YT0A 3TLSA 1KFYA 3AVRA 1FEWA 3Q5DA 2WQYA 3ZJ1A 4HFCA 5LGUB 3WI3A 2VKJA 4X64T 2XSBA 2KMFA 5FMNA 1N36T 4JEHB 1W09A 2VASA 4WBNE 4TWDA 2KNDA 3TKLB 3AVSA 5ABHA 5L4EA 4PFPA 1IBLT 1W9RA 4A56A 4L9IA 4QACA 4DUYT 1E1HB 2H7OA 3N9OA 5JMEA 2FUPA 4IT4A 5FP3A 5H6RB 3ZN0B 4CI2B 2N2NA 2WS3A 3GN5A 2V6YA 3N5LA 4UVAB 3RRWA 4JI6T 2WBLA 3HKEE 5JDHA 3RC8A 4B6XA 3FZLB 5AQFB 3QUJA 5JR9B 1S35A 2PFVA 4OX9T 1BR0A 4QABA 1HCIA 1MNEA 1V9DA 2AXDS 2P9BA 4ISSA 2X0LB 4HWHA 3WTLA 1S94A 5AQKB 2ZM2A 5CGMA 5AQJB 5C3JA 5JDMA 4ZJTA 2WDVA 2A72A 4AKRB 2X9HA 5ABEA 5L47A 4EB6E 3CX6B 4YSXA 5JH7E 3ONJA 3UU8A 3RGLA 5LJNA 2E9XA 3FB2A 5AQIB 3ZJ2A 2LKHA 2Y57A 2H7VC 2RPAA 3UQ7A 5AFNA 3I0QA 3NRXA 5CJ5A 2XTLA 4C91A 4AISA 4OHFA 2NW8A 4A97A 2BG9C 5L3DB 2X9YA 5J5GA 3MK7C 3U8MA 4ZEYA 3SRZA 3N9MA 4JI1T 4P09A 1N32T 2XAGB 3SWHA 2CWYA 2CBJA 3AA0B 4X20E 3J9X1 3RPUA 5IUXA 5LYJE 2D9DA 4WV9A 2W62A 2VQFT 4U2YA 3AE1A 4AKIA 4TWFA 5L3FB 4DO0A 2XYSA 4MHCA 3Q5EA 2JRKA 1M7KA 3T1YT 3F57A 5AFKA 3O9XA 5L3BB 3BQKA 1W0BA 2H88A 2LJLA 5DQVA 4WBOA 4ZK1A 4HGAA 3T4MA 3WTKA 4HTEA 4GIWA 4UIGA 4EEDA 3CMLA 3C98B 1UX2A 3H3AA 1QLBA 2KINB 3HKBE 2BYRA 3RF1A 4DV6T 1US7B 4COFA 2F4VT 3P4RA 2X00D 1X79A 5J0ZA 2ZLYA 2YK0A 1HX8A 3UQ4A 5GONE 1ZEEA 1FMWA 2IAKA 4ZS3A 3A5XA 4EZHA 1D1CA 4E7SA 3LK3B 2H3RA 3ZEFB 3AEGA 3L8RA 2VKOA 1JNRA 4B3RT 2EHOB 3CQCB 3KINB 3FXEB 4G63A 2UU9T 2XZ5A 2E9XC 4U33A 3HKDE 3WTMA 1E2AA 3E08A 4IE5A 3C51A 4JV5T 1HG2A 2OV9A 3WTIA 3ONLC 1XDOA 1Y64B 3Q2MA 3SQ6A 1IBMT 1N34T 5J2TE 1HNXT 4KMCA 2XAFB 3CVRA 2CXLA 3P8CD 1MIWA 1IJ6A 4CQIA 5DQWA 4EEBA 2BKPA 2X51A 3NVOA 5FXWA 5KE4A 2W63A 2QRXA 2JMKA 3KDSE 4X66T 3U78A 2UUAT 4XK9A 3U3IA 3NZQA 5JREA 2ZJUA 1HS7A 4IDNA 4QHOA 2HH7A 2XM2A 2BVMA 2XJ7A 1D0YA 4GK5E 5KDMC 1HFAA 3MKDA 4UXUA 3MACA 1IJ5A 3OVUA 1NWMX 3OBVE 2Q9QD 2JQ9A 3ZYLA 1SHZC 5HWYA 4H9RC 4MLKA 4UEMA 4DR4T 1J1JA 4AFHA 3BQLA 4U31A 2V26A 4PJNA 4DMVA 2C9TA 2X9WA 3CKDA 4X65T 4CI3B 3CPZA 2BYSA 3CQXC 1FMVA 2V6YB 2UZ6A 2MOZA 4JI4T 1VCSA 4EYYR 2JPFA 4IE4A 4DR3T 3AEEA 5LHIB 3WTHA 2Y54A 2LHRA 2ZM8A 3IBPA 3TLVA 4XHEA 1KEYA 3V5SA 4F8HA 2CHNA 3P4WA 3FBZA 4PIRA 4P0BA 2X68A 2LSGA 5JDNA 1XMOT 4ZZBA 3KVBA 1EZ3A 2HN2A 1KNRA 1AJ3A 3QNUA 2EHOD 4I4TE 5AFJA 2NP9A 3UUNA 4JEUB 4H9NC 2DL1A 2E9XB 3WIPA 4ZI2D 1XZYA 3B57A 4J2CA 2WWVA 3WAKA 2D5UA 5J1GA 4O2AE 4MFRA 3AE8A 1WFDA 1D1BA 3ANWA 2XPKA 3AE9A 3CWZB 3C84A 3FZKB 3PU8A 3VKHA 2WNJA 2I6HA 2ACXA 2DHRA 5AFMA 3JC6D 2LRKA 1YXRA 1XMQT 2VURA 1T8BA 3RYFE 3FBLA 5ABFB 5HEOA 2DI4A 2CLYB 3AECA 4O4HE 4YJ2E 2LSJA 3RYHE 2ZM0A 2W67A 5HCMA 3GA8A 2NW7A 3OYXA 3ZYKA 4O8SA 4AKGA 2H89A 4EYUA 4X1KE 3VRAA 2CA5A 2WCAA
chains in the Genus database with same CATH topology
2ZJVA 2XYSA 3P4WA 5KZUA 2YMEA 3JAEA 2BYNA 4HFHA 4D01A 4PIRA 4QABA 4QH1A 4UM1A 1OEDC 4IL4A 4ZZCA 3PEOA 4ZZBA 2YKSA 2PGZA 3SH1A 5AFKA 4NPPA 2XQ5A 2YMDA 2XQAA 4ALXA 3WTLA 4UY2A 4QH5A 5BW2A 2YN6A 5TVCA 3WTOA 2XYTA 5AFJA 5KE4A 4ZK1A 2YOEA 4ILAA 4X5TA 1UW6A 2Y56A 4BFQA 4XK9A 3TLWA 5HEGA 3SIOA 3T4MA 3WTKA 3WIPA 4ZJTA 4IREA 2ZJUA 4IL9A 4ZRUA 1UV6A 4Z91A 4QAAA 5FJVA 4LMJA 5L47A 3UU3A 1UX2A 3ZKRA 1OEDE 2XQ6A 2VL0A 2BYRA 2KSRA 3P50A 3UU8A 5LG3A 2WNLA 4UXUA 3C79A 4HFIA 4LMLA 4COFA 3C84A 3UU5A 5BP0A 1I9BA 2XQ8A 2LKGA 2X00D 2WZYA 2WNJA 3EHZA 3RIAA 4ZJSA 2XNTA 5J0ZA 4FRRA 3TLSA 5BRXA 2W8FA 5HEUA 4F8HA 4BQTA 3RHWA 2BG9B 2XZ6A 5AFMA 4HFCA 4HQPA 5HCJA 2WNCA 2Y58A 2LKHA 2Y57A 5AFMB 1OEDB 2LLYA 5L4HA 3UQ4A 2BJ0A 4A98A 4NZBA 3JADA 3RQWA 4EZ1A 4ILBA 4TWHA 3ZDHA 2Y7YA 4AFHA 3UQ7A 4Z90A 2BYQA 4AFGA 5AFNA 2C9TA 2XQ7A 5J5HA 3WTJA 4UM3S 2XQ4A 2BR7A 4LMKA 3RQUA 4TWDA 2M6IA 4TNVA 2BYPA 3ZDGA 2XNUA 2BG9E 3UU6A 2BYSA 2PH9A 5SYOA 4B5DA 5L4EA 4TNWA 2XQ3A 4ILCA 4AFTA 5HEOA 2XNVA 2UZ6A 2BG9A 2M6BA 4A97A 3RI5A 4ZR6A 2MAWA 5CO5A 4ZK4A 3JAFA 2XZ5A 2BG9C 3RIFA 1OEDA 3IGQA 3UU4A 3WTMA 5J5GA 3WTNA 5J5IA 3U8MA 4HFDA 2W8GA 4QACA 5AFHA 5AFLA 2QC1B 2BR8A 3EI0A 4HFBA 2LM2A 2XQ9A 3TLTA 5JMEA 5LXBA 5HCMA 3WTIA 5J5FA 3U8NA 3EAMA 4UM3A 3WTHA 2Y54A 5IUXA 4QH4A 3SQ6A 5CFBA 5HEJA 5AINA 4HFEA 5HEHA 4UM3P 2X00A 3GUAA 4WV9A 3UUBA 3PMZA 3SQ9A 3U8JA 3TLVA 4DBMA 4XHEA 2WN9A 3U8LA 3TLUA 3U8KA 4TWFA 3LSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJV A;  2XYS A;  3P4W A;  5KZU A;  2YME A;  3JAE A;  2BYN A;  4HFH A;  4D01 A;  4PIR A;  4QAB A;  4QH1 A;  4UM1 A;  1OED C;  4IL4 A;  4ZZC A;  3PEO A;  4ZZB A;  2YKS A;  2PGZ A;  3SH1 A;  5AFK A;  4NPP A;  2XQ5 A;  2YMD A;  2XQA A;  4ALX A;  3WTL A;  4UY2 A;  4QH5 A;  5BW2 A;  2YN6 A;  5TVC A;  3WTO A;  2XYT A;  5AFJ A;  5KE4 A;  4ZK1 A;  2YOE A;  4ILA A;  4X5T A;  1UW6 A;  2Y56 A;  4BFQ A;  4XK9 A;  3TLW A;  5HEG A;  3SIO A;  3T4M A;  3WTK A;  3WIP A;  4ZJT A;  4IRE A;  2ZJU A;  4IL9 A;  4ZRU A;  1UV6 A;  4Z91 A;  4QAA A;  5FJV A;  4LMJ A;  5L47 A;  3UU3 A;  1UX2 A;  3ZKR A;  1OED E;  2XQ6 A;  2VL0 A;  2BYR A;  2KSR A;  3P50 A;  3UU8 A;  5LG3 A;  2WNL A;  4UXU A;  3C79 A;  4HFI A;  4LML A;  4COF A;  3C84 A;  3UU5 A;  5BP0 A;  1I9B A;  2XQ8 A;  2LKG A;  2X00 D;  2WZY A;  2WNJ A;  3EHZ A;  3RIA A;  4ZJS A;  2XNT A;  5J0Z A;  4FRR A;  3TLS A;  5BRX A;  2W8F A;  5HEU A;  4F8H A;  4BQT A;  3RHW A;  2BG9 B;  2XZ6 A;  5AFM A;  4HFC A;  4HQP A;  5HCJ A;  2WNC A;  2Y58 A;  2LKH A;  2Y57 A;  5AFM B;  1OED B;  2LLY A;  5L4H A;  3UQ4 A;  2BJ0 A;  4A98 A;  4NZB A;  3JAD A;  3RQW A;  4EZ1 A;  4ILB A;  4TWH A;  3ZDH A;  2Y7Y A;  4AFH A;  3UQ7 A;  4Z90 A;  2BYQ A;  4AFG A;  5AFN A;  2C9T A;  2XQ7 A;  5J5H A;  3WTJ A;  4UM3 S;  2XQ4 A;  2BR7 A;  4LMK A;  3RQU A;  4TWD A;  2M6I A;  4TNV A;  2BYP A;  3ZDG A;  2XNU A;  2BG9 E;  3UU6 A;  2BYS A;  2PH9 A;  5SYO A;  4B5D A;  5L4E A;  4TNW A;  2XQ3 A;  4ILC A;  4AFT A;  5HEO A;  2XNV A;  2UZ6 A;  2BG9 A;  2M6B A;  4A97 A;  3RI5 A;  4ZR6 A;  2MAW A;  5CO5 A;  4ZK4 A;  3JAF A;  2XZ5 A;  2BG9 C;  3RIF A;  1OED A;  3IGQ A;  3UU4 A;  3WTM A;  5J5G A;  3WTN A;  5J5I A;  3U8M A;  4HFD A;  2W8G A;  4QAC A;  5AFH A;  5AFL A;  2QC1 B;  2BR8 A;  3EI0 A;  4HFB A;  2LM2 A;  2XQ9 A;  3TLT A;  5JME A;  5LXB A;  5HCM A;  3WTI A;  5J5F A;  3U8N A;  3EAM A;  4UM3 A;  3WTH A;  2Y54 A;  5IUX A;  4QH4 A;  3SQ6 A;  5CFB A;  5HEJ A;  5AIN A;  4HFE A;  5HEH A;  4UM3 P;  2X00 A;  3GUA A;  4WV9 A;  3UUB A;  3PMZ A;  3SQ9 A;  3U8J A;  3TLV A;  4DBM A;  4XHE A;  2WN9 A;  3U8L A;  3TLU A;  3U8K A;  4TWF A;  3LSV A; 
#chains in the Genus database with same CATH topology
 1XNR T;  3NWI A;  3CK6 A;  1MMG A;  4QX7 B;  1NEN A;  5JDF A;  3PUG A;  3SH1 A;  2XY8 B;  3FHN A;  3ZMU B;  4H9Q C;  2YOE A;  2YU1 A;  3SOL A;  3AAA B;  2IML A;  2UXN B;  1ZKE A;  4ZHQ E;  5FY0 A;  2XM1 A;  4DV2 T;  5ADX L;  3PUY F;  5JVD E;  4LML A;  3OYZ A;  1OWA A;  4ILU A;  3UU5 A;  3OKQ A;  1YKE B;  3HR0 A;  3O1J A;  3ONX A;  3VR9 A;  3LBX B;  3N9N A;  4CN4 A;  2BDE A;  2BS3 A;  2Y6X A;  4L5G A;  2K5B B;  3PJA A;  4PJM A;  3RQW A;  2CCQ A;  2C5K T;  3SFD A;  4UXN B;  3Q5W A;  3RKO A;  3KFW X;  3ETV A;  3ZDG A;  4X62 T;  4MBQ A;  4TNW A;  2XQ3 A;  4IDQ A;  3ZCI A;  2BG9 A;  4YTM A;  2PG8 A;  3BK9 A;  1UUR A;  2C5J A;  5HXR A;  1GQE A;  4KHZ F;  3PDY A;  1Y01 A;  1T7S A;  2A2F X;  5LJM A;  1XNQ T;  3HL6 A;  3FXD B;  1WR0 A;  2ACZ A;  4TZ4 C;  4IDZ A;  4DUZ T;  2QYW A;  2WZI A;  4DR6 T;  3RYC E;  4I0U A;  3AE7 A;  2FJE A;  2D2S A;  3U8L A;  2KWI B;  5J2U E;  5BR8 T;  5LB7 B;  4U2Z A;  4IL4 A;  2FJA A;  4UY2 A;  2WM9 A;  4ZI7 E;  4H9O C;  3PUZ F;  4JLE A;  2VQE T;  3ZMS B;  4IL9 A;  4K0K T;  4Z91 A;  5HXC A;  4LMJ A;  1HR0 T;  1OED E;  2KSR A;  5M4Y A;  3ZT7 A;  2V7L A;  5AQS B;  5BP0 A;  4AQY T;  3AE6 A;  2JIW A;  2IW5 B;  2JMH A;  3EHZ A;  3N2G E;  4B3T T;  5IWA T;  4ZS2 A;  2XNT A;  5JDL A;  2L9Q A;  4ERR A;  2W8F A;  1IZN B;  5FNV E;  3HI2 A;  4HQP A;  5CA1 E;  4DV4 T;  2K3W A;  3RIU A;  4ANJ A;  2PBI A;  3KV9 A;  2DNX A;  3ABV A;  4DV7 T;  2CM0 A;  4LMK A;  4TV8 E;  2BYP A;  2WDR A;  3E22 E;  2K48 A;  2PH9 A;  5FXV A;  4C90 A;  3KV6 A;  3K3Q C;  2FBW A;  1JNZ A;  1J5W A;  3F2E A;  3JAF A;  5LMU T;  2YEV C;  3AED A;  2KWH A;  2NTX A;  2M67 A;  5LXB A;  3U8N A;  2IDO B;  3Q9D A;  4DND A;  5AQH B;  2UUB T;  4ZI3 D;  4KP3 C;  2C5I T;  3NRY A;  3VKG A;  2BBJ A;  2V5D A;  3K8P C;  3EUH A;  2YDR A;  2D0T A;  1E7P A;  3ANW B;  2CBI A;  1HF8 A;  4YTN A;  3AA6 B;  2YMD A;  3N2K E;  5HYA A;  1BR1 A;  3RX6 A;  3JCF A;  2Y48 B;  2MTQ A;  3ZSS A;  3EAB A;  5KMG P;  4HN9 A;  4ZOL E;  5F8P A;  2PTF A;  5FY7 A;  3UU3 A;  3H37 A;  2VL0 A;  4PJJ A;  2ES0 A;  4DV5 T;  2NTY A;  1X9B A;  2IUB A;  3W15 B;  4H9P C;  2V7I A;  4JUY A;  4H63 H;  3VR8 A;  3AAI A;  1MIV A;  2WNC A;  2MYS A;  4OK0 A;  4LF9 T;  4PFO A;  2Y7Y A;  2XUE A;  4GK0 E;  2BYQ A;  2ZM6 T;  3UFG A;  1G73 A;  2XNV A;  4HWC A;  4LF5 T;  4U7I A;  3IGQ A;  1WRD A;  5AFH A;  5HWX A;  1MMA A;  3RIU C;  4HFB A;  5LA6 E;  5J5F A;  2IC6 A;  3FZM B;  4DBQ A;  3DTO A;  4HFE A;  5HEH A;  3L3P A;  5LGN B;  1VRB A;  1CHU A;  4AXP A;  5IYZ E;  4GKK T;  3PUQ A;  4QH1 A;  4UM1 A;  5JDG A;  4F6R C;  2YKS A;  3K3O A;  3PUX F;  1I94 T;  2YN6 A;  5TVC A;  3WTO A;  2XYT A;  4A5X A;  2E5V A;  2VK9 A;  3A7M A;  3MZK B;  5AQU B;  5EK2 A;  2BKO A;  3ZC1 A;  3SS1 A;  2WNL A;  2BS4 A;  3EDV A;  4KUM B;  5AQP B;  2WDQ A;  4AQF A;  3MXZ A;  4GYS A;  1VCT A;  5HEU A;  4U74 A;  2BG9 B;  2MBG A;  2VVS A;  5CB4 E;  5HCJ A;  4FJO A;  1YQ3 A;  4QX8 B;  4A98 A;  1B7T A;  2WY2 A;  2X66 A;  1H7C A;  4GKJ T;  5AFU L;  3C4W A;  3KV4 A;  1SA0 E;  1UK5 A;  5AQV B;  3UU6 A;  4HWD A;  1KNP A;  3EDU A;  2XHE B;  5LG4 A;  2MAW A;  5H6Q B;  2LOS A;  5AFL A;  4AI6 A;  1Z0P A;  3HA4 A;  2CRB A;  4WYV A;  4UM3 A;  3UUX B;  4X1I E;  4XBF B;  3U8J A;  2X00 A;  3GN5 B;  1DU2 A;  5JR9 A;  1MIY A;  3R84 B;  3HKC E;  1R8I A;  2N9D A;  2JQQ A;  4KHP T;  2G0U A;  2DCF A;  2YDQ A;  2CMR A;  5AQQ B;  2CWO A;  3ZT6 A;  1QUU A;  4I55 E;  2B1E A;  5LBM A;  4KBM B;  2UXD T;  2XQ6 A;  2E5L T;  1O3X A;  1HX1 B;  3KV5 A;  2UXB T;  4LFB T;  5DAB A;  4OYJ A;  2K24 A;  1UX5 A;  4ASK A;  2WB5 A;  2XZ6 A;  3ZMZ B;  2Y58 A;  5F5W A;  3OTO T;  2B76 A;  3D0T A;  3IA3 A;  1L0V A;  4DVD A;  3MA9 A;  2M6I A;  1HNW T;  5JTG A;  2QA7 A;  3QB5 A;  4AQF C;  2M6B A;  4ZR6 A;  3AA7 B;  3PUV F;  1XWM A;  3AE5 A;  2D0U A;  3PV0 F;  5J5I A;  3ZMT B;  2ODV A;  3C50 A;  5HAX A;  2I0M A;  1LRZ A;  2NW9 A;  3LK4 2;  3N9L A;  5AQL B;  4JYA T;  2QVA A;  2R6G F;  4UVC B;  2BS2 A;  3GMI A;  2X9X A;  3EAM A;  4LF4 T;  2BZB A;  1WLX A;  3UFE A;  4CXX A;  2KZ7 B;  1IAP A;  3I1A A;  5AQN B;  4JI2 T;  2HPL A;  4HKA A;  5FXZ A;  2Q9Q A;  4NIQ A;  4ADZ A;  4YJ3 E;  2XQ5 A;  2FJB A;  2V5C A;  5BW2 A;  4QH5 A;  2NR4 A;  2IHR 1;  4EGW A;  2LOP A;  3ETU A;  5LCY A;  3PUW F;  4QAA A;  4Z8X A;  4NXN T;  5ETW A;  3KVA A;  2GK9 A;  3PTR B;  4LF7 T;  4UR9 A;  5JR9 C;  5C2T A;  4HFI A;  2K9A A;  4BJN A;  1FIO A;  3RIA A;  2A3D A;  3AXJ A;  2OA5 A;  5BRX A;  4JI8 T;  2ZMA A;  3P7I A;  2LLY A;  4TN7 B;  4CN6 A;  2BJ0 A;  4DR5 T;  4DBR A;  4NZB A;  4UV8 B;  4YSY A;  4YHH T;  4AQG A;  4Q25 A;  5J5H A;  2XQ4 A;  1SUM B;  3K1S A;  4YFS A;  3NBX X;  4AKL A;  4B5D A;  2EHO A;  5BMV E;  2NWB A;  4IIJ E;  2RA1 A;  2HHH T;  4ZK4 A;  4HWF A;  1KNZ A;  2RP4 A;  1WCR A;  4CXY A;  2XQ9 A;  4DMW A;  3CIR A;  2VWA A;  4X1Y E;  2E9X D;  3ESL A;  4HFV A;  2VB6 A;  3O4X E;  3AEF A;  4K0U A;  2WN9 A;  2BG9 E;  4BFQ A;  5LXT E;  4EZ4 A;  4HEA A;  3UUM A;  4UF0 A;  3RYI E;  3RRC A;  2BVL A;  4EIW A;  4B3M T;  4YLH A;  2L3L A;  3T1H T;  5L3C B;  3BQI A;  2Z6E A;  4O4J E;  1XDP A;  3FZF B;  3NZP A;  2Q9Q C;  4O4L E;  3R6N A;  5TAO A;  2J1D G;  4QWN B;  3RH3 A;  5FL0 A;  2AE9 A;  2W2U A;  3PUS A;  4AKH A;  4IE0 A;  2JQH A;  4YTP A;  1LVF A;  4UEL A;  4WNK A;  4YY3 T;  2LM9 A;  3LK2 B;  2HN1 A;  2WZH A;  3LJC A;  1G8X A;  1IBK T;  5FYM A;  4AFG A;  3P4P A;  2BR7 A;  5L2L A;  5EK4 A;  3CX7 B;  5SYO A;  4ILC A;  4NUV A;  5FVL A;  3PUA A;  3KBU A;  2WMO A;  4LF6 T;  1HNZ T;  1OED A;  3S4U A;  3QC9 A;  5KXJ A;  3PJA J;  2XQY A;  3QB5 K;  2OLT A;  4HE8 A;  2QC1 B;  4YXD A;  1UUS A;  5JRC A;  4N78 D;  5JDQ A;  5AQG B;  4G2A A;  3K3N A;  3CX8 B;  4WW0 A;  4UM3 P;  3PMZ A;  1ZHC A;  4DV3 T;  2EHO C;  3ZC0 A;  4H9S E;  4CN1 A;  2YME A;  1QSD A;  4ZI2 C;  3WAJ A;  4YSZ A;  4CI1 B;  5FY1 A;  4PK6 A;  2ODU A;  4QXH B;  2PJQ A;  4GOU A;  4IST A;  5AQO B;  1T98 A;  5LNK A;  4ILA A;  4PK4 A;  2NOX A;  4IHJ E;  2J4G A;  3N9P A;  2L8K A;  2V7J A;  4IRE A;  5FKY A;  3AEB A;  3UUL A;  5HXE A;  3UT5 E;  2LSK A;  3IF8 B;  1ZV4 X;  5AQM B;  5FL1 A;  3C79 A;  3JC6 C;  1UGO A;  2SPC A;  4IDP A;  2J47 A;  4QKN A;  2CPT A;  2E8I A;  3RHW A;  2CXD A;  2WU5 A;  3I0O A;  4DV1 T;  1Z8U A;  5AFM B;  3PE0 A;  1U5P A;  2X67 A;  2LSY A;  5FVK A;  2N1G A;  3MJX A;  3JAD A;  4JI5 T;  2BBH A;  3VHL A;  3N2O A;  4LFA T;  2UUC T;  4V1A v;  3AEA A;  5AQR B;  3KBT A;  5ABF A;  4IE7 A;  1ZP0 A;  4O4I E;  4AFT A;  1J5E T;  2Q9Q B;  3IHR A;  2QGS A;  3WTN A;  1UX4 A;  2BKN A;  4PJL A;  5A1L A;  3EI0 A;  2V7K A;  2WAU A;  3ZYM A;  3LDQ B;  1NAF A;  3ZLI A;  4IGU A;  5EZY E;  5AIN A;  2MPK A;  3CQG B;  3AE4 A;  3SQ9 A;  3L09 A;  2CEA A;  2YDS A;  4O2B E;  2X0Y A;  2LEH A;  3LSV A;  2W66 A;  3JAE A;  2LRL A;  2VKH A;  4HFH A;  2UXC T;  4DR1 T;  1OED C;  4ZZC A;  3VU7 H;  2W0G A;  2PGZ A;  4P0A A;  3Q5X A;  4YHJ A;  2CXF A;  3RLF F;  5LBQ B;  1UW6 A;  1BR4 A;  2CHO A;  3AXJ B;  3NKZ A;  1ZOY A;  3I9W A;  4XZC A;  1UV6 A;  3I9Y A;  4U3C A;  3EVY A;  3QOF A;  4PAG A;  1FJG T;  5LP6 E;  3P50 A;  2V7M A;  1I9B A;  2XQ8 A;  4GYR A;  3LBX A;  4FRR A;  3ZST A;  1MND A;  4QXB B;  4JI0 T;  3P4S A;  1WYB A;  2DWK A;  2C0S A;  2XAS B;  3ZT5 A;  2V1D B;  4QXC B;  4Z90 A;  1N33 T;  4JBW F;  2XQ7 A;  4WZX A;  2LSI A;  3F31 A;  2IIU A;  4I50 E;  4MAL A;  4M1P A;  4I43 B;  3VRB A;  4IE6 A;  4L0R A;  4OYK A;  3UU4 A;  1WR6 A;  3QK6 A;  4HFD A;  2W8G A;  3T8O A;  4ZXL A;  4JI7 T;  4UF0 B;  2BR8 A;  4FI5 A;  3ZN1 B;  4EV6 A;  4NUU A;  3PUR A;  3E0Z A;  4TX5 A;  5CFB A;  5HEJ A;  2UXX B;  2X0H A;  3N9Q A;  4BJM A;  4EXT A;  3UUB A;  3GUA A;  2ZJV A;  2DLR A;  2CLY C;  5KZU A;  5IHY A;  2LT3 A;  1HTJ F;  3PEO A;  2JJ9 A;  4PW8 A;  4NPP A;  4U72 A;  2XQA A;  1U4Q A;  2V8S V;  2W61 A;  3PU3 A;  1M62 A;  3AB3 B;  2V6X A;  4DR7 T;  3M65 A;  3ZKR A;  2KLQ A;  2W4X A;  5HXS A;  2LKG A;  2WZY A;  5L3G B;  3B13 A;  4ZJS A;  5EK3 A;  1UCU A;  2JQK A;  5FXX A;  4IDO A;  2FJD A;  4OFZ A;  5LHG B;  4BQT A;  1YW0 A;  2KXP B;  1OED B;  5L4H A;  5HXH A;  2J62 A;  1HG5 A;  4EZ1 A;  5KX5 E;  1NEK A;  3C4X A;  3WTJ A;  4UM3 S;  5JRC B;  3A8Y C;  4TNV A;  4XAX B;  2XNU A;  3LG7 A;  4U7Y A;  1KK7 A;  2WMN A;  3RI5 A;  4BA9 A;  3ZMV B;  3AE2 A;  4JI3 T;  3B5M A;  4ZI3 C;  4LFC T;  2WP9 A;  1YKH B;  2LM2 A;  2XAQ B;  2W00 A;  2Y8D A;  2WSS V;  3AAE B;  4PNI A;  2XZE A;  1LVK A;  3ZPO A;  5DJQ C;  4P1N A;  4D01 A;  2A9U A;  3H3M A;  1I6Z A;  1T72 A;  3IEE A;  3FZH B;  4ALX A;  3C4Z A;  4X5T A;  2Y56 A;  1VOM A;  3SIO A;  5HEG A;  2IC9 A;  3GWH A;  4UV9 B;  3V5U A;  5LMN T;  1MMD A;  3RC3 A;  2LHN A;  2WWU A;  3UTK A;  3OPC A;  4DR2 T;  2YU2 A;  5LG3 A;  3OJA A;  3AE3 A;  2KT9 A;  2WU2 A;  3DJB A;  2LE8 A;  4DV0 T;  1D0Z A;  3C64 A;  4NXM T;  5JQG E;  5E0O A;  4PK5 A;  2DWG A;  2I59 A;  4ILB A;  4TWH A;  5L3E B;  3ZDH A;  4BAY B;  3J7Y q;  2XSA A;  3RQU A;  3O1I A;  5ABG A;  4TUY E;  3RKG A;  5F3J A;  5CO5 A;  5LHH B;  1W0A A;  2E2A A;  3P4Q A;  3RIF A;  3ZCJ A;  5C8Y E;  1KF6 A;  1BR2 A;  4LF8 T;  4CXW A;  4EAH A;  3TLT A;  2VL8 A;  3G06 A;  3L39 A;  1YQ4 A;  4EOZ B;  2XAH B;  3AA1 B;  4QH4 A;  3M3Z B;  4DID B;  1LKX A;  3X1D A;  1CUN A;  4DBM A;  3TLU A;  2VVN A;  3SFE A;  3U8K A;  4E7Z A;  1WYC A;  5LOV E;  2BYN A;  1D1A A;  4TV9 E;  4KI0 F;  3LFM A;  4CZZ B;  2YIN A;  4HWI B;  1OXZ A;  2VKD A;  5CA0 E;  5AQT B;  1SE7 A;  3TLW A;  4H63 V;  4ZRU A;  1D0X A;  5FJV A;  2XAJ B;  3DP7 A;  1YD8 G;  2CE7 A;  2HPJ A;  4B3S T;  1MMN A;  4UVB B;  3O1H A;  5LGT B;  4AIU A;  4KX6 A;  4YT0 A;  3TLS A;  1KFY A;  3AVR A;  1FEW A;  3Q5D A;  2WQY A;  3ZJ1 A;  4HFC A;  5LGU B;  3WI3 A;  2VKJ A;  4X64 T;  2XSB A;  2KMF A;  5FMN A;  1N36 T;  4JEH B;  1W09 A;  2VAS A;  4WBN E;  4TWD A;  2KND A;  3TKL B;  3AVS A;  5ABH A;  5L4E A;  4PFP A;  1IBL T;  1W9R A;  4A56 A;  4L9I A;  4QAC A;  4DUY T;  1E1H B;  2H7O A;  3N9O A;  5JME A;  2FUP A;  4IT4 A;  5FP3 A;  5H6R B;  3ZN0 B;  4CI2 B;  2N2N A;  2WS3 A;  3GN5 A;  2V6Y A;  3N5L A;  4UVA B;  3RRW A;  4JI6 T;  2WBL A;  3HKE E;  5JDH A;  3RC8 A;  4B6X A;  3FZL B;  5AQF B;  3QUJ A;  5JR9 B;  1S35 A;  2PFV A;  4OX9 T;  1BR0 A;  4QAB A;  1HCI A;  1MNE A;  1V9D A;  2AXD S;  2P9B A;  4ISS A;  2X0L B;  4HWH A;  3WTL A;  1S94 A;  5AQK B;  2ZM2 A;  5CGM A;  5AQJ B;  5C3J A;  5JDM A;  4ZJT A;  2WDV A;  2A72 A;  4AKR B;  2X9H A;  5ABE A;  5L47 A;  4EB6 E;  3CX6 B;  4YSX A;  5JH7 E;  3ONJ A;  3UU8 A;  3RGL A;  5LJN A;  2E9X A;  3FB2 A;  5AQI B;  3ZJ2 A;  2LKH A;  2Y57 A;  2H7V C;  2RPA A;  3UQ7 A;  5AFN A;  3I0Q A;  3NRX A;  5CJ5 A;  2XTL A;  4C91 A;  4AIS A;  4OHF A;  2NW8 A;  4A97 A;  2BG9 C;  5L3D B;  2X9Y A;  5J5G A;  3MK7 C;  3U8M A;  4ZEY A;  3SRZ A;  3N9M A;  4JI1 T;  4P09 A;  1N32 T;  2XAG B;  3SWH A;  2CWY A;  2CBJ A;  3AA0 B;  4X20 E;  3J9X 1;  3RPU A;  5IUX A;  5LYJ E;  2D9D A;  4WV9 A;  2W62 A;  2VQF T;  4U2Y A;  3AE1 A;  4AKI A;  4TWF A;  5L3F B;  4DO0 A;  2XYS A;  4MHC A;  3Q5E A;  2JRK A;  1M7K A;  3T1Y T;  3F57 A;  5AFK A;  3O9X A;  5L3B B;  3BQK A;  1W0B A;  2H88 A;  2LJL A;  5DQV A;  4WBO A;  4ZK1 A;  4HGA A;  3T4M A;  3WTK A;  4HTE A;  4GIW A;  4UIG A;  4EED A;  3CML A;  3C98 B;  1UX2 A;  3H3A A;  1QLB A;  2KIN B;  3HKB E;  2BYR A;  3RF1 A;  4DV6 T;  1US7 B;  4COF A;  2F4V T;  3P4R A;  2X00 D;  1X79 A;  5J0Z A;  2ZLY A;  2YK0 A;  1HX8 A;  3UQ4 A;  5GON E;  1ZEE A;  1FMW A;  2IAK A;  4ZS3 A;  3A5X A;  4EZH A;  1D1C A;  4E7S A;  3LK3 B;  2H3R A;  3ZEF B;  3AEG A;  3L8R A;  2VKO A;  1JNR A;  4B3R T;  2EHO B;  3CQC B;  3KIN B;  3FXE B;  4G63 A;  2UU9 T;  2XZ5 A;  2E9X C;  4U33 A;  3HKD E;  3WTM A;  1E2A A;  3E08 A;  4IE5 A;  3C51 A;  4JV5 T;  1HG2 A;  2OV9 A;  3WTI A;  3ONL C;  1XDO A;  1Y64 B;  3Q2M A;  3SQ6 A;  1IBM T;  1N34 T;  5J2T E;  1HNX T;  4KMC A;  2XAF B;  3CVR A;  2CXL A;  3P8C D;  1MIW A;  1IJ6 A;  4CQI A;  5DQW A;  4EEB A;  2BKP A;  2X51 A;  3NVO A;  5FXW A;  5KE4 A;  2W63 A;  2QRX A;  2JMK A;  3KDS E;  4X66 T;  3U78 A;  2UUA T;  4XK9 A;  3U3I A;  3NZQ A;  5JRE A;  2ZJU A;  1HS7 A;  4IDN A;  4QHO A;  2HH7 A;  2XM2 A;  2BVM A;  2XJ7 A;  1D0Y A;  4GK5 E;  5KDM C;  1HFA A;  3MKD A;  4UXU A;  3MAC A;  1IJ5 A;  3OVU A;  1NWM X;  3OBV E;  2Q9Q D;  2JQ9 A;  3ZYL A;  1SHZ C;  5HWY A;  4H9R C;  4MLK A;  4UEM A;  4DR4 T;  1J1J A;  4AFH A;  3BQL A;  4U31 A;  2V26 A;  4PJN A;  4DMV A;  2C9T A;  2X9W A;  3CKD A;  4X65 T;  4CI3 B;  3CPZ A;  2BYS A;  3CQX C;  1FMV A;  2V6Y B;  2UZ6 A;  2MOZ A;  4JI4 T;  1VCS A;  4EYY R;  2JPF A;  4IE4 A;  4DR3 T;  3AEE A;  5LHI B;  3WTH A;  2Y54 A;  2LHR A;  2ZM8 A;  3IBP A;  3TLV A;  4XHE A;  1KEY A;  3V5S A;  4F8H A;  2CHN A;  3P4W A;  3FBZ A;  4PIR A;  4P0B A;  2X68 A;  2LSG A;  5JDN A;  1XMO T;  4ZZB A;  3KVB A;  1EZ3 A;  2HN2 A;  1KNR A;  1AJ3 A;  3QNU A;  2EHO D;  4I4T E;  5AFJ A;  2NP9 A;  3UUN A;  4JEU B;  4H9N C;  2DL1 A;  2E9X B;  3WIP A;  4ZI2 D;  1XZY A;  3B57 A;  4J2C A;  2WWV A;  3WAK A;  2D5U A;  5J1G A;  4O2A E;  4MFR A;  3AE8 A;  1WFD A;  1D1B A;  3ANW A;  2XPK A;  3AE9 A;  3CWZ B;  3C84 A;  3FZK B;  3PU8 A;  3VKH A;  2WNJ A;  2I6H A;  2ACX A;  2DHR A;  5AFM A;  3JC6 D;  2LRK A;  1YXR A;  1XMQ T;  2VUR A;  1T8B A;  3RYF E;  3FBL A;  5ABF B;  5HEO A;  2DI4 A;  2CLY B;  3AEC A;  4O4H E;  4YJ2 E;  2LSJ A;  3RYH E;  2ZM0 A;  2W67 A;  5HCM A;  3GA8 A;  2NW7 A;  3OYX A;  3ZYK A;  4O8S A;  4AKG A;  2H89 A;  4EYU A;  4X1K E;  3VRA A;  2CA5 A;  2WCA A; 
#chains in the Genus database with same CATH homology
 2ZJV A;  2XYS A;  3P4W A;  5KZU A;  2YME A;  3JAE A;  2BYN A;  4HFH A;  4D01 A;  4PIR A;  4QAB A;  4QH1 A;  4UM1 A;  1OED C;  4IL4 A;  4ZZC A;  3PEO A;  4ZZB A;  2YKS A;  2PGZ A;  3SH1 A;  5AFK A;  4NPP A;  2XQ5 A;  2YMD A;  2XQA A;  4ALX A;  3WTL A;  4UY2 A;  4QH5 A;  5BW2 A;  2YN6 A;  5TVC A;  3WTO A;  2XYT A;  5AFJ A;  5KE4 A;  4ZK1 A;  2YOE A;  4ILA A;  4X5T A;  1UW6 A;  2Y56 A;  4BFQ A;  4XK9 A;  3TLW A;  5HEG A;  3SIO A;  3T4M A;  3WTK A;  3WIP A;  4ZJT A;  4IRE A;  2ZJU A;  4IL9 A;  4ZRU A;  1UV6 A;  4Z91 A;  4QAA A;  5FJV A;  4LMJ A;  5L47 A;  3UU3 A;  1UX2 A;  3ZKR A;  1OED E;  2XQ6 A;  2VL0 A;  2BYR A;  2KSR A;  3P50 A;  3UU8 A;  5LG3 A;  2WNL A;  4UXU A;  3C79 A;  4HFI A;  4LML A;  4COF A;  3C84 A;  3UU5 A;  5BP0 A;  1I9B A;  2XQ8 A;  2LKG A;  2X00 D;  2WZY A;  2WNJ A;  3EHZ A;  3RIA A;  4ZJS A;  2XNT A;  5J0Z A;  4FRR A;  3TLS A;  5BRX A;  2W8F A;  5HEU A;  4F8H A;  4BQT A;  3RHW A;  2BG9 B;  2XZ6 A;  5AFM A;  4HFC A;  4HQP A;  5HCJ A;  2WNC A;  2Y58 A;  2LKH A;  2Y57 A;  5AFM B;  1OED B;  2LLY A;  5L4H A;  3UQ4 A;  2BJ0 A;  4A98 A;  4NZB A;  3JAD A;  3RQW A;  4EZ1 A;  4ILB A;  4TWH A;  3ZDH A;  2Y7Y A;  4AFH A;  3UQ7 A;  4Z90 A;  2BYQ A;  4AFG A;  5AFN A;  2C9T A;  2XQ7 A;  5J5H A;  3WTJ A;  4UM3 S;  2XQ4 A;  2BR7 A;  4LMK A;  3RQU A;  4TWD A;  2M6I A;  4TNV A;  2BYP A;  3ZDG A;  2XNU A;  2BG9 E;  3UU6 A;  2BYS A;  2PH9 A;  5SYO A;  4B5D A;  5L4E A;  4TNW A;  2XQ3 A;  4ILC A;  4AFT A;  5HEO A;  2XNV A;  2UZ6 A;  2BG9 A;  2M6B A;  4A97 A;  3RI5 A;  4ZR6 A;  2MAW A;  5CO5 A;  4ZK4 A;  3JAF A;  2XZ5 A;  2BG9 C;  3RIF A;  1OED A;  3IGQ A;  3UU4 A;  3WTM A;  5J5G A;  3WTN A;  5J5I A;  3U8M A;  4HFD A;  2W8G A;  4QAC A;  5AFH A;  5AFL A;  2QC1 B;  2BR8 A;  3EI0 A;  4HFB A;  2LM2 A;  2XQ9 A;  3TLT A;  5JME A;  5LXB A;  5HCM A;  3WTI A;  5J5F A;  3U8N A;  3EAM A;  4UM3 A;  3WTH A;  2Y54 A;  5IUX A;  4QH4 A;  3SQ6 A;  5CFB A;  5HEJ A;  5AIN A;  4HFE A;  5HEH A;  4UM3 P;  2X00 A;  3GUA A;  4WV9 A;  3UUB A;  3PMZ A;  3SQ9 A;  3U8J A;  3TLV A;  4DBM A;  4XHE A;  2WN9 A;  3U8L A;  3TLU A;  3U8K A;  4TWF A;  3LSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...