3U8MA

Crystal structure of the acetylcholine binding protein (achbp) from lymnaea stagnalis in complex with ns3920 (1-(6-bromopyridin-3-yl)-1,4-diazepane)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
202
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine alpha 4 beta 2 receptors: unique role of halogen bonding revealed.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein/agonist
total genus 49
structure length 202
sequence length 206
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3u8mA00
5J0ZA 4WV9A 5HEOA 4QABA 4F8HA 2PH9A 2WN9A 2XNTA 5HCJA 2XQ7A 2W8GA 2YMEA 4EZ1A 5J5HA 3SQ9A 4TNWA 4UM3P 4XHEA 2VL0A 5HEHA 4COFA 5LG3A 2YMDA 3WTLA 3EAMA 3WTMA 2Y58A 5AFMA 4ZJSA 2WNCA 4TWDA 3WTHA 3PMZA 3U8MA 2BYSA 3SQ6A 3UU8A 2XZ5A 2YN6A 1UV6A 4ZK1A 2WNLA 4FRRA 4HQPA 4QH1A 3ZKRA 3SH1A 4ZZBA 2BG9A 5AFHA 5J5FA 2BG9C 4ILBA 4Z91A 3UU4A 3ZDHA 4TNVA 2ZJUA 4UY2A 3P4WA 2XYTA 3EI0A 3RQUA 3WTOA 4NPPA 3RIFA 3JAFA 3UQ4A 4ALXA 4ZK4A 5L4EA 2XQ9A 2Y57A 5AFKA 2X00A 3U8KA 2BG9B 4BQTA 5AINA 4IREA 4DBMA 2XQ3A 3TLUA 4TWFA 3TLVA 2BYPA 5HEJA 5J5IA 4LMKA 3JAEA 4ILCA 4UM1A 5HEUA 2XQ4A 2XZ6A 4QAAA 5LXBA 2Y7YA 2WZYA 3C84A 2C9TA 2BG9E 5AFMB 3RQWA 3TLWA 4HFEA 5CO5A 2Y54A 1UW6A 3TLTA 3UU5A 3WIPA 4AFTA 4UM3S 4IL4A 4A98A 3RHWA 2XQ5A 3GUAA 3T4MA 3WTJA 1UX2A 5AFJA 4QH5A 2ZJVA 4Z90A 3U8JA 4NZBA 4B5DA 5SYOA 2BYNA 5CFBA 3U8NA 1I9BA 2XNVA 2BR8A 3JADA 2QC1B 3WTIA 4X5TA 4HFBA 5HCMA 5AFNA 5FJVA 2XNUA 2XYSA 4HFDA 5BP0A 4LMLA 5IUXA 4ILAA 2BR7A 3U8LA 2YOEA 5BRXA 4HFIA 4AFHA 5HEGA 4D01A 2Y56A 4ZZCA 2XQAA 2BJ0A 2BYQA 5JMEA 3UQ7A 4QACA 5KZUA 3IGQA 4HFCA 5BW2A 2YKSA 2UZ6A 5L47A 4UXUA 3TLSA 3RI5A 3UU6A 2XQ6A 2X00D 2PGZA 4IL9A 4LMJA 4QH4A 5TVCA 3SIOA 3WTKA 3WTNA 5AFLA 5KE4A 4ZJTA 4ZRUA 5J5GA 3PEOA 3P50A 3UUBA 2XQ8A 2BYRA 4TWHA 3LSVA 4HFHA 3UU3A 4A97A 4BFQA 4AFGA 4ZR6A 4PIRA 4XK9A 3EHZA 2W8FA 2WNJA 5L4HA 3ZDGA 3RIAA 4UM3A 3C79A
chains in the Genus database with same CATH superfamily
5J0ZA 4WV9A 5HEOA 4QABA 4F8HA 2PH9A 2WN9A 2XNTA 5HCJA 2XQ7A 2W8GA 2YMEA 4EZ1A 5J5HA 3SQ9A 4TNWA 4UM3P 4XHEA 2VL0A 5HEHA 4COFA 5LG3A 2YMDA 3WTLA 3EAMA 3WTMA 2Y58A 5AFMA 4ZJSA 2WNCA 4TWDA 3WTHA 3PMZA 3U8MA 2BYSA 3SQ6A 3UU8A 2XZ5A 2YN6A 1UV6A 4ZK1A 2WNLA 4FRRA 4HQPA 4QH1A 3ZKRA 3SH1A 4ZZBA 2BG9A 5AFHA 5J5FA 2BG9C 4ILBA 4Z91A 3UU4A 3ZDHA 4TNVA 2ZJUA 4UY2A 3P4WA 2XYTA 3EI0A 3RQUA 3WTOA 4NPPA 3RIFA 3JAFA 3UQ4A 4ALXA 4ZK4A 5L4EA 2XQ9A 2Y57A 5AFKA 2X00A 3U8KA 2BG9B 4BQTA 5AINA 4IREA 4DBMA 2XQ3A 3TLUA 4TWFA 3TLVA 2BYPA 5HEJA 5J5IA 4LMKA 3JAEA 4ILCA 4UM1A 5HEUA 2XQ4A 2XZ6A 4QAAA 5LXBA 2Y7YA 2WZYA 3C84A 2C9TA 2BG9E 5AFMB 3RQWA 3TLWA 4HFEA 5CO5A 2Y54A 1UW6A 3TLTA 3UU5A 3WIPA 4AFTA 4UM3S 4IL4A 4A98A 3RHWA 2XQ5A 3GUAA 3T4MA 3WTJA 1UX2A 5AFJA 4QH5A 2ZJVA 4Z90A 3U8JA 4NZBA 4B5DA 5SYOA 2BYNA 5CFBA 3U8NA 1I9BA 2XNVA 2BR8A 3JADA 2QC1B 3WTIA 4X5TA 4HFBA 5HCMA 5AFNA 5FJVA 2XNUA 2XYSA 4HFDA 5BP0A 4LMLA 5IUXA 4ILAA 2BR7A 3U8LA 2YOEA 5BRXA 4HFIA 4AFHA 5HEGA 4D01A 2Y56A 4ZZCA 2XQAA 2BJ0A 2BYQA 5JMEA 3UQ7A 4QACA 5KZUA 3IGQA 4HFCA 5BW2A 2YKSA 2UZ6A 5L47A 4UXUA 3TLSA 3RI5A 3UU6A 2XQ6A 2X00D 2PGZA 4IL9A 4LMJA 4QH4A 5TVCA 3SIOA 3WTKA 3WTNA 5AFLA 5KE4A 4ZJTA 4ZRUA 5J5GA 3PEOA 3P50A 3UUBA 2XQ8A 2BYRA 4TWHA 3LSVA 4HFHA 3UU3A 4A97A 4BFQA 4AFGA 4ZR6A 4PIRA 4XK9A 3EHZA 2W8FA 2WNJA 5L4HA 3ZDGA 3RIAA 4UM3A 3C79A
chains in the Genus database with same CATH topology
5J0ZA 4WV9A 5HEOA 4QABA 4F8HA 2PH9A 2WN9A 2XNTA 5HCJA 2XQ7A 2W8GA 2YMEA 4EZ1A 5J5HA 3SQ9A 4TNWA 4UM3P 4XHEA 2VL0A 5HEHA 4COFA 5LG3A 2YMDA 3WTLA 3EAMA 3WTMA 2Y58A 5AFMA 4ZJSA 2WNCA 4TWDA 3WTHA 3PMZA 3U8MA 2BYSA 3SQ6A 3UU8A 2XZ5A 2YN6A 1UV6A 4ZK1A 2WNLA 4FRRA 4HQPA 4QH1A 3ZKRA 3SH1A 4ZZBA 2BG9A 5AFHA 5J5FA 2BG9C 4ILBA 4Z91A 3UU4A 3ZDHA 4TNVA 2ZJUA 4UY2A 3P4WA 2XYTA 3EI0A 3RQUA 3WTOA 4NPPA 3RIFA 3JAFA 3UQ4A 4ALXA 4ZK4A 5L4EA 2XQ9A 2Y57A 5AFKA 2X00A 3U8KA 2BG9B 4BQTA 5AINA 4IREA 4DBMA 2XQ3A 3TLUA 4TWFA 3TLVA 2BYPA 5HEJA 5J5IA 4LMKA 3JAEA 4ILCA 4UM1A 5HEUA 2XQ4A 2XZ6A 4QAAA 5LXBA 2Y7YA 2WZYA 3C84A 2C9TA 2BG9E 5AFMB 3RQWA 3TLWA 4HFEA 5CO5A 2Y54A 1UW6A 3TLTA 3UU5A 3WIPA 4AFTA 4UM3S 4IL4A 4A98A 3RHWA 2XQ5A 3GUAA 3T4MA 3WTJA 1UX2A 5AFJA 4QH5A 2ZJVA 4Z90A 3U8JA 4NZBA 4B5DA 5SYOA 2BYNA 5CFBA 3U8NA 1I9BA 2XNVA 2BR8A 3JADA 2QC1B 3WTIA 4X5TA 4HFBA 5HCMA 5AFNA 5FJVA 2XNUA 2XYSA 4HFDA 5BP0A 4LMLA 5IUXA 4ILAA 2BR7A 3U8LA 2YOEA 5BRXA 4HFIA 4AFHA 5HEGA 4D01A 2Y56A 4ZZCA 2XQAA 2BJ0A 2BYQA 5JMEA 3UQ7A 4QACA 5KZUA 3IGQA 4HFCA 5BW2A 2YKSA 2UZ6A 5L47A 4UXUA 3TLSA 3RI5A 3UU6A 2XQ6A 2X00D 2PGZA 4IL9A 4LMJA 4QH4A 5TVCA 3SIOA 3WTKA 3WTNA 5AFLA 5KE4A 4ZJTA 4ZRUA 5J5GA 3PEOA 3P50A 3UUBA 2XQ8A 2BYRA 4TWHA 3LSVA 4HFHA 3UU3A 4A97A 4BFQA 4AFGA 4ZR6A 4PIRA 4XK9A 3EHZA 2W8FA 2WNJA 5L4HA 3ZDGA 3RIAA 4UM3A 3C79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J0Z A;  4WV9 A;  5HEO A;  4QAB A;  4F8H A;  2PH9 A;  2WN9 A;  2XNT A;  5HCJ A;  2XQ7 A;  2W8G A;  2YME A;  4EZ1 A;  5J5H A;  3SQ9 A;  4TNW A;  4UM3 P;  4XHE A;  2VL0 A;  5HEH A;  4COF A;  5LG3 A;  2YMD A;  3WTL A;  3EAM A;  3WTM A;  2Y58 A;  5AFM A;  4ZJS A;  2WNC A;  4TWD A;  3WTH A;  3PMZ A;  3U8M A;  2BYS A;  3SQ6 A;  3UU8 A;  2XZ5 A;  2YN6 A;  1UV6 A;  4ZK1 A;  2WNL A;  4FRR A;  4HQP A;  4QH1 A;  3ZKR A;  3SH1 A;  4ZZB A;  2BG9 A;  5AFH A;  5J5F A;  2BG9 C;  4ILB A;  4Z91 A;  3UU4 A;  3ZDH A;  4TNV A;  2ZJU A;  4UY2 A;  3P4W A;  2XYT A;  3EI0 A;  3RQU A;  3WTO A;  4NPP A;  3RIF A;  3JAF A;  3UQ4 A;  4ALX A;  4ZK4 A;  5L4E A;  2XQ9 A;  2Y57 A;  5AFK A;  2X00 A;  3U8K A;  2BG9 B;  4BQT A;  5AIN A;  4IRE A;  4DBM A;  2XQ3 A;  3TLU A;  4TWF A;  3TLV A;  2BYP A;  5HEJ A;  5J5I A;  4LMK A;  3JAE A;  4ILC A;  4UM1 A;  5HEU A;  2XQ4 A;  2XZ6 A;  4QAA A;  5LXB A;  2Y7Y A;  2WZY A;  3C84 A;  2C9T A;  2BG9 E;  5AFM B;  3RQW A;  3TLW A;  4HFE A;  5CO5 A;  2Y54 A;  1UW6 A;  3TLT A;  3UU5 A;  3WIP A;  4AFT A;  4UM3 S;  4IL4 A;  4A98 A;  3RHW A;  2XQ5 A;  3GUA A;  3T4M A;  3WTJ A;  1UX2 A;  5AFJ A;  4QH5 A;  2ZJV A;  4Z90 A;  3U8J A;  4NZB A;  4B5D A;  5SYO A;  2BYN A;  5CFB A;  3U8N A;  1I9B A;  2XNV A;  2BR8 A;  3JAD A;  2QC1 B;  3WTI A;  4X5T A;  4HFB A;  5HCM A;  5AFN A;  5FJV A;  2XNU A;  2XYS A;  4HFD A;  5BP0 A;  4LML A;  5IUX A;  4ILA A;  2BR7 A;  3U8L A;  2YOE A;  5BRX A;  4HFI A;  4AFH A;  5HEG A;  4D01 A;  2Y56 A;  4ZZC A;  2XQA A;  2BJ0 A;  2BYQ A;  5JME A;  3UQ7 A;  4QAC A;  5KZU A;  3IGQ A;  4HFC A;  5BW2 A;  2YKS A;  2UZ6 A;  5L47 A;  4UXU A;  3TLS A;  3RI5 A;  3UU6 A;  2XQ6 A;  2X00 D;  2PGZ A;  4IL9 A;  4LMJ A;  4QH4 A;  5TVC A;  3SIO A;  3WTK A;  3WTN A;  5AFL A;  5KE4 A;  4ZJT A;  4ZRU A;  5J5G A;  3PEO A;  3P50 A;  3UUB A;  2XQ8 A;  2BYR A;  4TWH A;  3LSV A;  4HFH A;  3UU3 A;  4A97 A;  4BFQ A;  4AFG A;  4ZR6 A;  4PIR A;  4XK9 A;  3EHZ A;  2W8F A;  2WNJ A;  5L4H A;  3ZDG A;  3RIA A;  4UM3 A;  3C79 A; 
#chains in the Genus database with same CATH topology
 5J0Z A;  4WV9 A;  5HEO A;  4QAB A;  4F8H A;  2PH9 A;  2WN9 A;  2XNT A;  5HCJ A;  2XQ7 A;  2W8G A;  2YME A;  4EZ1 A;  5J5H A;  3SQ9 A;  4TNW A;  4UM3 P;  4XHE A;  2VL0 A;  5HEH A;  4COF A;  5LG3 A;  2YMD A;  3WTL A;  3EAM A;  3WTM A;  2Y58 A;  5AFM A;  4ZJS A;  2WNC A;  4TWD A;  3WTH A;  3PMZ A;  3U8M A;  2BYS A;  3SQ6 A;  3UU8 A;  2XZ5 A;  2YN6 A;  1UV6 A;  4ZK1 A;  2WNL A;  4FRR A;  4HQP A;  4QH1 A;  3ZKR A;  3SH1 A;  4ZZB A;  2BG9 A;  5AFH A;  5J5F A;  2BG9 C;  4ILB A;  4Z91 A;  3UU4 A;  3ZDH A;  4TNV A;  2ZJU A;  4UY2 A;  3P4W A;  2XYT A;  3EI0 A;  3RQU A;  3WTO A;  4NPP A;  3RIF A;  3JAF A;  3UQ4 A;  4ALX A;  4ZK4 A;  5L4E A;  2XQ9 A;  2Y57 A;  5AFK A;  2X00 A;  3U8K A;  2BG9 B;  4BQT A;  5AIN A;  4IRE A;  4DBM A;  2XQ3 A;  3TLU A;  4TWF A;  3TLV A;  2BYP A;  5HEJ A;  5J5I A;  4LMK A;  3JAE A;  4ILC A;  4UM1 A;  5HEU A;  2XQ4 A;  2XZ6 A;  4QAA A;  5LXB A;  2Y7Y A;  2WZY A;  3C84 A;  2C9T A;  2BG9 E;  5AFM B;  3RQW A;  3TLW A;  4HFE A;  5CO5 A;  2Y54 A;  1UW6 A;  3TLT A;  3UU5 A;  3WIP A;  4AFT A;  4UM3 S;  4IL4 A;  4A98 A;  3RHW A;  2XQ5 A;  3GUA A;  3T4M A;  3WTJ A;  1UX2 A;  5AFJ A;  4QH5 A;  2ZJV A;  4Z90 A;  3U8J A;  4NZB A;  4B5D A;  5SYO A;  2BYN A;  5CFB A;  3U8N A;  1I9B A;  2XNV A;  2BR8 A;  3JAD A;  2QC1 B;  3WTI A;  4X5T A;  4HFB A;  5HCM A;  5AFN A;  5FJV A;  2XNU A;  2XYS A;  4HFD A;  5BP0 A;  4LML A;  5IUX A;  4ILA A;  2BR7 A;  3U8L A;  2YOE A;  5BRX A;  4HFI A;  4AFH A;  5HEG A;  4D01 A;  2Y56 A;  4ZZC A;  2XQA A;  2BJ0 A;  2BYQ A;  5JME A;  3UQ7 A;  4QAC A;  5KZU A;  3IGQ A;  4HFC A;  5BW2 A;  2YKS A;  2UZ6 A;  5L47 A;  4UXU A;  3TLS A;  3RI5 A;  3UU6 A;  2XQ6 A;  2X00 D;  2PGZ A;  4IL9 A;  4LMJ A;  4QH4 A;  5TVC A;  3SIO A;  3WTK A;  3WTN A;  5AFL A;  5KE4 A;  4ZJT A;  4ZRU A;  5J5G A;  3PEO A;  3P50 A;  3UUB A;  2XQ8 A;  2BYR A;  4TWH A;  3LSV A;  4HFH A;  3UU3 A;  4A97 A;  4BFQ A;  4AFG A;  4ZR6 A;  4PIR A;  4XK9 A;  3EHZ A;  2W8F A;  2WNJ A;  5L4H A;  3ZDG A;  3RIA A;  4UM3 A;  3C79 A; 
#chains in the Genus database with same CATH homology
 5J0Z A;  4WV9 A;  5HEO A;  4QAB A;  4F8H A;  2PH9 A;  2WN9 A;  2XNT A;  5HCJ A;  2XQ7 A;  2W8G A;  2YME A;  4EZ1 A;  5J5H A;  3SQ9 A;  4TNW A;  4UM3 P;  4XHE A;  2VL0 A;  5HEH A;  4COF A;  5LG3 A;  2YMD A;  3WTL A;  3EAM A;  3WTM A;  2Y58 A;  5AFM A;  4ZJS A;  2WNC A;  4TWD A;  3WTH A;  3PMZ A;  3U8M A;  2BYS A;  3SQ6 A;  3UU8 A;  2XZ5 A;  2YN6 A;  1UV6 A;  4ZK1 A;  2WNL A;  4FRR A;  4HQP A;  4QH1 A;  3ZKR A;  3SH1 A;  4ZZB A;  2BG9 A;  5AFH A;  5J5F A;  2BG9 C;  4ILB A;  4Z91 A;  3UU4 A;  3ZDH A;  4TNV A;  2ZJU A;  4UY2 A;  3P4W A;  2XYT A;  3EI0 A;  3RQU A;  3WTO A;  4NPP A;  3RIF A;  3JAF A;  3UQ4 A;  4ALX A;  4ZK4 A;  5L4E A;  2XQ9 A;  2Y57 A;  5AFK A;  2X00 A;  3U8K A;  2BG9 B;  4BQT A;  5AIN A;  4IRE A;  4DBM A;  2XQ3 A;  3TLU A;  4TWF A;  3TLV A;  2BYP A;  5HEJ A;  5J5I A;  4LMK A;  3JAE A;  4ILC A;  4UM1 A;  5HEU A;  2XQ4 A;  2XZ6 A;  4QAA A;  5LXB A;  2Y7Y A;  2WZY A;  3C84 A;  2C9T A;  2BG9 E;  5AFM B;  3RQW A;  3TLW A;  4HFE A;  5CO5 A;  2Y54 A;  1UW6 A;  3TLT A;  3UU5 A;  3WIP A;  4AFT A;  4UM3 S;  4IL4 A;  4A98 A;  3RHW A;  2XQ5 A;  3GUA A;  3T4M A;  3WTJ A;  1UX2 A;  5AFJ A;  4QH5 A;  2ZJV A;  4Z90 A;  3U8J A;  4NZB A;  4B5D A;  5SYO A;  2BYN A;  5CFB A;  3U8N A;  1I9B A;  2XNV A;  2BR8 A;  3JAD A;  2QC1 B;  3WTI A;  4X5T A;  4HFB A;  5HCM A;  5AFN A;  5FJV A;  2XNU A;  2XYS A;  4HFD A;  5BP0 A;  4LML A;  5IUX A;  4ILA A;  2BR7 A;  3U8L A;  2YOE A;  5BRX A;  4HFI A;  4AFH A;  5HEG A;  4D01 A;  2Y56 A;  4ZZC A;  2XQA A;  2BJ0 A;  2BYQ A;  5JME A;  3UQ7 A;  4QAC A;  5KZU A;  3IGQ A;  4HFC A;  5BW2 A;  2YKS A;  2UZ6 A;  5L47 A;  4UXU A;  3TLS A;  3RI5 A;  3UU6 A;  2XQ6 A;  2X00 D;  2PGZ A;  4IL9 A;  4LMJ A;  4QH4 A;  5TVC A;  3SIO A;  3WTK A;  3WTN A;  5AFL A;  5KE4 A;  4ZJT A;  4ZRU A;  5J5G A;  3PEO A;  3P50 A;  3UUB A;  2XQ8 A;  2BYR A;  4TWH A;  3LSV A;  4HFH A;  3UU3 A;  4A97 A;  4BFQ A;  4AFG A;  4ZR6 A;  4PIR A;  4XK9 A;  3EHZ A;  2W8F A;  2WNJ A;  5L4H A;  3ZDG A;  3RIA A;  4UM3 A;  3C79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...