4IL9A

The pentameric ligand-gated ion channel glic a237f in complex with bromide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4il9A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4il9A01
2XQ4A 4UXUA 5KZUA 4IREA 2BR8A 4QABA 4BFQA 3UQ7A 5CFBA 3U8NA 2WNJA 4HFHA 3SQ6A 5LG3A 5AFLA 3IGQA 4Z91A 2BG9A 2YKSA 4QAAA 4HFIA 2XZ6A 4ZK4A 4IL9A 2YOEA 2WN9A 5HCMA 3WTNA 2W8FA 2X00A 2XNTA 4HFCA 3SH1A 2XQ9A 5FJVA 3ZDHA 3P50A 4QH1A 4TWFA 5L4HA 2Y54A 2PH9A 4LMLA 5TVCA 5J5HA 4X5TA 4COFA 2BG9B 2LM2A 5BP0A 5HEHA 4TNVA 3RI5A 3UU5A 2C9TA 5J5GA 4QH5A 4ZJSA 1UV6A 2BYPA 2XQ8A 2WNLA 3T4MA 2YMDA 2BR7A 3U8MA 2BYNA 4D01A 5IUXA 2BG9E 2MAWA 3JAEA 4HFBA 5HEUA 3C79A 2LKGA 1UW6A 3SQ9A 2XNUA 5L47A 4UM3A 1OEDC 4HFEA 5HEOA 2UZ6A 4EZ1A 2VL0A 2Y56A 4AFTA 5L4EA 4Z90A 3EI0A 4A97A 4B5DA 1UX2A 4A98A 5HEJA 3WTMA 4ZZCA 5CO5A 4ZK1A 4TNWA 4UM3P 3WTLA 3ZDGA 5AFNA 3EHZA 2XQ6A 2LKHA 3RIFA 2M6BA 3WTIA 4ALXA 3WTKA 3WTOA 5JMEA 5LXBA 4WV9A 3PMZA 2QC1B 2BYQA 3TLWA 3WTHA 5AFKA 5AFHA 2BYSA 3GUAA 4DBMA 4QACA 3TLTA 5J5IA 2XNVA 2KSRA 5SYOA 3JAFA 2XQAA 5AFJA 1OEDA 3U8LA 5HCJA 2BJ0A 3U8JA 4UM1A 4AFHA 2ZJUA 4ZR6A 3SIOA 2WNCA 3EAMA 2WZYA 4XK9A 4LMKA 3RQWA 5BRXA 3UU6A 4ZZBA 5AFMA 5J0ZA 3RHWA 3JADA 3P4WA 4TWDA 1OEDB 2Y58A 2YMEA 4QH4A 4BQTA 4XHEA 3TLVA 4ILAA 4NPPA 2XQ3A 2XYTA 4UY2A 3TLSA 5AFMB 3UU3A 2XYSA 3UUBA 3C84A 4TWHA 5HEGA 4ILCA 4UM3S 1OEDE 5J5FA 4AFGA 3PEOA 4ILBA 4PIRA 2BG9C 4HQPA 3WIPA 3TLUA 2XQ5A 4FRRA 3LSVA 2M6IA 5KE4A 4ZRUA 4IL4A 3RIAA 2LLYA 2BYRA 2PGZA 3WTJA 2ZJVA 3UU4A 4NZBA 3U8KA 4ZJTA 3RQUA 3UQ4A 2Y7YA 4HFDA 1I9BA 2X00D 2Y57A 3UU8A 4LMJA 2W8GA 2XZ5A 5BW2A 4F8HA 5AINA 2XQ7A 3ZKRA 2YN6A
chains in the Genus database with same CATH superfamily
5JVDE 4ZI7E 5JR9C 4MFRA 2CE7A 2I6HA 2BG9A 2H89A 4QAAA 4IDNA 5JDQA 4DR5T 4DV1T 2OV9A 2UUAT 3U78A 2W63A 4CXYA 3KBUA 2BYPA 2WS3A 4WYVA 3T4MA 5FY7A 3AAAB 2VURA 4JBWF 3HKCE 4YHJA 3KV9A 2JPFA 5F8PA 4FI5A 3WAJA 3RYIE 3P8CD 3CWZB 2VL0A 4E7SA 4A56A 3WTLA 5AQNB 2LKHA 1U5PA 2W00A 4G63A 1J1JA 4GK5E 4X65T 2LM9A 2C5JA 5KX5E 4DBMA 4Q25A 3J7Yq 5JDHA 3PURA 3VRBA 2UU9T 5DJQC 4AFHA 4HFVA 3LK2B 3RH3A 2WNCA 4U33A 5LGUB 4P0BA 5ABFA 4QH4A 2JJ9A 4ZI3D 4LFBT 2IDOB 3N5LA 2WMNA 4TWHA 2QA7A 4I43B 3GMIA 4YTPA 4PIRA 2FJEA 4X64T 2XQ5A 5KE4A 3RGLA 3WTJA 4XZCA 2IMLA 5AQOB 4GOUA 4EZHA 4B3TT 2BVLA 3ZC1A 2D9DA 1FMVA 4DV4T 2LOSA 4BJMA 5H6RB 1N36T 4DMWA 3ESLA 2XQ4A 2JQHA 3LBXB 3UUNA 3N9OA 3AA6B 1HNXT 4HFIA 2XZ6A 2WN9A 4JI3T 5FY1A 1L0VA 2LM2A 2XAQB 5JTGA 4NUVA 3UU5A 2G0UA 3G06A 2UXDT 3PUVF 2X0HA 1YD8G 3U8MA 4LF8T 2BDEA 4U3CA 2VKJA 3ZYMA 2LKGA 4B3MT 4EZ1A 4CXWA 5F5WA 3AA1B 4PJJA 2KMFA 4A97A 5LMNT 2IUBA 3WTMA 1HX8A 5FP3A 2ZM0A 3P4RA 1FEWA 1JNZA 2XM2A 3WTHA 2MBGA 4KP3C 3TLTA 4PJMA 4GKKT 2LHNA 3ONLC 4IGUA 2BKPA 2WB5A 3SFEA 2H3RA 3FBLA 5J0ZA 4CI1B 1XNQT 5FY0A 1KNZA 2X51A 4MBQA 4L9IA 4CI2B 2D5UA 4ILBA 3KVBA 2RPAA 3HA4A 4FJOA 3RLFF 3LBXA 3K3QC 2K5BB 3UQ4A 2WZIA 4LF6T 5AQLB 2LT3A 3NKZA 3ZT7A 4I4TE 2CEAA 2KT9A 3ZMZB 3LJCA 4HFHA 1Y64B 1EZ3A 4UR9A 5FXXA 1IBKT 3WTNA 2X00A 3S4UA 3C64A 3M3ZB 2CM0A 2WSSV 5J5GA 1MNDA 4ZJSA 3L39A 2EHOB 3AECA 4U2ZA 5LJNA 2BG9E 5LG4A 3MA9A 3CVRA 3AEFA 2A2FX 3IF8B 2Y56A 4HKAA 4IT4A 4HWFA 5L3EB 5JQGE 4WBOA 4B5DA 4L0RA 5AFUL 3CQGB 5LOVE 1XWMA 3QNUA 1WRDA 4EEDA 3RKGA 2BYSA 4DMVA 4DR6T 2K48A 3ZJ2A 3UT5E 2ACXA 4ZR6A 2WZYA 4JV5T 1D1BA 2DHRA 3DP7A 1AJ3A 5FXVA 2CLYB 2LSJA 4DR3T 5LBQB 3TLSA 3ZN0B 2LRKA 3N2GE 2BG9C 3WIPA 5AQHB 2Q9QD 3L09A 4YLHA 5C8YE 4JI5T 4XAXB 2YDSA 4JI2T 3W15B 1BR1A 3UQ7A 4DO0A 4TV9E 4LF7T 4ILUA 3GN5B 3BK9A 5HCMA 2EHOA 4A5XA 3MJXA 3I0QA 3OYXA 5EK3A 4TNVA 2W2UA 4OYKA 3PUZF 2BYNA 3KBTA 4P1NA 5JDMA 4UIGA 3PUXF 2V5DA 2CBIA 5HEOA 2I0MA 5L4EA 2CBJA 2WZHA 3NVOA 5CO5A 4NUUA 2PTFA 3ABVA 3ONXA 4DIDB 1WFDA 2X0LB 3H37A 2WU5A 5F3JA 3RYFE 2CHOA 1YW0A 4P09A 3AEDA 1IJ6A 2CWOA 2XQAA 2VWAA 2ZJUA 2L8KA 3N9LA 4BQTA 2WM9A 4EB6E 5FVKA 3HI2A 3U3IA 3T1YT 4GKJT 3VKHA 5HEGA 4AFGA 3AVSA 1MIVA 5LYJE 2FBWA 2W66A 5LBMA 2XHEB 2W0GA 2NW9A 2PGZA 2A72A 3VR8A 4ZOLE 3GN5A 5FXZA 2WDVA 3QK6A 4H9NC 4F8HA 2M67A 3AE9A 2HH7A 3AVRA 4IREA 3HKDE 3A7MA 3MK7C 5ABHA 2LJLA 4O4LE 3L8RA 1W0BA 4AQFC 2XPKA 2N9DA 1J5ET 2V5CA 2FUPA 4ZXLA 5TVCA 2DL1A 1IZNB 5FYMA 3FZMB 3CPZA 5JREA 1QUUA 3BQIA 3UFEA 4LFCT 2XNUA 4HFEA 4YT0A 4HTEA 4UEMA 4AFTA 2WCAA 1UX2A 3Q2MA 1ZOYA 2DI4A 4CZZB 4DBQA 4ALXA 3L3PA 3SS1A 2X68A 3JAFA 4GYSA 3ZJ1A 2WWUA 2C5IT 1WR0A 1MMGA 3FZLB 3CMLA 3ZN1B 4AKIA 2PG8A 4HWHA 5FXWA 3I0OA 4ILAA 5AQQB 4NIQA 2XAGB 2CXLA 2HPLA 2QGSA 3K3OA 4ZRUA 4G2AA 3U8KA 4ZJTA 2NWBA 3CX7B 2VQFT 5AINA 3AA0B 4P0AA 2UXBT 1B7TA 4AISA 1T7SA 2XZEA 3HR0A 3AE7A 2YKSA 3M65A 4ZK4A 4U7IA 2JQ9A 4PJNA 5L4HA 3H3AA 4AKHA 1J5WA 2WDQA 5HEHA 3PU3A 4QHOA 4ERRA 1SUMB 2MAWA 2JIWA 1Y01A 3A5XA 3VRAA 1UW6A 1MIWA 3QB5A 5FL1A 2E9XD 3ZT5A 2RP4A 3VU7H 2CXDA 2D2SA 4HWDA 3ZYKA 3WTIA 3WTKA 3CX8B 1ZEEA 4GYRA 3HKBE 2YK0A 2XAFB 2SPCA 1UX5A 4TUYE 2OLTA 2X0YA 2W67A 3OTOT 3T8OA 3PDYA 4TV8E 5BRXA 1IBMT 2W62A 4U72A 5EZYE 2PJQA 1T98A 1IBLT 1OWAA 2NP9A 3Q5DA 3MXZA 1KNRA 2XSBA 2J47A 3F31A 1T72A 4B3RT 4FRRA 2M6IA 5BP0A 2BS2A 2EHOC 2CCQA 3UUMA 4PJLA 4JYAT 4B6XA 1SHZC 2ODUA 3NRXA 4QABA 4AXPA 4PFPA 1S94A 3SQ6A 2YDRA 2CMRA 5JRCB 1QLBA 4IL9A 1MMAA 4HFCA 5CA1E 4KHPT 3PUWF 4ZI2D 1ZV4X 3OVUA 5LHGB 1XMQT 3AE3A 1XZYA 4CI3B 5HYAA 2WNLA 5C2TA 4JEHB 4EIWA 3AAIA 2CLYC 4KHZF 3LFMA 3ZEFB 4OHFA 3RC8A 4Z90A 4UV9B 4QX8B 1BR4A 2MTQA 3LK3B 4UVAB 2OA5A 5ADXL 1W09A 2ES0A 3TLWA 2V26A 4Z8XA 4U2YA 2XNVA 4AQFA 5LCYA 5CGMA 3QC9A 1VRBA 3O1JA 2E8IA 3NZQA 5HWXA 2NTYA 5TAOA 3RYCE 2BZBA 3CQCB 2V6XA 4XHEA 4JI8T 4DR4T 3OBVE 2DWGA 2BKNA 3B57A 3EDVA 4LF9T 2AXDS 5LHIB 2ACZA 2H7OA 3HKEE 4QXBB 5AQKB 4H9PC 1LVKA 2C5KT 3RQUA 4O2BE 3ETVA 4HFDA 4I50E 3UU8A 4LMJA 5JRCA 5DABA 4L5GA 5HXRA 4I55E 2JRKA 2V1DB 2LE8A 1UX4A 4IHJE 4JEUB 2LHRA 1Z8UA 3Q5EA 5FJVA 3O1HA 4MHCA 2KWIB 3DJBA 5AQFB 5J2TE 5AQUB 2BR7A 1E2AA 2GK9A 4HFBA 1G73A 3WAKA 4CN6A 3CKDA 3QB5K 4AKLA 2B76A 4ZK1A 4TNWA 1XNRT 4WNKA 5AFNA 2VK9A 2HN1A 4CN1A 4EEBA 5JMEA 5LXBA 1WLXA 3GUAA 1HCIA 4JLEA 3LK42 1IAPA 3O4XE 1D0YA 5HXEA 3F57A 5HCJA 3N9QA 1WYBA 2WAUA 3PUGA 4LMKA 1KFYA 2EHOD 4JUYA 1FMWA 4IDPA 1XDOA 5BR8T 1SE7A 4DUYT 2NOXA 3N2OA 3UUBA 1CUNA 3E22E 4YTMA 2W61A 3RX6A 2KZ7B 4DV6T 4UELA 4HGAA 4HWIB 4IE0A 2XY8B 3FZHB 1BR2A 3ZKRA 1D1CA 2FJBA 3P4SA 4ZS2A 5HXSA 2VKOA 4JI6T 5LG3A 4M1PA 1O3XA 1WCRA 2F4VT 4TZ4C 1UK5A 2ZMAA 5ETWA 1FIOA 3GWHA 4QH1A 4TWFA 2IIUA 2LOPA 2Q9QB 1M62A 4DR2T 3SFDA 2VKDA 2HPJA 4BA9A 2JQKA 3OJAA 3AE6A 3OPCA 4EZ4A 1US7B 3IEEA 2QVAA 2VB6A 3KVAA 4ZZCA 3PJAJ 4KI0F 2XQ6A 3WTOA 3MACA 2BYQA 5AFKA 2JMKA 3AXJB 1HR0T 1YQ4A 3N9MA 4ZZBA 4QXHB 4MLKA 5LGTB 3RIUC 2VVNA 4O8SA 3SOLA 4KX6A 2X9YA 4JI7T 4ILCA 4UM3S 5FKYA 1KF6A 4UVBB 3J9X1 3LSVA 1YKEB 1OXZA 4H9RC 4LF4T 4PNIA 4YSYA 2BBHA 4UXUA 3KINB 1H7CA 2Q9QA 5AFLA 3LDQB 2V6YB 2ZLYA 4CQIA 1VOMA 5KDMC 3ZDHA 4IE5A 1N34T 3CX6B 2Y54A 1V9DA 5CA0E 5DQWA 2CPTA 2C9TA 4YJ3E 4O4JE 3CK6A 3ZMUB 2HN2A 3F2EA 2ZM8A 2VL8A 5LA6E 3C79A 2XTLA 4AKRB 4UM3A 2D0UA 3QOFA 3RRWA 4EV6A 3H3MA 4H63V 1UGOA 1R8IA 5ABEA 4E7ZA 2WMOA 4UM3P 4WW0A 4AQGA 2E5VA 3AXJA 3EHZA 3VKGA 3JC6C 3RKOA 2E2AA 4AI6A 2KSRA 5E0OA 1HNZT 5LHHB 1KK7A 3KFWX 2XM1A 3EAMA 3Q5XA 4XK9A 1ZP0A 4ZI3C 2K24A 4H9SE 3JADA 1OEDB 2N2NA 2XQ3A 5LGNB 2X67A 2XYTA 1D1AA 5J5FA 2V8SV 3AA7B 3RPUA 2HHHT 2YINA 2J62A 2LLYA 3UUXB 4EYYR 3HL6A 3UU4A 4V1Av 3ZMSB 1M7KA 2XZ5A 4C90A 1MMNA 2WQYA 2XQ7A 3C4WA 2YN6A 3ANWB 2V6YA 1N33T 4B3ST 3PUSA 1VCTA 3AB3B 3DTOA 3SRZA 3IGQA 2LRLA 3P50A 5HXCA 5J5HA 2DWKA 3B13A 4YTNA 4LFAT 3UULA 3CQXC 2NW8A 2Y6XA 4QWNB 3AE4A 4IIJE 5HAXA 3P4PA 2YMDA 4QKNA 4ZEYA 3JAEA 4YSZA 2FJAA 4YHHT 3PUYF 5LJMA 5M4YA 3P7IA 4ADZA 3AE8A 3C50A 2VQET 4UV8B 3ZC0A 3AE1A 4O4IE 2E5LT 3ZSTA 3PMZA 4OX9T 3X1DA 5AFHA 4DNDA 2XASB 1MIYA 2J1DG 2B1EA 1OEDA 3U8LA 4NXMT 5J2UE 2DCFA 2E9XB 2A9UA 2BKOA 3Q9DA 4X1YE 3EUHA 2VVSA 2XAHB 3KV5A 3TLVA 2LSGA 2D0TA 1DU2A 4I0UA 3UTKA 3N9NA 2XSAA 3VHLA 4BJNA 2A3DA 1W0AA 3ANWA 5IWAT 5DQVA 4KMCA 3FXEB 3RIAA 2Y7YA 3EVYA 3K3NA 5AQGB 2KINB 3KDSE 4JI4T 5KZUA 2BR8A 2WY2A 5AQPB 3U8NA 4PAGA 4IDQA 3PV0F 4Z91A 3FXDB 2WU2A 1CHUA 2UXCT 5FNVE 2WP9A 2XJ7A 2X9HA 3ZT6A 1LRZA 4X5TA 2CRBA 3RIUA 4U7YA 5HXHA 2XAJB 2X9XA 4J2CA 4X1IE 1U4QA 3RC3A 3AEGA 5IUXA 4PK6A 4X1KE 3JC6D 3UFGA 5KXJA 5GONE 5LMUT 5ABGA 3N2KE 1D0XA 2YEVC 4WBNE 5AQRB 4QXCB 4ASKA 2DLRA 5HEJA 2XUEA 3ZDGA 2NW7A 2XQYA 1S35A 1QSDA 2Y8DA 4YJ2E 2E9XA 4CXXA 3BQKA 3PJAA 1YKHB 4X20E 5AFJA 5AQVB 3SIOA 2H88A 4ISSA 3IBPA 4TWDA 5L2LA 1HFAA 4NPPA 4UY2A 2UUBT 4BAYB 4EGWA 5AFMB 2Q9QC 5L3DB 2K9AA 5AQTB 3ZCJA 2WWVA 4HEAA 4ZS3A 4JI0T 4IL4A 2ZJVA 3Q5WA 4DV0T 2IC9A 1I9BA 2X00D 2Y57A 4X62T 4K0KT 5CB4E 1UUSA 3BQLA 4IE6A 4UF0B 2YOEA 5IHYA 2XQ9A 4GIWA 5L3CB 3ZMVB 3FB2A 2PH9A 4ANJA 3ZMTB 2L9QA 3NRYA 5J1GA 4H63H 3PTRB 1NWMX 2FJDA 1HG2A 1FJGT 2JQQA 3PUQA 3CIRA 4U74A 1VCSA 3SQ9A 4TN7B 5JR9B 1HNWT 3R6NA 5L3GB 4N78D 3EI0A 3LG7A 3V5UA 1ZKEA 5LB7B 4A98A 1KNPA 3P4QA 3C98B 3R84B 2K3WA 1X79A 5AQSB 1ZHCA 4OFZA 4GK0E 4IDOA 2UXXB 1HX1B 2MOZA 5AQMB 3EDUA 4AIUA 4DV2T 2I59A 4YSXA 5AFMA 2Y58A 3C51A 4IDZA 2DNXA 3C84A 3ONJA 2X66A 4OK0A 1OEDE 3PEOA 4HQPA 3FZFB 2NTXA 2UXNB 5BMVE 4NZBA 1Z0PA 3E08A 5JH7E 3RF1A 3A8YC 1BR0A 2W4XA 4UF0A 1IJ5A 1KEYA 2CXFA 2IW5B 3K1SA 4UVCB 3OYZA 4IE4A 2LSIA 4ZHQE 3GA8A 4XBFB 4KBMB 1W9RA 2W8FA 2XNTA 3ZPOA 2CWYA 4LF5T 1XMOT 2VKHA 3AE5A 2H7VC 4COFA 4O4HE 4QH5A 5JDFA 3WI3A 3B5MA 5JR9A 2XQ8A 4HWCA 1E7PA 3K8PC 2QYWA 2VASA 3IA3A 2LSYA 1OEDC 2UZ6A 1G8XA 3TKLB 2KNDA 3RRCA 3NWIA 2UUCT 2V7IA 5FMNA 3RIFA 2RA1A 1X9BA 4WZXA 2QC1B 4ISTA 4YXDA 5IYZE 3AE2A 3NBXX 1UCUA 2BJ0A 1N32T 1LKXA 5FL0A 3EABA 3UU6A 4C91A 3FBZA 3RHWA 5CJ5A 4DR1T 2YMEA 3FZKB 2QRXA 2PBIA 5LNKA 4DR7T 4YY3T 3C4ZA 4DBRA 4TX5A 4F6RC 1D0ZA 1I6ZA 5LXTE 1GQEA 4H9OC 2YU2A 3TLUA 4CN4A 4NXNT 4KUMB 2MPKA 4U31A 3ZYLA 1NEKA 2L3LA 2BYRA 3I9WA 3PE0A 2N1GA 4PFOA 4DV5T 5CFBA 4EOZB 4AKGA 2AE9A 3AEEA 5A1LA 3SH1A 1YXRA 4DV3T 2CA5A 3RI5A 4UXNB 2IHR1 1WR6A 5AQIB 5JDLA 4X66T 2BS3A 2E9XC 5JDGA 3PUAA 1NENA 1HF8A 2V7KA 2YU1A 3C4XA 3O9XA 4EAHA 1NAFA 2X9WA 2M6BA 2JMHA 3MKDA 4O2AE 4IE7A 5KMGP 3FHNA 4QACA 5L3FB 2IAKA 4UM1A 5JDNA 5HWYA 3RQWA 1XDPA 1HS7A 4EYUA 5C3JA 3ZCIA 3T1HT 2XYSA 3AEAA 3IHRA 3E0ZA 2YDQA 5LP6E 3NZPA 1MMDA 3SWHA 2Z6EA 2ZM6T 3V5SA 2BBJA 2IC6A 3KV6A 3ETUA 4PW8A 5BW2A 2V7JA 4BFQA 2WDRA 4K0UA 4HE8A 2WNJA 3I9YA 4DVDA 4AQYT 2C0SA 1E1HB 4ZI2C 4JI1T 2LSKA 2CHNA 2LEHA 2ZM2A 1I94T 4HN9A 4QX7B 2KXPB 4LMLA 3N9PA 2BG9B 2ODVA 1UURA 2NR4A 1WYCA 3AEBA 3ZLIA 2Y48B 1UV6A 2BVMA 3I1AA 3OKQA 4D01A 3O1IA 4DUZT 2R6GF 5HEUA 2V7LA 5L47A 1HTJF 3JCFA 5L3BB 4DV7T 2PFVA 3D0TA 1SA0E 4WV9A 5FVLA 4H9QC 1MNEA 5J5IA 5SYOA 5EK2A 4MALA 3U8JA 4YFSA 3RYHE 5H6QB 3P4WA 2MYSA 3KV4A 4PK5A 2BS4A 2WBLA 3VR9A 3UU3A 3QUJA 4EXTA 5ABFB 2V7MA 1HG5A 3PU8A 3ZSSA 2KWHA 2P9BA 2KLQA 2J4GA 1JNRA 3MZKB 1LVFA 3AAEB 5AQJB 1T8BA 4OYJA 2W8GA 1YQ3A 4PK4A 5EK4A
chains in the Genus database with same CATH topology
2XQ4A 4UXUA 5KZUA 4IREA 2BR8A 4QABA 4BFQA 3UQ7A 5CFBA 3U8NA 2WNJA 4HFHA 3SQ6A 5LG3A 5AFLA 3IGQA 4Z91A 2BG9A 2YKSA 4QAAA 4HFIA 2XZ6A 4ZK4A 4IL9A 2YOEA 2WN9A 5HCMA 3WTNA 2W8FA 2X00A 2XNTA 4HFCA 3SH1A 2XQ9A 5FJVA 3ZDHA 3P50A 4QH1A 4TWFA 5L4HA 2Y54A 2PH9A 4LMLA 5TVCA 5J5HA 4X5TA 4COFA 2BG9B 2LM2A 5BP0A 5HEHA 4TNVA 3RI5A 3UU5A 2C9TA 5J5GA 4QH5A 4ZJSA 1UV6A 2BYPA 2XQ8A 2WNLA 3T4MA 2YMDA 2BR7A 3U8MA 2BYNA 4D01A 5IUXA 2BG9E 2MAWA 3JAEA 4HFBA 5HEUA 3C79A 2LKGA 1UW6A 3SQ9A 2XNUA 5L47A 4UM3A 1OEDC 4HFEA 5HEOA 2UZ6A 4EZ1A 2VL0A 2Y56A 4AFTA 5L4EA 4Z90A 3EI0A 4A97A 4B5DA 1UX2A 4A98A 5HEJA 3WTMA 4ZZCA 5CO5A 4ZK1A 4TNWA 4UM3P 3WTLA 3ZDGA 5AFNA 3EHZA 2XQ6A 2LKHA 3RIFA 2M6BA 3WTIA 4ALXA 3WTKA 3WTOA 5JMEA 5LXBA 4WV9A 3PMZA 2QC1B 2BYQA 3TLWA 3WTHA 5AFKA 5AFHA 2BYSA 3GUAA 4DBMA 4QACA 3TLTA 5J5IA 2XNVA 2KSRA 5SYOA 3JAFA 2XQAA 5AFJA 1OEDA 3U8LA 5HCJA 2BJ0A 3U8JA 4UM1A 4AFHA 2ZJUA 4ZR6A 3SIOA 2WNCA 3EAMA 2WZYA 4XK9A 4LMKA 3RQWA 5BRXA 3UU6A 4ZZBA 5AFMA 5J0ZA 3RHWA 3JADA 3P4WA 4TWDA 1OEDB 2Y58A 2YMEA 4QH4A 4BQTA 4XHEA 3TLVA 4ILAA 4NPPA 2XQ3A 2XYTA 4UY2A 3TLSA 5AFMB 3UU3A 2XYSA 3UUBA 3C84A 4TWHA 5HEGA 4ILCA 4UM3S 1OEDE 5J5FA 4AFGA 3PEOA 4ILBA 4PIRA 2BG9C 4HQPA 3WIPA 3TLUA 2XQ5A 4FRRA 3LSVA 2M6IA 5KE4A 4ZRUA 4IL4A 3RIAA 2LLYA 2BYRA 2PGZA 3WTJA 2ZJVA 3UU4A 4NZBA 3U8KA 4ZJTA 3RQUA 3UQ4A 2Y7YA 4HFDA 1I9BA 2X00D 2Y57A 3UU8A 4LMJA 2W8GA 2XZ5A 5BW2A 4F8HA 5AINA 2XQ7A 3ZKRA 2YN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ4 A;  4UXU A;  5KZU A;  4IRE A;  2BR8 A;  4QAB A;  4BFQ A;  3UQ7 A;  5CFB A;  3U8N A;  2WNJ A;  4HFH A;  3SQ6 A;  5LG3 A;  5AFL A;  3IGQ A;  4Z91 A;  2BG9 A;  2YKS A;  4QAA A;  4HFI A;  2XZ6 A;  4ZK4 A;  4IL9 A;  2YOE A;  2WN9 A;  5HCM A;  3WTN A;  2W8F A;  2X00 A;  2XNT A;  4HFC A;  3SH1 A;  2XQ9 A;  5FJV A;  3ZDH A;  3P50 A;  4QH1 A;  4TWF A;  5L4H A;  2Y54 A;  2PH9 A;  4LML A;  5TVC A;  5J5H A;  4X5T A;  4COF A;  2BG9 B;  2LM2 A;  5BP0 A;  5HEH A;  4TNV A;  3RI5 A;  3UU5 A;  2C9T A;  5J5G A;  4QH5 A;  4ZJS A;  1UV6 A;  2BYP A;  2XQ8 A;  2WNL A;  3T4M A;  2YMD A;  2BR7 A;  3U8M A;  2BYN A;  4D01 A;  5IUX A;  2BG9 E;  2MAW A;  3JAE A;  4HFB A;  5HEU A;  3C79 A;  2LKG A;  1UW6 A;  3SQ9 A;  2XNU A;  5L47 A;  4UM3 A;  1OED C;  4HFE A;  5HEO A;  2UZ6 A;  4EZ1 A;  2VL0 A;  2Y56 A;  4AFT A;  5L4E A;  4Z90 A;  3EI0 A;  4A97 A;  4B5D A;  1UX2 A;  4A98 A;  5HEJ A;  3WTM A;  4ZZC A;  5CO5 A;  4ZK1 A;  4TNW A;  4UM3 P;  3WTL A;  3ZDG A;  5AFN A;  3EHZ A;  2XQ6 A;  2LKH A;  3RIF A;  2M6B A;  3WTI A;  4ALX A;  3WTK A;  3WTO A;  5JME A;  5LXB A;  4WV9 A;  3PMZ A;  2QC1 B;  2BYQ A;  3TLW A;  3WTH A;  5AFK A;  5AFH A;  2BYS A;  3GUA A;  4DBM A;  4QAC A;  3TLT A;  5J5I A;  2XNV A;  2KSR A;  5SYO A;  3JAF A;  2XQA A;  5AFJ A;  1OED A;  3U8L A;  5HCJ A;  2BJ0 A;  3U8J A;  4UM1 A;  4AFH A;  2ZJU A;  4ZR6 A;  3SIO A;  2WNC A;  3EAM A;  2WZY A;  4XK9 A;  4LMK A;  3RQW A;  5BRX A;  3UU6 A;  4ZZB A;  5AFM A;  5J0Z A;  3RHW A;  3JAD A;  3P4W A;  4TWD A;  1OED B;  2Y58 A;  2YME A;  4QH4 A;  4BQT A;  4XHE A;  3TLV A;  4ILA A;  4NPP A;  2XQ3 A;  2XYT A;  4UY2 A;  3TLS A;  5AFM B;  3UU3 A;  2XYS A;  3UUB A;  3C84 A;  4TWH A;  5HEG A;  4ILC A;  4UM3 S;  1OED E;  5J5F A;  4AFG A;  3PEO A;  4ILB A;  4PIR A;  2BG9 C;  4HQP A;  3WIP A;  3TLU A;  2XQ5 A;  4FRR A;  3LSV A;  2M6I A;  5KE4 A;  4ZRU A;  4IL4 A;  3RIA A;  2LLY A;  2BYR A;  2PGZ A;  3WTJ A;  2ZJV A;  3UU4 A;  4NZB A;  3U8K A;  4ZJT A;  3RQU A;  3UQ4 A;  2Y7Y A;  4HFD A;  1I9B A;  2X00 D;  2Y57 A;  3UU8 A;  4LMJ A;  2W8G A;  2XZ5 A;  5BW2 A;  4F8H A;  5AIN A;  2XQ7 A;  3ZKR A;  2YN6 A; 
#chains in the Genus database with same CATH topology
 5JVD E;  4ZI7 E;  5JR9 C;  4MFR A;  2CE7 A;  2I6H A;  2BG9 A;  2H89 A;  4QAA A;  4IDN A;  5JDQ A;  4DR5 T;  4DV1 T;  2OV9 A;  2UUA T;  3U78 A;  2W63 A;  4CXY A;  3KBU A;  2BYP A;  2WS3 A;  4WYV A;  3T4M A;  5FY7 A;  3AAA B;  2VUR A;  4JBW F;  3HKC E;  4YHJ A;  3KV9 A;  2JPF A;  5F8P A;  4FI5 A;  3WAJ A;  3RYI E;  3P8C D;  3CWZ B;  2VL0 A;  4E7S A;  4A56 A;  3WTL A;  5AQN B;  2LKH A;  1U5P A;  2W00 A;  4G63 A;  1J1J A;  4GK5 E;  4X65 T;  2LM9 A;  2C5J A;  5KX5 E;  4DBM A;  4Q25 A;  3J7Y q;  5JDH A;  3PUR A;  3VRB A;  2UU9 T;  5DJQ C;  4AFH A;  4HFV A;  3LK2 B;  3RH3 A;  2WNC A;  4U33 A;  5LGU B;  4P0B A;  5ABF A;  4QH4 A;  2JJ9 A;  4ZI3 D;  4LFB T;  2IDO B;  3N5L A;  2WMN A;  4TWH A;  2QA7 A;  4I43 B;  3GMI A;  4YTP A;  4PIR A;  2FJE A;  4X64 T;  2XQ5 A;  5KE4 A;  3RGL A;  3WTJ A;  4XZC A;  2IML A;  5AQO B;  4GOU A;  4EZH A;  4B3T T;  2BVL A;  3ZC1 A;  2D9D A;  1FMV A;  4DV4 T;  2LOS A;  4BJM A;  5H6R B;  1N36 T;  4DMW A;  3ESL A;  2XQ4 A;  2JQH A;  3LBX B;  3UUN A;  3N9O A;  3AA6 B;  1HNX T;  4HFI A;  2XZ6 A;  2WN9 A;  4JI3 T;  5FY1 A;  1L0V A;  2LM2 A;  2XAQ B;  5JTG A;  4NUV A;  3UU5 A;  2G0U A;  3G06 A;  2UXD T;  3PUV F;  2X0H A;  1YD8 G;  3U8M A;  4LF8 T;  2BDE A;  4U3C A;  2VKJ A;  3ZYM A;  2LKG A;  4B3M T;  4EZ1 A;  4CXW A;  5F5W A;  3AA1 B;  4PJJ A;  2KMF A;  4A97 A;  5LMN T;  2IUB A;  3WTM A;  1HX8 A;  5FP3 A;  2ZM0 A;  3P4R A;  1FEW A;  1JNZ A;  2XM2 A;  3WTH A;  2MBG A;  4KP3 C;  3TLT A;  4PJM A;  4GKK T;  2LHN A;  3ONL C;  4IGU A;  2BKP A;  2WB5 A;  3SFE A;  2H3R A;  3FBL A;  5J0Z A;  4CI1 B;  1XNQ T;  5FY0 A;  1KNZ A;  2X51 A;  4MBQ A;  4L9I A;  4CI2 B;  2D5U A;  4ILB A;  3KVB A;  2RPA A;  3HA4 A;  4FJO A;  3RLF F;  3LBX A;  3K3Q C;  2K5B B;  3UQ4 A;  2WZI A;  4LF6 T;  5AQL B;  2LT3 A;  3NKZ A;  3ZT7 A;  4I4T E;  2CEA A;  2KT9 A;  3ZMZ B;  3LJC A;  4HFH A;  1Y64 B;  1EZ3 A;  4UR9 A;  5FXX A;  1IBK T;  3WTN A;  2X00 A;  3S4U A;  3C64 A;  3M3Z B;  2CM0 A;  2WSS V;  5J5G A;  1MND A;  4ZJS A;  3L39 A;  2EHO B;  3AEC A;  4U2Z A;  5LJN A;  2BG9 E;  5LG4 A;  3MA9 A;  3CVR A;  3AEF A;  2A2F X;  3IF8 B;  2Y56 A;  4HKA A;  4IT4 A;  4HWF A;  5L3E B;  5JQG E;  4WBO A;  4B5D A;  4L0R A;  5AFU L;  3CQG B;  5LOV E;  1XWM A;  3QNU A;  1WRD A;  4EED A;  3RKG A;  2BYS A;  4DMV A;  4DR6 T;  2K48 A;  3ZJ2 A;  3UT5 E;  2ACX A;  4ZR6 A;  2WZY A;  4JV5 T;  1D1B A;  2DHR A;  3DP7 A;  1AJ3 A;  5FXV A;  2CLY B;  2LSJ A;  4DR3 T;  5LBQ B;  3TLS A;  3ZN0 B;  2LRK A;  3N2G E;  2BG9 C;  3WIP A;  5AQH B;  2Q9Q D;  3L09 A;  4YLH A;  5C8Y E;  4JI5 T;  4XAX B;  2YDS A;  4JI2 T;  3W15 B;  1BR1 A;  3UQ7 A;  4DO0 A;  4TV9 E;  4LF7 T;  4ILU A;  3GN5 B;  3BK9 A;  5HCM A;  2EHO A;  4A5X A;  3MJX A;  3I0Q A;  3OYX A;  5EK3 A;  4TNV A;  2W2U A;  4OYK A;  3PUZ F;  2BYN A;  3KBT A;  4P1N A;  5JDM A;  4UIG A;  3PUX F;  2V5D A;  2CBI A;  5HEO A;  2I0M A;  5L4E A;  2CBJ A;  2WZH A;  3NVO A;  5CO5 A;  4NUU A;  2PTF A;  3ABV A;  3ONX A;  4DID B;  1WFD A;  2X0L B;  3H37 A;  2WU5 A;  5F3J A;  3RYF E;  2CHO A;  1YW0 A;  4P09 A;  3AED A;  1IJ6 A;  2CWO A;  2XQA A;  2VWA A;  2ZJU A;  2L8K A;  3N9L A;  4BQT A;  2WM9 A;  4EB6 E;  5FVK A;  3HI2 A;  3U3I A;  3T1Y T;  4GKJ T;  3VKH A;  5HEG A;  4AFG A;  3AVS A;  1MIV A;  5LYJ E;  2FBW A;  2W66 A;  5LBM A;  2XHE B;  2W0G A;  2NW9 A;  2PGZ A;  2A72 A;  3VR8 A;  4ZOL E;  3GN5 A;  5FXZ A;  2WDV A;  3QK6 A;  4H9N C;  4F8H A;  2M67 A;  3AE9 A;  2HH7 A;  3AVR A;  4IRE A;  3HKD E;  3A7M A;  3MK7 C;  5ABH A;  2LJL A;  4O4L E;  3L8R A;  1W0B A;  4AQF C;  2XPK A;  2N9D A;  1J5E T;  2V5C A;  2FUP A;  4ZXL A;  5TVC A;  2DL1 A;  1IZN B;  5FYM A;  3FZM B;  3CPZ A;  5JRE A;  1QUU A;  3BQI A;  3UFE A;  4LFC T;  2XNU A;  4HFE A;  4YT0 A;  4HTE A;  4UEM A;  4AFT A;  2WCA A;  1UX2 A;  3Q2M A;  1ZOY A;  2DI4 A;  4CZZ B;  4DBQ A;  4ALX A;  3L3P A;  3SS1 A;  2X68 A;  3JAF A;  4GYS A;  3ZJ1 A;  2WWU A;  2C5I T;  1WR0 A;  1MMG A;  3FZL B;  3CML A;  3ZN1 B;  4AKI A;  2PG8 A;  4HWH A;  5FXW A;  3I0O A;  4ILA A;  5AQQ B;  4NIQ A;  2XAG B;  2CXL A;  2HPL A;  2QGS A;  3K3O A;  4ZRU A;  4G2A A;  3U8K A;  4ZJT A;  2NWB A;  3CX7 B;  2VQF T;  5AIN A;  3AA0 B;  4P0A A;  2UXB T;  1B7T A;  4AIS A;  1T7S A;  2XZE A;  3HR0 A;  3AE7 A;  2YKS A;  3M65 A;  4ZK4 A;  4U7I A;  2JQ9 A;  4PJN A;  5L4H A;  3H3A A;  4AKH A;  1J5W A;  2WDQ A;  5HEH A;  3PU3 A;  4QHO A;  4ERR A;  1SUM B;  2MAW A;  2JIW A;  1Y01 A;  3A5X A;  3VRA A;  1UW6 A;  1MIW A;  3QB5 A;  5FL1 A;  2E9X D;  3ZT5 A;  2RP4 A;  3VU7 H;  2CXD A;  2D2S A;  4HWD A;  3ZYK A;  3WTI A;  3WTK A;  3CX8 B;  1ZEE A;  4GYR A;  3HKB E;  2YK0 A;  2XAF B;  2SPC A;  1UX5 A;  4TUY E;  2OLT A;  2X0Y A;  2W67 A;  3OTO T;  3T8O A;  3PDY A;  4TV8 E;  5BRX A;  1IBM T;  2W62 A;  4U72 A;  5EZY E;  2PJQ A;  1T98 A;  1IBL T;  1OWA A;  2NP9 A;  3Q5D A;  3MXZ A;  1KNR A;  2XSB A;  2J47 A;  3F31 A;  1T72 A;  4B3R T;  4FRR A;  2M6I A;  5BP0 A;  2BS2 A;  2EHO C;  2CCQ A;  3UUM A;  4PJL A;  4JYA T;  4B6X A;  1SHZ C;  2ODU A;  3NRX A;  4QAB A;  4AXP A;  4PFP A;  1S94 A;  3SQ6 A;  2YDR A;  2CMR A;  5JRC B;  1QLB A;  4IL9 A;  1MMA A;  4HFC A;  5CA1 E;  4KHP T;  3PUW F;  4ZI2 D;  1ZV4 X;  3OVU A;  5LHG B;  1XMQ T;  3AE3 A;  1XZY A;  4CI3 B;  5HYA A;  2WNL A;  5C2T A;  4JEH B;  4EIW A;  3AAI A;  2CLY C;  4KHZ F;  3LFM A;  3ZEF B;  4OHF A;  3RC8 A;  4Z90 A;  4UV9 B;  4QX8 B;  1BR4 A;  2MTQ A;  3LK3 B;  4UVA B;  2OA5 A;  5ADX L;  1W09 A;  2ES0 A;  3TLW A;  2V26 A;  4Z8X A;  4U2Y A;  2XNV A;  4AQF A;  5LCY A;  5CGM A;  3QC9 A;  1VRB A;  3O1J A;  2E8I A;  3NZQ A;  5HWX A;  2NTY A;  5TAO A;  3RYC E;  2BZB A;  3CQC B;  2V6X A;  4XHE A;  4JI8 T;  4DR4 T;  3OBV E;  2DWG A;  2BKN A;  3B57 A;  3EDV A;  4LF9 T;  2AXD S;  5LHI B;  2ACZ A;  2H7O A;  3HKE E;  4QXB B;  5AQK B;  4H9P C;  1LVK A;  2C5K T;  3RQU A;  4O2B E;  3ETV A;  4HFD A;  4I50 E;  3UU8 A;  4LMJ A;  5JRC A;  5DAB A;  4L5G A;  5HXR A;  4I55 E;  2JRK A;  2V1D B;  2LE8 A;  1UX4 A;  4IHJ E;  4JEU B;  2LHR A;  1Z8U A;  3Q5E A;  5FJV A;  3O1H A;  4MHC A;  2KWI B;  3DJB A;  5AQF B;  5J2T E;  5AQU B;  2BR7 A;  1E2A A;  2GK9 A;  4HFB A;  1G73 A;  3WAK A;  4CN6 A;  3CKD A;  3QB5 K;  4AKL A;  2B76 A;  4ZK1 A;  4TNW A;  1XNR T;  4WNK A;  5AFN A;  2VK9 A;  2HN1 A;  4CN1 A;  4EEB A;  5JME A;  5LXB A;  1WLX A;  3GUA A;  1HCI A;  4JLE A;  3LK4 2;  1IAP A;  3O4X E;  1D0Y A;  5HXE A;  3F57 A;  5HCJ A;  3N9Q A;  1WYB A;  2WAU A;  3PUG A;  4LMK A;  1KFY A;  2EHO D;  4JUY A;  1FMW A;  4IDP A;  1XDO A;  5BR8 T;  1SE7 A;  4DUY T;  2NOX A;  3N2O A;  3UUB A;  1CUN A;  3E22 E;  4YTM A;  2W61 A;  3RX6 A;  2KZ7 B;  4DV6 T;  4UEL A;  4HGA A;  4HWI B;  4IE0 A;  2XY8 B;  3FZH B;  1BR2 A;  3ZKR A;  1D1C A;  2FJB A;  3P4S A;  4ZS2 A;  5HXS A;  2VKO A;  4JI6 T;  5LG3 A;  4M1P A;  1O3X A;  1WCR A;  2F4V T;  4TZ4 C;  1UK5 A;  2ZMA A;  5ETW A;  1FIO A;  3GWH A;  4QH1 A;  4TWF A;  2IIU A;  2LOP A;  2Q9Q B;  1M62 A;  4DR2 T;  3SFD A;  2VKD A;  2HPJ A;  4BA9 A;  2JQK A;  3OJA A;  3AE6 A;  3OPC A;  4EZ4 A;  1US7 B;  3IEE A;  2QVA A;  2VB6 A;  3KVA A;  4ZZC A;  3PJA J;  4KI0 F;  2XQ6 A;  3WTO A;  3MAC A;  2BYQ A;  5AFK A;  2JMK A;  3AXJ B;  1HR0 T;  1YQ4 A;  3N9M A;  4ZZB A;  4QXH B;  4MLK A;  5LGT B;  3RIU C;  2VVN A;  4O8S A;  3SOL A;  4KX6 A;  2X9Y A;  4JI7 T;  4ILC A;  4UM3 S;  5FKY A;  1KF6 A;  4UVB B;  3J9X 1;  3LSV A;  1YKE B;  1OXZ A;  4H9R C;  4LF4 T;  4PNI A;  4YSY A;  2BBH A;  4UXU A;  3KIN B;  1H7C A;  2Q9Q A;  5AFL A;  3LDQ B;  2V6Y B;  2ZLY A;  4CQI A;  1VOM A;  5KDM C;  3ZDH A;  4IE5 A;  1N34 T;  3CX6 B;  2Y54 A;  1V9D A;  5CA0 E;  5DQW A;  2CPT A;  2C9T A;  4YJ3 E;  4O4J E;  3CK6 A;  3ZMU B;  2HN2 A;  3F2E A;  2ZM8 A;  2VL8 A;  5LA6 E;  3C79 A;  2XTL A;  4AKR B;  4UM3 A;  2D0U A;  3QOF A;  3RRW A;  4EV6 A;  3H3M A;  4H63 V;  1UGO A;  1R8I A;  5ABE A;  4E7Z A;  2WMO A;  4UM3 P;  4WW0 A;  4AQG A;  2E5V A;  3AXJ A;  3EHZ A;  3VKG A;  3JC6 C;  3RKO A;  2E2A A;  4AI6 A;  2KSR A;  5E0O A;  1HNZ T;  5LHH B;  1KK7 A;  3KFW X;  2XM1 A;  3EAM A;  3Q5X A;  4XK9 A;  1ZP0 A;  4ZI3 C;  2K24 A;  4H9S E;  3JAD A;  1OED B;  2N2N A;  2XQ3 A;  5LGN B;  2X67 A;  2XYT A;  1D1A A;  5J5F A;  2V8S V;  3AA7 B;  3RPU A;  2HHH T;  2YIN A;  2J62 A;  2LLY A;  3UUX B;  4EYY R;  3HL6 A;  3UU4 A;  4V1A v;  3ZMS B;  1M7K A;  2XZ5 A;  4C90 A;  1MMN A;  2WQY A;  2XQ7 A;  3C4W A;  2YN6 A;  3ANW B;  2V6Y A;  1N33 T;  4B3S T;  3PUS A;  1VCT A;  3AB3 B;  3DTO A;  3SRZ A;  3IGQ A;  2LRL A;  3P50 A;  5HXC A;  5J5H A;  2DWK A;  3B13 A;  4YTN A;  4LFA T;  3UUL A;  3CQX C;  2NW8 A;  2Y6X A;  4QWN B;  3AE4 A;  4IIJ E;  5HAX A;  3P4P A;  2YMD A;  4QKN A;  4ZEY A;  3JAE A;  4YSZ A;  2FJA A;  4YHH T;  3PUY F;  5LJM A;  5M4Y A;  3P7I A;  4ADZ A;  3AE8 A;  3C50 A;  2VQE T;  4UV8 B;  3ZC0 A;  3AE1 A;  4O4I E;  2E5L T;  3ZST A;  3PMZ A;  4OX9 T;  3X1D A;  5AFH A;  4DND A;  2XAS B;  1MIY A;  2J1D G;  2B1E A;  1OED A;  3U8L A;  4NXM T;  5J2U E;  2DCF A;  2E9X B;  2A9U A;  2BKO A;  3Q9D A;  4X1Y E;  3EUH A;  2VVS A;  2XAH B;  3KV5 A;  3TLV A;  2LSG A;  2D0T A;  1DU2 A;  4I0U A;  3UTK A;  3N9N A;  2XSA A;  3VHL A;  4BJN A;  2A3D A;  1W0A A;  3ANW A;  5IWA T;  5DQV A;  4KMC A;  3FXE B;  3RIA A;  2Y7Y A;  3EVY A;  3K3N A;  5AQG B;  2KIN B;  3KDS E;  4JI4 T;  5KZU A;  2BR8 A;  2WY2 A;  5AQP B;  3U8N A;  4PAG A;  4IDQ A;  3PV0 F;  4Z91 A;  3FXD B;  2WU2 A;  1CHU A;  2UXC T;  5FNV E;  2WP9 A;  2XJ7 A;  2X9H A;  3ZT6 A;  1LRZ A;  4X5T A;  2CRB A;  3RIU A;  4U7Y A;  5HXH A;  2XAJ B;  2X9X A;  4J2C A;  4X1I E;  1U4Q A;  3RC3 A;  3AEG A;  5IUX A;  4PK6 A;  4X1K E;  3JC6 D;  3UFG A;  5KXJ A;  5GON E;  5LMU T;  5ABG A;  3N2K E;  1D0X A;  2YEV C;  4WBN E;  5AQR B;  4QXC B;  4ASK A;  2DLR A;  5HEJ A;  2XUE A;  3ZDG A;  2NW7 A;  2XQY A;  1S35 A;  1QSD A;  2Y8D A;  4YJ2 E;  2E9X A;  4CXX A;  3BQK A;  3PJA A;  1YKH B;  4X20 E;  5AFJ A;  5AQV B;  3SIO A;  2H88 A;  4ISS A;  3IBP A;  4TWD A;  5L2L A;  1HFA A;  4NPP A;  4UY2 A;  2UUB T;  4BAY B;  4EGW A;  5AFM B;  2Q9Q C;  5L3D B;  2K9A A;  5AQT B;  3ZCJ A;  2WWV A;  4HEA A;  4ZS3 A;  4JI0 T;  4IL4 A;  2ZJV A;  3Q5W A;  4DV0 T;  2IC9 A;  1I9B A;  2X00 D;  2Y57 A;  4X62 T;  4K0K T;  5CB4 E;  1UUS A;  3BQL A;  4IE6 A;  4UF0 B;  2YOE A;  5IHY A;  2XQ9 A;  4GIW A;  5L3C B;  3ZMV B;  3FB2 A;  2PH9 A;  4ANJ A;  3ZMT B;  2L9Q A;  3NRY A;  5J1G A;  4H63 H;  3PTR B;  1NWM X;  2FJD A;  1HG2 A;  1FJG T;  2JQQ A;  3PUQ A;  3CIR A;  4U74 A;  1VCS A;  3SQ9 A;  4TN7 B;  5JR9 B;  1HNW T;  3R6N A;  5L3G B;  4N78 D;  3EI0 A;  3LG7 A;  3V5U A;  1ZKE A;  5LB7 B;  4A98 A;  1KNP A;  3P4Q A;  3C98 B;  3R84 B;  2K3W A;  1X79 A;  5AQS B;  1ZHC A;  4OFZ A;  4GK0 E;  4IDO A;  2UXX B;  1HX1 B;  2MOZ A;  5AQM B;  3EDU A;  4AIU A;  4DV2 T;  2I59 A;  4YSX A;  5AFM A;  2Y58 A;  3C51 A;  4IDZ A;  2DNX A;  3C84 A;  3ONJ A;  2X66 A;  4OK0 A;  1OED E;  3PEO A;  4HQP A;  3FZF B;  2NTX A;  2UXN B;  5BMV E;  4NZB A;  1Z0P A;  3E08 A;  5JH7 E;  3RF1 A;  3A8Y C;  1BR0 A;  2W4X A;  4UF0 A;  1IJ5 A;  1KEY A;  2CXF A;  2IW5 B;  3K1S A;  4UVC B;  3OYZ A;  4IE4 A;  2LSI A;  4ZHQ E;  3GA8 A;  4XBF B;  4KBM B;  1W9R A;  2W8F A;  2XNT A;  3ZPO A;  2CWY A;  4LF5 T;  1XMO T;  2VKH A;  3AE5 A;  2H7V C;  4COF A;  4O4H E;  4QH5 A;  5JDF A;  3WI3 A;  3B5M A;  5JR9 A;  2XQ8 A;  4HWC A;  1E7P A;  3K8P C;  2QYW A;  2VAS A;  3IA3 A;  2LSY A;  1OED C;  2UZ6 A;  1G8X A;  3TKL B;  2KND A;  3RRC A;  3NWI A;  2UUC T;  2V7I A;  5FMN A;  3RIF A;  2RA1 A;  1X9B A;  4WZX A;  2QC1 B;  4IST A;  4YXD A;  5IYZ E;  3AE2 A;  3NBX X;  1UCU A;  2BJ0 A;  1N32 T;  1LKX A;  5FL0 A;  3EAB A;  3UU6 A;  4C91 A;  3FBZ A;  3RHW A;  5CJ5 A;  4DR1 T;  2YME A;  3FZK B;  2QRX A;  2PBI A;  5LNK A;  4DR7 T;  4YY3 T;  3C4Z A;  4DBR A;  4TX5 A;  4F6R C;  1D0Z A;  1I6Z A;  5LXT E;  1GQE A;  4H9O C;  2YU2 A;  3TLU A;  4CN4 A;  4NXN T;  4KUM B;  2MPK A;  4U31 A;  3ZYL A;  1NEK A;  2L3L A;  2BYR A;  3I9W A;  3PE0 A;  2N1G A;  4PFO A;  4DV5 T;  5CFB A;  4EOZ B;  4AKG A;  2AE9 A;  3AEE A;  5A1L A;  3SH1 A;  1YXR A;  4DV3 T;  2CA5 A;  3RI5 A;  4UXN B;  2IHR 1;  1WR6 A;  5AQI B;  5JDL A;  4X66 T;  2BS3 A;  2E9X C;  5JDG A;  3PUA A;  1NEN A;  1HF8 A;  2V7K A;  2YU1 A;  3C4X A;  3O9X A;  4EAH A;  1NAF A;  2X9W A;  2M6B A;  2JMH A;  3MKD A;  4O2A E;  4IE7 A;  5KMG P;  3FHN A;  4QAC A;  5L3F B;  2IAK A;  4UM1 A;  5JDN A;  5HWY A;  3RQW A;  1XDP A;  1HS7 A;  4EYU A;  5C3J A;  3ZCI A;  3T1H T;  2XYS A;  3AEA A;  3IHR A;  3E0Z A;  2YDQ A;  5LP6 E;  3NZP A;  1MMD A;  3SWH A;  2Z6E A;  2ZM6 T;  3V5S A;  2BBJ A;  2IC6 A;  3KV6 A;  3ETU A;  4PW8 A;  5BW2 A;  2V7J A;  4BFQ A;  2WDR A;  4K0U A;  4HE8 A;  2WNJ A;  3I9Y A;  4DVD A;  4AQY T;  2C0S A;  1E1H B;  4ZI2 C;  4JI1 T;  2LSK A;  2CHN A;  2LEH A;  2ZM2 A;  1I94 T;  4HN9 A;  4QX7 B;  2KXP B;  4LML A;  3N9P A;  2BG9 B;  2ODV A;  1UUR A;  2NR4 A;  1WYC A;  3AEB A;  3ZLI A;  2Y48 B;  1UV6 A;  2BVM A;  3I1A A;  3OKQ A;  4D01 A;  3O1I A;  4DUZ T;  2R6G F;  5HEU A;  2V7L A;  5L47 A;  1HTJ F;  3JCF A;  5L3B B;  4DV7 T;  2PFV A;  3D0T A;  1SA0 E;  4WV9 A;  5FVL A;  4H9Q C;  1MNE A;  5J5I A;  5SYO A;  5EK2 A;  4MAL A;  3U8J A;  4YFS A;  3RYH E;  5H6Q B;  3P4W A;  2MYS A;  3KV4 A;  4PK5 A;  2BS4 A;  2WBL A;  3VR9 A;  3UU3 A;  3QUJ A;  4EXT A;  5ABF B;  2V7M A;  1HG5 A;  3PU8 A;  3ZSS A;  2KWH A;  2P9B A;  2KLQ A;  2J4G A;  1JNR A;  3MZK B;  1LVF A;  3AAE B;  5AQJ B;  1T8B A;  4OYJ A;  2W8G A;  1YQ3 A;  4PK4 A;  5EK4 A; 
#chains in the Genus database with same CATH homology
 2XQ4 A;  4UXU A;  5KZU A;  4IRE A;  2BR8 A;  4QAB A;  4BFQ A;  3UQ7 A;  5CFB A;  3U8N A;  2WNJ A;  4HFH A;  3SQ6 A;  5LG3 A;  5AFL A;  3IGQ A;  4Z91 A;  2BG9 A;  2YKS A;  4QAA A;  4HFI A;  2XZ6 A;  4ZK4 A;  4IL9 A;  2YOE A;  2WN9 A;  5HCM A;  3WTN A;  2W8F A;  2X00 A;  2XNT A;  4HFC A;  3SH1 A;  2XQ9 A;  5FJV A;  3ZDH A;  3P50 A;  4QH1 A;  4TWF A;  5L4H A;  2Y54 A;  2PH9 A;  4LML A;  5TVC A;  5J5H A;  4X5T A;  4COF A;  2BG9 B;  2LM2 A;  5BP0 A;  5HEH A;  4TNV A;  3RI5 A;  3UU5 A;  2C9T A;  5J5G A;  4QH5 A;  4ZJS A;  1UV6 A;  2BYP A;  2XQ8 A;  2WNL A;  3T4M A;  2YMD A;  2BR7 A;  3U8M A;  2BYN A;  4D01 A;  5IUX A;  2BG9 E;  2MAW A;  3JAE A;  4HFB A;  5HEU A;  3C79 A;  2LKG A;  1UW6 A;  3SQ9 A;  2XNU A;  5L47 A;  4UM3 A;  1OED C;  4HFE A;  5HEO A;  2UZ6 A;  4EZ1 A;  2VL0 A;  2Y56 A;  4AFT A;  5L4E A;  4Z90 A;  3EI0 A;  4A97 A;  4B5D A;  1UX2 A;  4A98 A;  5HEJ A;  3WTM A;  4ZZC A;  5CO5 A;  4ZK1 A;  4TNW A;  4UM3 P;  3WTL A;  3ZDG A;  5AFN A;  3EHZ A;  2XQ6 A;  2LKH A;  3RIF A;  2M6B A;  3WTI A;  4ALX A;  3WTK A;  3WTO A;  5JME A;  5LXB A;  4WV9 A;  3PMZ A;  2QC1 B;  2BYQ A;  3TLW A;  3WTH A;  5AFK A;  5AFH A;  2BYS A;  3GUA A;  4DBM A;  4QAC A;  3TLT A;  5J5I A;  2XNV A;  2KSR A;  5SYO A;  3JAF A;  2XQA A;  5AFJ A;  1OED A;  3U8L A;  5HCJ A;  2BJ0 A;  3U8J A;  4UM1 A;  4AFH A;  2ZJU A;  4ZR6 A;  3SIO A;  2WNC A;  3EAM A;  2WZY A;  4XK9 A;  4LMK A;  3RQW A;  5BRX A;  3UU6 A;  4ZZB A;  5AFM A;  5J0Z A;  3RHW A;  3JAD A;  3P4W A;  4TWD A;  1OED B;  2Y58 A;  2YME A;  4QH4 A;  4BQT A;  4XHE A;  3TLV A;  4ILA A;  4NPP A;  2XQ3 A;  2XYT A;  4UY2 A;  3TLS A;  5AFM B;  3UU3 A;  2XYS A;  3UUB A;  3C84 A;  4TWH A;  5HEG A;  4ILC A;  4UM3 S;  1OED E;  5J5F A;  4AFG A;  3PEO A;  4ILB A;  4PIR A;  2BG9 C;  4HQP A;  3WIP A;  3TLU A;  2XQ5 A;  4FRR A;  3LSV A;  2M6I A;  5KE4 A;  4ZRU A;  4IL4 A;  3RIA A;  2LLY A;  2BYR A;  2PGZ A;  3WTJ A;  2ZJV A;  3UU4 A;  4NZB A;  3U8K A;  4ZJT A;  3RQU A;  3UQ4 A;  2Y7Y A;  4HFD A;  1I9B A;  2X00 D;  2Y57 A;  3UU8 A;  4LMJ A;  2W8G A;  2XZ5 A;  5BW2 A;  4F8H A;  5AIN A;  2XQ7 A;  3ZKR A;  2YN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...