4IL9A

The pentameric ligand-gated ion channel glic a237f in complex with bromide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
molecule tags Membrane protein, transport protein
source organism Gloeobacter violaceus
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4il9A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4il9A01
4QABA 3WTNA 3GUAA 4ZJSA 3TLUA 2M6IA 1OEDB 2XQ6A 4BQTA 4LMJA 4ZZBA 2XZ5A 2WN9A 4TNWA 4ILBA 4NPPA 2WNJA 3IGQA 2W8FA 2XQ7A 1UV6A 2LKGA 4AFTA 4WV9A 2X00A 3C84A 4QAAA 5AFKA 2LKHA 3T4MA 2LLYA 3WTMA 3WTLA 3UQ4A 5AFJA 4D01A 3WTHA 2XNUA 4QH4A 3UU3A 4UXUA 2LM2A 3UUBA 5SYOA 5FJVA 5L4EA 5J5HA 4ZRUA 3RQUA 5AFMA 2KSRA 5L47A 4HFCA 4IREA 4LMKA 2BR7A 4QACA 2BG9C 2BG9E 2YOEA 2XQ9A 3P4WA 5LG3A 3PMZA 4HQPA 1OEDE 4ILCA 3WIPA 2XYTA 4EZ1A 5BP0A 4UM1A 4TWHA 2BJ0A 2X00D 3JADA 5AFLA 2BYNA 2Y7YA 5BW2A 3EHZA 3WTKA 2XQ8A 4HFDA 5BRXA 5AFMB 5CO5A 4ALXA 2W8GA 3UU5A 2BG9A 2BYPA 2XYSA 5HCMA 5J5IA 2UZ6A 4ZR6A 3P50A 4Z91A 2XQ4A 4F8HA 2BR8A 2WNLA 1OEDC 4UY2A 3UQ7A 4Z90A 2WNCA 3U8KA 2Y58A 5AINA 3C79A 4UM3S 3U8LA 4NZBA 2BYQA 5J5GA 2M6BA 3SQ9A 3TLWA 4UM3P 5HCJA 4HFEA 3TLVA 5CFBA 2PGZA 2Y54A 5IUXA 4ZJTA 2YKSA 2YN6A 3UU4A 5AFNA 4B5DA 5KE4A 4AFGA 2YMDA 2WZYA 4X5TA 3U8MA 3UU6A 5TVCA 1OEDA 2XNTA 3U8NA 3RIAA 2YMEA 4XK9A 3WTJA 2XNVA 3TLSA 3LSVA 4ZK1A 5L4HA 4TWFA 4QH5A 4HFHA 2PH9A 5KZUA 3ZDGA 3JAFA 5HEHA 5HEUA 4DBMA 1I9BA 2BYSA 1UW6A 2XQ5A 2Y57A 5J5FA 2MAWA 3PEOA 3U8JA 4AFHA 2XQAA 3SH1A 3WTOA 3JAEA 4TWDA 5JMEA 4COFA 3SIOA 3ZDHA 4ILAA 3TLTA 2XQ3A 4ZZCA 3EAMA 4HFIA 3ZKRA 4IL9A 4FRRA 4A97A 4PIRA 4LMLA 5AFHA 4BFQA 2BG9B 3RIFA 4TNVA 2ZJUA 2C9TA 5HEJA 2BYRA 5LXBA 3SQ6A 4HFBA 3UU8A 1UX2A 5J0ZA 2ZJVA 4IL4A 5HEGA 4UM3A 3RQWA 4QH1A 4A98A 4ZK4A 2Y56A 3RI5A 3WTIA 2QC1B 3EI0A 5HEOA 3RHWA 2VL0A 2XZ6A 4XHEA
chains in the Genus database with same CATH superfamily
2LSKA 1SHZC 3TLUA 2XQ6A 1NEKA 4LMJA 3UFEA 3LBXA 4UXNB 1U4QA 5JR9A 2LSIA 1IBLT 2KXPB 3QB5K 2BS3A 3WTLA 5FXXA 2HPJA 4YJ2E 2C5JA 4P1NA 4DR7T 2RA1A 2YOEA 2XYTA 2X0HA 4JUYA 2MPKA 5AQKB 3PUVF 4O4HE 5LG4A 2B1EA 1XDPA 5F3JA 3FXDB 5JDNA 5FP3A 3IBPA 3PU8A 1YKEB 2WZHA 3P4SA 4UM3S 5HWXA 3ZN0B 2VKDA 4B5DA 3SS1A 4AKIA 3ZCIA 3AEAA 4EEDA 3RC3A 4U2ZA 1KNZA 3TLSA 2LEHA 3BQLA 3RIUA 4AFHA 1UX5A 4DMVA 3EAMA 2EHOD 2A2FX 4LMLA 4IHJE 4JEHB 1HNXT 4H9SE 3AA7B 2PJQA 4H63H 3Q5DA 3T8OA 4IL4A 4ZK4A 4I55E 2LE8A 5LGTB 2PBIA 3FBZA 1UURA 4MBQA 5HXEA 2BDEA 1UX4A 1MNEA 5LNKA 1XZYA 1HX8A 3E0ZA 3B13A 3OPCA 4EYYR 5AQQB 3GMIA 2JQKA 3Q9DA 2UXBT 5DABA 2V7LA 2XNUA 3ZSSA 2W62A 1WR0A 3FZLB 3KV4A 2CE7A 4QACA 2PTFA 1MMAA 2UXXB 3MK7C 4X62T 5ABEA 5BMVE 2H3RA 4LFCT 2UZ6A 3KVAA 2QGSA 1S35A 4XBFB 5FYMA 3MACA 1MIVA 3UU6A 3ZC1A 2XNTA 3QNUA 3UT5E 2IMLA 4O8SA 4X66T 4HFHA 5KZUA 5HEHA 2ZM2A 4PK5A 5AQVB 2C5IT 2VQET 3SH1A 4TWDA 4PK6A 5CJ5A 1WFDA 1LVKA 3AE7A 4PIRA 4TNVA 2ZJUA 2VURA 5LP6E 4LF4T 3ZYKA 2VL0A 4UR9A 2XZ6A 1IJ6A 4XHEA 3LK3B 3U78A 5L3EB 4HEAA 4HE8A 5LHHB 3AAEB 4ZS3A 2WU5A 4TNWA 3K3QC 4ILUA 5A1LA 2XQ7A 4CZZB 2JQHA 2VKJA 1XNRT 2J47A 1HX1B 2KMFA 1N34T 4LF7T 3AEEA 4WBNE 5FJVA 5LGUB 1MIYA 3DJBA 3AVSA 1D0XA 3P4WA 2WB5A 3PMZA 5LXTE 3CK6A 4EZ1A 4UM1A 2V1DB 2RPAA 1YXRA 4U74A 2FJDA 5L3GB 2K9AA 3IEEA 5M4YA 5FNVE 5FXWA 3Q5WA 3ONJA 2BYPA 4E7SA 2BR8A 2XQ4A 3W15B 2V6YB 2BBHA 3A8YC 3SQ9A 5AQLB 2NW9A 1I6ZA 3K3NA 5E0OA 3PUZF 4DMWA 1E2AA 3ZMTB 4CXYA 2XNVA 3H3MA 2HPLA 1VCTA 1Y01A 4G63A 3J7Yq 5HEUA 5L3CB 2X67A 1AJ3A 2W4XA 5LMUT 4UF0B 4EB6E 3ABVA 5JMEA 3TLTA 4GOUA 3NWIA 2W63A 2HHHT 5AQOB 3RF1A 4UM3A 3AE4A 5F8PA 1R8IA 3KDSE 3ZMSB 4V1Av 3WTNA 3P8CD 2XAJB 5LJMA 3OYXA 2V26A 4C90A 1HNWT 4LFAT 5H6RB 2WWVA 1YQ3A 5ABFB 3C84A 2JMHA 4O4IE 5FY0A 2LKHA 3GN5B 3C98B 4AKGA 4GYRA 2IC9A 4KX6A 1I94T 4ZRUA 2CBJA 1D0YA 2ACXA 4DV2T 3WIPA 3PDYA 4QWNB 3NZPA 4TWHA 2GK9A 3EHZA 2QRXA 4PJLA 3FZMB 4UVBB 5LB7B 3KV9A 3CX6B 2Q9QD 2F4VT 2V7KA 5J5GA 3DP7A 1H7CA 2YKSA 4AKRB 4JI4T 4U3CA 4IDNA 4XK9A 2CHNA 1B7TA 1T98A 3UUMA 4HWFA 3ZDGA 4DBMA 2XSAA 3FZHB 1BR2A 4JEUB 4AISA 2K24A 4MLKA 3RGLA 3AXJB 4MALA 2P9BA 4IT4A 4Z8XA 2LT3A 3HKDE 3ZYLA 1KEYA 3MZKB 4UVCB 3L3PA 4HWDA 2WZIA 1BR0A 2DWGA 3ONXA 3GUAA 3LG7A 3H37A 3RKOA 3I1AA 4I50E 2X68A 2J62A 2DLRA 4NPPA 1SE7A 3IGQA 2NWBA 3QUJA 3SFDA 1UUSA 2NTYA 1V9DA 1SA0E 4IDPA 3CIRA 3VRBA 4QH4A 4TV8E 3ZN1B 1G8XA 5AFMA 2HH7A 3VU7H 2YU2A 3N5LA 2WS3A 3KFWX 2BZBA 4IE0A 4EZHA 1MNDA 3KV5A 4X64T 5JDLA 4DR5T 3PUSA 2XQ8A 1G73A 5FXVA 5EK2A 5CO5A 3HKEE 5AQIB 2VK9A 3RKGA 4UELA 4Z91A 2WNLA 1OEDC 3LK2B 3RRCA 4CN4A 2XSBA 3TLWA 1HR0T 4KHZF 2W66A 4IIJE 3AE2A 4DIDB 2IC6A 2WY2A 5BR8T 5HWYA 4TZ4C 4DUZT 4OHFA 1NAFA 5IWAT 2X66A 4ILAA 2KINB 3BK9A 3EDVA 2KWHA 1LKXA 4I0UA 4DR1T 1L0VA 3SWHA 4I43B 2Y8DA 1X79A 4EAHA 1M7KA 3P4QA 2ZMAA 4EV6A 3L39A 4FI5A 1WYCA 1KFYA 4IE6A 5H6QB 5LHGB 1UGOA 3PV0F 4ZI7E 2X00A 3C50A 3WTMA 2YDSA 5ADXL 5LCYA 2RP4A 4HWHA 5L3FB 4YTNA 2QYWA 4UXUA 3QOFA 3AAAB 5KX5E 3RQUA 3CQCB 5L3DB 3OVUA 2Q9QA 4DR6T 3HKBE 4N78D 3MKDA 3FZFB 3LBXB 1YW0A 4AQYT 2W8GA 2CCQA 1FMWA 2WWUA 2X9YA 4ZR6A 3E22E 4UY2A 3U8KA 4CQIA 3EABA 5AFNA 4EIWA 2BKNA 2DHRA 5JDMA 3H3AA 4AXPA 1OEDA 4YLHA 2XAFB 1HFAA 1LRZA 2OV9A 5JDFA 5JH7E 1KF6A 3FBLA 2EHOB 1HCIA 3PEOA 4WYVA 2NTXA 3DTOA 3N2GE 1GQEA 5LBQB 2WM9A 4U2YA 3WAKA 3AXJA 1W09A 5LXBA 2CHOA 4QXBB 1CUNA 3AA1B 4TV9E 4DO0A 2LSYA 2M6IA 1OEDB 3RYFE 5LBMA 2BS2A 3I0QA 2UXDT 3PJAA 4AKHA 3O9XA 1ZEEA 2E8IA 2MTQA 5CB4E 3T1HT 5AQGB 3G06A 2CXDA 4ILCA 4HFVA 1J5ET 3F2EA 5HAXA 3ZT7A 2XUEA 4WZXA 3S4UA 2OLTA 3V5UA 5AFLA 4BAYB 3PJAJ 3PUAA 2K3WA 3ZYMA 3TKLB 2WMNA 2X0LB 5LMNT 4JLEA 2DNXA 4DV7T 3P50A 5AQTB 4H9QC 5AQJB 3NVOA 1J1JA 5J2UE 5AQPB 5HCJA 1QSDA 4MFRA 4GK5E 3CX8B 3HL6A 1HG2A 3RIAA 4BA9A 2A3DA 4OX9T 2PH9A 3LK42 3KVBA 3JAFA 3K1SA 1UW6A 3RPUA 2MAWA 4ASKA 3JAEA 5CA1E 1MMDA 4COFA 5JTGA 4ZZCA 4H9RC 4IL9A 3RC8A 2YINA 1KNRA 1NENA 1W9RA 1UX2A 3NRYA 2JJ9A 4WBOA 4A98A 2WSSV 3EI0A 4KMCA 1XDOA 1T72A 5IHYA 2CEAA 4B3RT 2ZLYA 3ZJ2A 2LM9A 2IHR1 2WMOA 2B76A 2V6YA 2X0YA 3QC9A 4D01A 3UUXB 3I0OA 1LVFA 1OXZA 3N9QA 1YQ4A 3EVYA 1ZV4X 3I9YA 4Q25A 4U7IA 4LF8T 3ETUA 2XQ9A 3RH3A 4EYUA 2C0SA 2E9XA 4UV9B 2C5KT 3AECA 3JADA 1Z0PA 4IE5A 2E2AA 2BG9A 2YDRA 5J5IA 2D5UA 3ZLIA 2XM1A 3B5MA 4M1PA 4UM3P 3VR8A 4HFEA 3TLVA 2Y54A 2YN6A 3UU4A 1HNZT 2D9DA 1US7B 3CMLA 2W2UA 3U8NA 2LSJA 5FY7A 3JC6D 2XTLA 1WLXA 3V5SA 3P4PA 2D0TA 4L0RA 5JR9B 3RLFF 3ANWA 3ZDHA 2X51A 4X1YE 2DL1A 4XZCA 4CI1B 4DV4T 5AQSB 2KT9A 2WDRA 1ZKEA 2XQYA 2D2SA 4ISSA 2M67A 2YEVC 2V7JA 3RYHE 4YTPA 4ZS2A 1MIWA 1IBKT 4AQFA 3VKGA 4AIUA 1FJGT 3ETVA 4AI6A 4JI5T 4YHJA 4ANJA 3NKZA 4NXNT 2Q9QB 2CPTA 2K5BB 2LJLA 4KP3C 2XHEB 2E9XC 5J5HA 5ETWA 5L47A 5LA6E 2PFVA 3OTOT 3MXZA 5BP0A 3PTRB 4UV8B 5TAOA 5AQNB 4H9NC 5IYZE 2CLYB 3C4WA 3CQXC 3AE1A 4LF9T 2H7VC 3N9PA 2XYSA 1KNPA 2CMRA 5AFUL 3WI3A 2Y58A 4OFZA 3AEBA 4B6XA 2IAKA 5AQRB 4MHCA 2UUCT 4HGAA 3Q2MA 4A56A 2YMDA 2WZYA 3U8MA 2YMEA 3AA0B 2MBGA 3CWZB 4GYSA 5FXZA 3LJCA 2VB6A 3T1YT 3HR0A 4YTMA 2Y57A 3CX7B 1XNQT 3U8JA 3WTOA 4QXCB 3SOLA 3OBVE 5EK3A 4B3TT 3AAIA 5JQGE 5LYJE 3FB2A 5J0ZA 4DR3T 4KBMB 4DV6T 3WTIA 2KZ7B 4K0UA 2PG8A 4QABA 2I0MA 4ZZBA 3ZMVB 2WN9A 4ILBA 4X1IE 2E9XD 3N2OA 3NZQA 4ZI2D 2LKGA 2UUAT 4QAAA 3AEFA 2OA5A 4AQGA 3VR9A 2IUBA 3M65A 2VASA 1BR1A 4J2CA 5FKYA 3HA4A 2X9WA 4IDOA 1N33T 5SYOA 3OJAA 2NOXA 5C3JA 3I9WA 2NW8A 2BG9C 2A9UA 4YHHT 4P09A 2BYNA 5CA0E 4EZ4A 2V5CA 4NIQA 5BW2A 2CXFA 4HFDA 3AE8A 3BQKA 3KBUA 2VVSA 4YY3T 2XAQB 4PFOA 3U8LA 2EHOA 5L2LA 2W00A 2M6BA 1IJ5A 5AQMB 3L8RA 1D1BA 2YU1A 5JDQA 2K48A 4ZK1A 2EHOC 2L3LA 4TWFA 4ZOLE 1FEWA 5ABFA 4X1KE 2DCFA 5GONE 3ZEFB 2FUPA 1BR4A 1FIOA 3Q5EA 2XQAA 4OYJA 3Q5XA 3SIOA 2ES0A 4HN9A 4BFQA 4P0AA 2BKOA 3SQ6A 4HFBA 2NR4A 1IAPA 2JRKA 5ABGA 5KMGP 4GKKT 4X20E 3PUXF 2XASB 3RI5A 4QKNA 4DBQA 3ZC0A 4DV0T 3P4RA 4K0KT 2CM0A 2FJAA 3RYIE 4LFBT 3ESLA 3LDQB 2KLQA 2WNJA 4EGWA 4PAGA 4DBRA 3UUNA 3WTHA 4GK0E 3PU3A 4DV1T 2YDQA 4QX8B 2VVNA 3MA9A 3AVRA 4L5GA 2G0UA 2XJ7A 4DR2T 5AFMB 2H88A 4YSYA 2XM2A 4XAXB 4H9OC 4TX5A 1ZHCA 5JREA 1HG5A 1IZNB 5JRCA 5J1GA 3A5XA 1X9BA 5CFBA 3CVRA 4GIWA 2V5DA 1ZOYA 3WTJA 4L9IA 1ZP0A 4NUVA 3LSVA 1VCSA 4JI6T 5FVKA 2NP9A 2IIUA 3R84B 2BYSA 2L9QA 4JI3T 3FXEB 4ZHQE 3L09A 4U72A 4HFIA 4ISTA 4FRRA 2IDOB 2X9XA 3B57A 4PJNA 4IGUA 2BVLA 1QUUA 3KV6A 2WP9A 4I4TE 2Y56A 5J2TE 2UXCT 3KINB 4IE7A 4ZJSA 3O4XE 4BQTA 5FVLA 4IDZA 2W67A 3ONLC 2ODVA 2WDVA 1UV6A 3D0TA 4WV9A 2LSGA 4AQFC 5LGNB 1HTJF 5AFJA 5LJNA 2UU9T 5HXHA 4E7ZA 2W61A 1OWAA 4GKJT 4HFCA 4CI3B 3AE9A 2UUBT 4IREA 2BG9E 4DVDA 1E1HB 1SUMB 4OYKA 2L8KA 3ZT5A 4TUYE 3K8PC 4YSXA 4JV5T 3J9X1 5BRXA 4ALXA 1MMGA 1VOMA 3AE3A 4ZXLA 4ADZA 5HCMA 3AE6A 1HF8A 3PUGA 2WAUA 3C64A 3N9NA 5IUXA 4CXWA 2FJBA 1NWMX 4O2AE 2XZEA 3QK6A 5ABHA 2WU2A 3CKDA 2J4GA 1UCUA 2LOPA 5J5FA 4YXDA 3N9MA 4H9PC 4HWIB 5LHIB 3GA8A 3WAJA 3N9LA 5LOVE 5DQVA 2H7OA 5AQHB 2CWYA 4QXHB 2KNDA 2ZJVA 2HN2A 5HXRA 3EDUA 3O1IA 3RQWA 3EUHA 1UK5A 2H89A 4LF6T 2V7IA 2DI4A 2I59A 3UFGA 4X65T 1WYBA 3PUWF 1N32T 2QA7A 3N2KE 3GN5A 2CLYC 2W8FA 3IF8B 3AEDA 2I6HA 5AFKA 2VKHA 2LLYA 4CN6A 3OKQA 5KDMC 4CN1A 5C8YE 2V6XA 3IHRA 2XAHB 4LMKA 4PW8A 2VWAA 3AEGA 2BVMA 5EZYE 3HI2A 3CQGB 4YSZA 3A7MA 4PNIA 4F8HA 5DQWA 3UQ7A 2WNCA 3C79A 4NZBA 2BYQA 3ZCJA 1QLBA 4U7YA 5JDGA 3IA3A 3F31A 4AFGA 4IDQA 4JI8T 4ZI3D 1EZ3A 4PK4A 5FMNA 2X9HA 5CGMA 4JI0T 1XWMA 2KWIB 2XQ5A 1MMNA 2QVAA 3E08A 2Y6XA 2BS4A 3VKHA 3GWHA 4PFPA 4B3MT 5AFHA 3PURA 4P0BA 4LF5T 4OK0A 2E9XB 5HEGA 4CXXA 4QH1A 2QC1B 1WCRA 4DUYT 1E7PA 3RIUC 4BJNA 2XZ5A 2LHNA 4C91A 2JIWA 1D1AA 4EOZB 4PJMA 5FY1A 4BJMA 2VL8A 2WBLA 3C4ZA 2W0GA 4DNDA 2VKOA 2JMKA 3UUBA 1KK7A 3RRWA 5L4EA 3PE0A 2LRKA 1YD8G 2MYSA 5L3BB 2JQQA 3BQIA 4ZI2C 2Y7YA 2YK0A 1XMOT 2LOSA 3UU5A 4ZEYA 3FZKB 3PUYF 2E5LT 4KUMB 3KBTA 1CHUA 3OYZA 1Z8UA 1JNRA 4H63V 2Z6EA 4ZJTA 3CPZA 5FL1A 2AE9A 4QHOA 3ZPOA 5JR9C 1IBMT 5L4HA 3O1JA 5HXCA 3FHNA 5DJQC 4B3ST 1D1CA 1W0BA 2E5VA 4F6RC 3ZMUB 4HTEA 2IW5B 2XQ3A 2FJEA 1W0AA 3ZKRA 2ZM6T 5HYAA 3ZT6A 4FJOA 2C9TA 5HEJA 3QB5A 4G2AA 3SFEA 3RX6A 5AQUB 4JI2T 4JYAT 1HS7A 3UULA 3O1HA 3AB3B 4DV5T 5C2TA 2N1GA 3JCFA 4JI1T 4O2BE 1YKHB 4PJJA 4EXTA 4AFTA 5JDHA 1DU2A 4JBWF 3N9OA 2R6GF 2XAGB 1XMQT 2LM2A 3LFMA 2WQYA 1FMVA 4NXMT 2KSRA 5AQFB 4YT0A 5LG3A 4HQPA 2CA5A 4U31A 3C51A 2BJ0A 5HXSA 3UTKA 4U33A 3WTKA 2JPFA 4JI7T 1D0ZA 3RYCE 4KI0F 4O4JE 2SPCA 4EEBA 2N2NA 3R6NA 5EK4A 1I9BA 2DWKA 4CI2B 2V7MA 2WCAA 3M3ZB 3ZSTA 2BG9B 3NBXX 5F5WA 3ANWB 2BYRA 3F57A 3K3OA 1WR6A 3VHLA 1Y64B 3ZMZB 2ACZA 1T7SA 5HEOA 2ZM0A 2JQ9A 2V8SV 3P7IA 4ZI3C 1O3XA 2XY8B 3MJXA 2J1DG 1M62A 3T4MA 5JRCB 3UQ4A 2WDQA 2A72A 2LHRA 3UU3A 2ZM8A 2ODUA 2MOZA 2BBJA 3HKCE 3PUQA 2Q9QC 1U5PA 5KXJA 2BR7A 3JC6C 2Y48B 4UF0A 1OEDE 3U3IA 4KHPT 2X00D 4NUUA 4HKAA 2NW7A 4WNKA 1S94A 2CWOA 2XPKA 3NRXA 3SRZA 3ZJ1A 4UEMA 4A5XA 2BKPA 5JVDE 1VRBA 4QX7B 4Z90A 5AINA 1JNZA 2CXLA 2N9DA 4UIGA 2PGZA 5KE4A 4X5TA 1T8BA 5TVCA 5FL0A 4IE4A 4O4LE 1WRDA 4YFSA 4DR4T 4TN7B 3VRAA 4QH5A 4UVAB 2CRBA 4YJ3E 2UXNB 3AA6B 3C4XA 4HWCA 4ERRA 4AKLA 4A97A 2CBIA 1N36T 3AE5A 4DV3T 1J5WA 3RIFA 2LRLA 3UU8A 2HN1A 2VQFT 2AXDS 2D0UA 3RHWA 2FBWA 3X1DA 4WW0A
chains in the Genus database with same CATH topology
4QABA 3WTNA 3GUAA 4ZJSA 3TLUA 2M6IA 1OEDB 2XQ6A 4BQTA 4LMJA 4ZZBA 2XZ5A 2WN9A 4TNWA 4ILBA 4NPPA 2WNJA 3IGQA 2W8FA 2XQ7A 1UV6A 2LKGA 4AFTA 4WV9A 2X00A 3C84A 4QAAA 5AFKA 2LKHA 3T4MA 2LLYA 3WTMA 3WTLA 3UQ4A 5AFJA 4D01A 3WTHA 2XNUA 4QH4A 3UU3A 4UXUA 2LM2A 3UUBA 5SYOA 5FJVA 5L4EA 5J5HA 4ZRUA 3RQUA 5AFMA 2KSRA 5L47A 4HFCA 4IREA 4LMKA 2BR7A 4QACA 2BG9C 2BG9E 2YOEA 2XQ9A 3P4WA 5LG3A 3PMZA 4HQPA 1OEDE 4ILCA 3WIPA 2XYTA 4EZ1A 5BP0A 4UM1A 4TWHA 2BJ0A 2X00D 3JADA 5AFLA 2BYNA 2Y7YA 5BW2A 3EHZA 3WTKA 2XQ8A 4HFDA 5BRXA 5AFMB 5CO5A 4ALXA 2W8GA 3UU5A 2BG9A 2BYPA 2XYSA 5HCMA 5J5IA 2UZ6A 4ZR6A 3P50A 4Z91A 2XQ4A 4F8HA 2BR8A 2WNLA 1OEDC 4UY2A 3UQ7A 4Z90A 2WNCA 3U8KA 2Y58A 5AINA 3C79A 4UM3S 3U8LA 4NZBA 2BYQA 5J5GA 2M6BA 3SQ9A 3TLWA 4UM3P 5HCJA 4HFEA 3TLVA 5CFBA 2PGZA 2Y54A 5IUXA 4ZJTA 2YKSA 2YN6A 3UU4A 5AFNA 4B5DA 5KE4A 4AFGA 2YMDA 2WZYA 4X5TA 3U8MA 3UU6A 5TVCA 1OEDA 2XNTA 3U8NA 3RIAA 2YMEA 4XK9A 3WTJA 2XNVA 3TLSA 3LSVA 4ZK1A 5L4HA 4TWFA 4QH5A 4HFHA 2PH9A 5KZUA 3ZDGA 3JAFA 5HEHA 5HEUA 4DBMA 1I9BA 2BYSA 1UW6A 2XQ5A 2Y57A 5J5FA 2MAWA 3PEOA 3U8JA 4AFHA 2XQAA 3SH1A 3WTOA 3JAEA 4TWDA 5JMEA 4COFA 3SIOA 3ZDHA 4ILAA 3TLTA 2XQ3A 4ZZCA 3EAMA 4HFIA 3ZKRA 4IL9A 4FRRA 4A97A 4PIRA 4LMLA 5AFHA 4BFQA 2BG9B 3RIFA 4TNVA 2ZJUA 2C9TA 5HEJA 2BYRA 5LXBA 3SQ6A 4HFBA 3UU8A 1UX2A 5J0ZA 2ZJVA 4IL4A 5HEGA 4UM3A 3RQWA 4QH1A 4A98A 4ZK4A 2Y56A 3RI5A 3WTIA 2QC1B 3EI0A 5HEOA 3RHWA 2VL0A 2XZ6A 4XHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QAB A;  3WTN A;  3GUA A;  4ZJS A;  3TLU A;  2M6I A;  1OED B;  2XQ6 A;  4BQT A;  4LMJ A;  4ZZB A;  2XZ5 A;  2WN9 A;  4TNW A;  4ILB A;  4NPP A;  2WNJ A;  3IGQ A;  2W8F A;  2XQ7 A;  1UV6 A;  2LKG A;  4AFT A;  4WV9 A;  2X00 A;  3C84 A;  4QAA A;  5AFK A;  2LKH A;  3T4M A;  2LLY A;  3WTM A;  3WTL A;  3UQ4 A;  5AFJ A;  4D01 A;  3WTH A;  2XNU A;  4QH4 A;  3UU3 A;  4UXU A;  2LM2 A;  3UUB A;  5SYO A;  5FJV A;  5L4E A;  5J5H A;  4ZRU A;  3RQU A;  5AFM A;  2KSR A;  5L47 A;  4HFC A;  4IRE A;  4LMK A;  2BR7 A;  4QAC A;  2BG9 C;  2BG9 E;  2YOE A;  2XQ9 A;  3P4W A;  5LG3 A;  3PMZ A;  4HQP A;  1OED E;  4ILC A;  3WIP A;  2XYT A;  4EZ1 A;  5BP0 A;  4UM1 A;  4TWH A;  2BJ0 A;  2X00 D;  3JAD A;  5AFL A;  2BYN A;  2Y7Y A;  5BW2 A;  3EHZ A;  3WTK A;  2XQ8 A;  4HFD A;  5BRX A;  5AFM B;  5CO5 A;  4ALX A;  2W8G A;  3UU5 A;  2BG9 A;  2BYP A;  2XYS A;  5HCM A;  5J5I A;  2UZ6 A;  4ZR6 A;  3P50 A;  4Z91 A;  2XQ4 A;  4F8H A;  2BR8 A;  2WNL A;  1OED C;  4UY2 A;  3UQ7 A;  4Z90 A;  2WNC A;  3U8K A;  2Y58 A;  5AIN A;  3C79 A;  4UM3 S;  3U8L A;  4NZB A;  2BYQ A;  5J5G A;  2M6B A;  3SQ9 A;  3TLW A;  4UM3 P;  5HCJ A;  4HFE A;  3TLV A;  5CFB A;  2PGZ A;  2Y54 A;  5IUX A;  4ZJT A;  2YKS A;  2YN6 A;  3UU4 A;  5AFN A;  4B5D A;  5KE4 A;  4AFG A;  2YMD A;  2WZY A;  4X5T A;  3U8M A;  3UU6 A;  5TVC A;  1OED A;  2XNT A;  3U8N A;  3RIA A;  2YME A;  4XK9 A;  3WTJ A;  2XNV A;  3TLS A;  3LSV A;  4ZK1 A;  5L4H A;  4TWF A;  4QH5 A;  4HFH A;  2PH9 A;  5KZU A;  3ZDG A;  3JAF A;  5HEH A;  5HEU A;  4DBM A;  1I9B A;  2BYS A;  1UW6 A;  2XQ5 A;  2Y57 A;  5J5F A;  2MAW A;  3PEO A;  3U8J A;  4AFH A;  2XQA A;  3SH1 A;  3WTO A;  3JAE A;  4TWD A;  5JME A;  4COF A;  3SIO A;  3ZDH A;  4ILA A;  3TLT A;  2XQ3 A;  4ZZC A;  3EAM A;  4HFI A;  3ZKR A;  4IL9 A;  4FRR A;  4A97 A;  4PIR A;  4LML A;  5AFH A;  4BFQ A;  2BG9 B;  3RIF A;  4TNV A;  2ZJU A;  2C9T A;  5HEJ A;  2BYR A;  5LXB A;  3SQ6 A;  4HFB A;  3UU8 A;  1UX2 A;  5J0Z A;  2ZJV A;  4IL4 A;  5HEG A;  4UM3 A;  3RQW A;  4QH1 A;  4A98 A;  4ZK4 A;  2Y56 A;  3RI5 A;  3WTI A;  2QC1 B;  3EI0 A;  5HEO A;  3RHW A;  2VL0 A;  2XZ6 A;  4XHE A; 
#chains in the Genus database with same CATH topology
 2LSK A;  1SHZ C;  3TLU A;  2XQ6 A;  1NEK A;  4LMJ A;  3UFE A;  3LBX A;  4UXN B;  1U4Q A;  5JR9 A;  2LSI A;  1IBL T;  2KXP B;  3QB5 K;  2BS3 A;  3WTL A;  5FXX A;  2HPJ A;  4YJ2 E;  2C5J A;  4P1N A;  4DR7 T;  2RA1 A;  2YOE A;  2XYT A;  2X0H A;  4JUY A;  2MPK A;  5AQK B;  3PUV F;  4O4H E;  5LG4 A;  2B1E A;  1XDP A;  5F3J A;  3FXD B;  5JDN A;  5FP3 A;  3IBP A;  3PU8 A;  1YKE B;  2WZH A;  3P4S A;  4UM3 S;  5HWX A;  3ZN0 B;  2VKD A;  4B5D A;  3SS1 A;  4AKI A;  3ZCI A;  3AEA A;  4EED A;  3RC3 A;  4U2Z A;  1KNZ A;  3TLS A;  2LEH A;  3BQL A;  3RIU A;  4AFH A;  1UX5 A;  4DMV A;  3EAM A;  2EHO D;  2A2F X;  4LML A;  4IHJ E;  4JEH B;  1HNX T;  4H9S E;  3AA7 B;  2PJQ A;  4H63 H;  3Q5D A;  3T8O A;  4IL4 A;  4ZK4 A;  4I55 E;  2LE8 A;  5LGT B;  2PBI A;  3FBZ A;  1UUR A;  4MBQ A;  5HXE A;  2BDE A;  1UX4 A;  1MNE A;  5LNK A;  1XZY A;  1HX8 A;  3E0Z A;  3B13 A;  3OPC A;  4EYY R;  5AQQ B;  3GMI A;  2JQK A;  3Q9D A;  2UXB T;  5DAB A;  2V7L A;  2XNU A;  3ZSS A;  2W62 A;  1WR0 A;  3FZL B;  3KV4 A;  2CE7 A;  4QAC A;  2PTF A;  1MMA A;  2UXX B;  3MK7 C;  4X62 T;  5ABE A;  5BMV E;  2H3R A;  4LFC T;  2UZ6 A;  3KVA A;  2QGS A;  1S35 A;  4XBF B;  5FYM A;  3MAC A;  1MIV A;  3UU6 A;  3ZC1 A;  2XNT A;  3QNU A;  3UT5 E;  2IML A;  4O8S A;  4X66 T;  4HFH A;  5KZU A;  5HEH A;  2ZM2 A;  4PK5 A;  5AQV B;  2C5I T;  2VQE T;  3SH1 A;  4TWD A;  4PK6 A;  5CJ5 A;  1WFD A;  1LVK A;  3AE7 A;  4PIR A;  4TNV A;  2ZJU A;  2VUR A;  5LP6 E;  4LF4 T;  3ZYK A;  2VL0 A;  4UR9 A;  2XZ6 A;  1IJ6 A;  4XHE A;  3LK3 B;  3U78 A;  5L3E B;  4HEA A;  4HE8 A;  5LHH B;  3AAE B;  4ZS3 A;  2WU5 A;  4TNW A;  3K3Q C;  4ILU A;  5A1L A;  2XQ7 A;  4CZZ B;  2JQH A;  2VKJ A;  1XNR T;  2J47 A;  1HX1 B;  2KMF A;  1N34 T;  4LF7 T;  3AEE A;  4WBN E;  5FJV A;  5LGU B;  1MIY A;  3DJB A;  3AVS A;  1D0X A;  3P4W A;  2WB5 A;  3PMZ A;  5LXT E;  3CK6 A;  4EZ1 A;  4UM1 A;  2V1D B;  2RPA A;  1YXR A;  4U74 A;  2FJD A;  5L3G B;  2K9A A;  3IEE A;  5M4Y A;  5FNV E;  5FXW A;  3Q5W A;  3ONJ A;  2BYP A;  4E7S A;  2BR8 A;  2XQ4 A;  3W15 B;  2V6Y B;  2BBH A;  3A8Y C;  3SQ9 A;  5AQL B;  2NW9 A;  1I6Z A;  3K3N A;  5E0O A;  3PUZ F;  4DMW A;  1E2A A;  3ZMT B;  4CXY A;  2XNV A;  3H3M A;  2HPL A;  1VCT A;  1Y01 A;  4G63 A;  3J7Y q;  5HEU A;  5L3C B;  2X67 A;  1AJ3 A;  2W4X A;  5LMU T;  4UF0 B;  4EB6 E;  3ABV A;  5JME A;  3TLT A;  4GOU A;  3NWI A;  2W63 A;  2HHH T;  5AQO B;  3RF1 A;  4UM3 A;  3AE4 A;  5F8P A;  1R8I A;  3KDS E;  3ZMS B;  4V1A v;  3WTN A;  3P8C D;  2XAJ B;  5LJM A;  3OYX A;  2V26 A;  4C90 A;  1HNW T;  4LFA T;  5H6R B;  2WWV A;  1YQ3 A;  5ABF B;  3C84 A;  2JMH A;  4O4I E;  5FY0 A;  2LKH A;  3GN5 B;  3C98 B;  4AKG A;  4GYR A;  2IC9 A;  4KX6 A;  1I94 T;  4ZRU A;  2CBJ A;  1D0Y A;  2ACX A;  4DV2 T;  3WIP A;  3PDY A;  4QWN B;  3NZP A;  4TWH A;  2GK9 A;  3EHZ A;  2QRX A;  4PJL A;  3FZM B;  4UVB B;  5LB7 B;  3KV9 A;  3CX6 B;  2Q9Q D;  2F4V T;  2V7K A;  5J5G A;  3DP7 A;  1H7C A;  2YKS A;  4AKR B;  4JI4 T;  4U3C A;  4IDN A;  4XK9 A;  2CHN A;  1B7T A;  1T98 A;  3UUM A;  4HWF A;  3ZDG A;  4DBM A;  2XSA A;  3FZH B;  1BR2 A;  4JEU B;  4AIS A;  2K24 A;  4MLK A;  3RGL A;  3AXJ B;  4MAL A;  2P9B A;  4IT4 A;  4Z8X A;  2LT3 A;  3HKD E;  3ZYL A;  1KEY A;  3MZK B;  4UVC B;  3L3P A;  4HWD A;  2WZI A;  1BR0 A;  2DWG A;  3ONX A;  3GUA A;  3LG7 A;  3H37 A;  3RKO A;  3I1A A;  4I50 E;  2X68 A;  2J62 A;  2DLR A;  4NPP A;  1SE7 A;  3IGQ A;  2NWB A;  3QUJ A;  3SFD A;  1UUS A;  2NTY A;  1V9D A;  1SA0 E;  4IDP A;  3CIR A;  3VRB A;  4QH4 A;  4TV8 E;  3ZN1 B;  1G8X A;  5AFM A;  2HH7 A;  3VU7 H;  2YU2 A;  3N5L A;  2WS3 A;  3KFW X;  2BZB A;  4IE0 A;  4EZH A;  1MND A;  3KV5 A;  4X64 T;  5JDL A;  4DR5 T;  3PUS A;  2XQ8 A;  1G73 A;  5FXV A;  5EK2 A;  5CO5 A;  3HKE E;  5AQI B;  2VK9 A;  3RKG A;  4UEL A;  4Z91 A;  2WNL A;  1OED C;  3LK2 B;  3RRC A;  4CN4 A;  2XSB A;  3TLW A;  1HR0 T;  4KHZ F;  2W66 A;  4IIJ E;  3AE2 A;  4DID B;  2IC6 A;  2WY2 A;  5BR8 T;  5HWY A;  4TZ4 C;  4DUZ T;  4OHF A;  1NAF A;  5IWA T;  2X66 A;  4ILA A;  2KIN B;  3BK9 A;  3EDV A;  2KWH A;  1LKX A;  4I0U A;  4DR1 T;  1L0V A;  3SWH A;  4I43 B;  2Y8D A;  1X79 A;  4EAH A;  1M7K A;  3P4Q A;  2ZMA A;  4EV6 A;  3L39 A;  4FI5 A;  1WYC A;  1KFY A;  4IE6 A;  5H6Q B;  5LHG B;  1UGO A;  3PV0 F;  4ZI7 E;  2X00 A;  3C50 A;  3WTM A;  2YDS A;  5ADX L;  5LCY A;  2RP4 A;  4HWH A;  5L3F B;  4YTN A;  2QYW A;  4UXU A;  3QOF A;  3AAA B;  5KX5 E;  3RQU A;  3CQC B;  5L3D B;  3OVU A;  2Q9Q A;  4DR6 T;  3HKB E;  4N78 D;  3MKD A;  3FZF B;  3LBX B;  1YW0 A;  4AQY T;  2W8G A;  2CCQ A;  1FMW A;  2WWU A;  2X9Y A;  4ZR6 A;  3E22 E;  4UY2 A;  3U8K A;  4CQI A;  3EAB A;  5AFN A;  4EIW A;  2BKN A;  2DHR A;  5JDM A;  3H3A A;  4AXP A;  1OED A;  4YLH A;  2XAF B;  1HFA A;  1LRZ A;  2OV9 A;  5JDF A;  5JH7 E;  1KF6 A;  3FBL A;  2EHO B;  1HCI A;  3PEO A;  4WYV A;  2NTX A;  3DTO A;  3N2G E;  1GQE A;  5LBQ B;  2WM9 A;  4U2Y A;  3WAK A;  3AXJ A;  1W09 A;  5LXB A;  2CHO A;  4QXB B;  1CUN A;  3AA1 B;  4TV9 E;  4DO0 A;  2LSY A;  2M6I A;  1OED B;  3RYF E;  5LBM A;  2BS2 A;  3I0Q A;  2UXD T;  3PJA A;  4AKH A;  3O9X A;  1ZEE A;  2E8I A;  2MTQ A;  5CB4 E;  3T1H T;  5AQG B;  3G06 A;  2CXD A;  4ILC A;  4HFV A;  1J5E T;  3F2E A;  5HAX A;  3ZT7 A;  2XUE A;  4WZX A;  3S4U A;  2OLT A;  3V5U A;  5AFL A;  4BAY B;  3PJA J;  3PUA A;  2K3W A;  3ZYM A;  3TKL B;  2WMN A;  2X0L B;  5LMN T;  4JLE A;  2DNX A;  4DV7 T;  3P50 A;  5AQT B;  4H9Q C;  5AQJ B;  3NVO A;  1J1J A;  5J2U E;  5AQP B;  5HCJ A;  1QSD A;  4MFR A;  4GK5 E;  3CX8 B;  3HL6 A;  1HG2 A;  3RIA A;  4BA9 A;  2A3D A;  4OX9 T;  2PH9 A;  3LK4 2;  3KVB A;  3JAF A;  3K1S A;  1UW6 A;  3RPU A;  2MAW A;  4ASK A;  3JAE A;  5CA1 E;  1MMD A;  4COF A;  5JTG A;  4ZZC A;  4H9R C;  4IL9 A;  3RC8 A;  2YIN A;  1KNR A;  1NEN A;  1W9R A;  1UX2 A;  3NRY A;  2JJ9 A;  4WBO A;  4A98 A;  2WSS V;  3EI0 A;  4KMC A;  1XDO A;  1T72 A;  5IHY A;  2CEA A;  4B3R T;  2ZLY A;  3ZJ2 A;  2LM9 A;  2IHR 1;  2WMO A;  2B76 A;  2V6Y A;  2X0Y A;  3QC9 A;  4D01 A;  3UUX B;  3I0O A;  1LVF A;  1OXZ A;  3N9Q A;  1YQ4 A;  3EVY A;  1ZV4 X;  3I9Y A;  4Q25 A;  4U7I A;  4LF8 T;  3ETU A;  2XQ9 A;  3RH3 A;  4EYU A;  2C0S A;  2E9X A;  4UV9 B;  2C5K T;  3AEC A;  3JAD A;  1Z0P A;  4IE5 A;  2E2A A;  2BG9 A;  2YDR A;  5J5I A;  2D5U A;  3ZLI A;  2XM1 A;  3B5M A;  4M1P A;  4UM3 P;  3VR8 A;  4HFE A;  3TLV A;  2Y54 A;  2YN6 A;  3UU4 A;  1HNZ T;  2D9D A;  1US7 B;  3CML A;  2W2U A;  3U8N A;  2LSJ A;  5FY7 A;  3JC6 D;  2XTL A;  1WLX A;  3V5S A;  3P4P A;  2D0T A;  4L0R A;  5JR9 B;  3RLF F;  3ANW A;  3ZDH A;  2X51 A;  4X1Y E;  2DL1 A;  4XZC A;  4CI1 B;  4DV4 T;  5AQS B;  2KT9 A;  2WDR A;  1ZKE A;  2XQY A;  2D2S A;  4ISS A;  2M67 A;  2YEV C;  2V7J A;  3RYH E;  4YTP A;  4ZS2 A;  1MIW A;  1IBK T;  4AQF A;  3VKG A;  4AIU A;  1FJG T;  3ETV A;  4AI6 A;  4JI5 T;  4YHJ A;  4ANJ A;  3NKZ A;  4NXN T;  2Q9Q B;  2CPT A;  2K5B B;  2LJL A;  4KP3 C;  2XHE B;  2E9X C;  5J5H A;  5ETW A;  5L47 A;  5LA6 E;  2PFV A;  3OTO T;  3MXZ A;  5BP0 A;  3PTR B;  4UV8 B;  5TAO A;  5AQN B;  4H9N C;  5IYZ E;  2CLY B;  3C4W A;  3CQX C;  3AE1 A;  4LF9 T;  2H7V C;  3N9P A;  2XYS A;  1KNP A;  2CMR A;  5AFU L;  3WI3 A;  2Y58 A;  4OFZ A;  3AEB A;  4B6X A;  2IAK A;  5AQR B;  4MHC A;  2UUC T;  4HGA A;  3Q2M A;  4A56 A;  2YMD A;  2WZY A;  3U8M A;  2YME A;  3AA0 B;  2MBG A;  3CWZ B;  4GYS A;  5FXZ A;  3LJC A;  2VB6 A;  3T1Y T;  3HR0 A;  4YTM A;  2Y57 A;  3CX7 B;  1XNQ T;  3U8J A;  3WTO A;  4QXC B;  3SOL A;  3OBV E;  5EK3 A;  4B3T T;  3AAI A;  5JQG E;  5LYJ E;  3FB2 A;  5J0Z A;  4DR3 T;  4KBM B;  4DV6 T;  3WTI A;  2KZ7 B;  4K0U A;  2PG8 A;  4QAB A;  2I0M A;  4ZZB A;  3ZMV B;  2WN9 A;  4ILB A;  4X1I E;  2E9X D;  3N2O A;  3NZQ A;  4ZI2 D;  2LKG A;  2UUA T;  4QAA A;  3AEF A;  2OA5 A;  4AQG A;  3VR9 A;  2IUB A;  3M65 A;  2VAS A;  1BR1 A;  4J2C A;  5FKY A;  3HA4 A;  2X9W A;  4IDO A;  1N33 T;  5SYO A;  3OJA A;  2NOX A;  5C3J A;  3I9W A;  2NW8 A;  2BG9 C;  2A9U A;  4YHH T;  4P09 A;  2BYN A;  5CA0 E;  4EZ4 A;  2V5C A;  4NIQ A;  5BW2 A;  2CXF A;  4HFD A;  3AE8 A;  3BQK A;  3KBU A;  2VVS A;  4YY3 T;  2XAQ B;  4PFO A;  3U8L A;  2EHO A;  5L2L A;  2W00 A;  2M6B A;  1IJ5 A;  5AQM B;  3L8R A;  1D1B A;  2YU1 A;  5JDQ A;  2K48 A;  4ZK1 A;  2EHO C;  2L3L A;  4TWF A;  4ZOL E;  1FEW A;  5ABF A;  4X1K E;  2DCF A;  5GON E;  3ZEF B;  2FUP A;  1BR4 A;  1FIO A;  3Q5E A;  2XQA A;  4OYJ A;  3Q5X A;  3SIO A;  2ES0 A;  4HN9 A;  4BFQ A;  4P0A A;  2BKO A;  3SQ6 A;  4HFB A;  2NR4 A;  1IAP A;  2JRK A;  5ABG A;  5KMG P;  4GKK T;  4X20 E;  3PUX F;  2XAS B;  3RI5 A;  4QKN A;  4DBQ A;  3ZC0 A;  4DV0 T;  3P4R A;  4K0K T;  2CM0 A;  2FJA A;  3RYI E;  4LFB T;  3ESL A;  3LDQ B;  2KLQ A;  2WNJ A;  4EGW A;  4PAG A;  4DBR A;  3UUN A;  3WTH A;  4GK0 E;  3PU3 A;  4DV1 T;  2YDQ A;  4QX8 B;  2VVN A;  3MA9 A;  3AVR A;  4L5G A;  2G0U A;  2XJ7 A;  4DR2 T;  5AFM B;  2H88 A;  4YSY A;  2XM2 A;  4XAX B;  4H9O C;  4TX5 A;  1ZHC A;  5JRE A;  1HG5 A;  1IZN B;  5JRC A;  5J1G A;  3A5X A;  1X9B A;  5CFB A;  3CVR A;  4GIW A;  2V5D A;  1ZOY A;  3WTJ A;  4L9I A;  1ZP0 A;  4NUV A;  3LSV A;  1VCS A;  4JI6 T;  5FVK A;  2NP9 A;  2IIU A;  3R84 B;  2BYS A;  2L9Q A;  4JI3 T;  3FXE B;  4ZHQ E;  3L09 A;  4U72 A;  4HFI A;  4IST A;  4FRR A;  2IDO B;  2X9X A;  3B57 A;  4PJN A;  4IGU A;  2BVL A;  1QUU A;  3KV6 A;  2WP9 A;  4I4T E;  2Y56 A;  5J2T E;  2UXC T;  3KIN B;  4IE7 A;  4ZJS A;  3O4X E;  4BQT A;  5FVL A;  4IDZ A;  2W67 A;  3ONL C;  2ODV A;  2WDV A;  1UV6 A;  3D0T A;  4WV9 A;  2LSG A;  4AQF C;  5LGN B;  1HTJ F;  5AFJ A;  5LJN A;  2UU9 T;  5HXH A;  4E7Z A;  2W61 A;  1OWA A;  4GKJ T;  4HFC A;  4CI3 B;  3AE9 A;  2UUB T;  4IRE A;  2BG9 E;  4DVD A;  1E1H B;  1SUM B;  4OYK A;  2L8K A;  3ZT5 A;  4TUY E;  3K8P C;  4YSX A;  4JV5 T;  3J9X 1;  5BRX A;  4ALX A;  1MMG A;  1VOM A;  3AE3 A;  4ZXL A;  4ADZ A;  5HCM A;  3AE6 A;  1HF8 A;  3PUG A;  2WAU A;  3C64 A;  3N9N A;  5IUX A;  4CXW A;  2FJB A;  1NWM X;  4O2A E;  2XZE A;  3QK6 A;  5ABH A;  2WU2 A;  3CKD A;  2J4G A;  1UCU A;  2LOP A;  5J5F A;  4YXD A;  3N9M A;  4H9P C;  4HWI B;  5LHI B;  3GA8 A;  3WAJ A;  3N9L A;  5LOV E;  5DQV A;  2H7O A;  5AQH B;  2CWY A;  4QXH B;  2KND A;  2ZJV A;  2HN2 A;  5HXR A;  3EDU A;  3O1I A;  3RQW A;  3EUH A;  1UK5 A;  2H89 A;  4LF6 T;  2V7I A;  2DI4 A;  2I59 A;  3UFG A;  4X65 T;  1WYB A;  3PUW F;  1N32 T;  2QA7 A;  3N2K E;  3GN5 A;  2CLY C;  2W8F A;  3IF8 B;  3AED A;  2I6H A;  5AFK A;  2VKH A;  2LLY A;  4CN6 A;  3OKQ A;  5KDM C;  4CN1 A;  5C8Y E;  2V6X A;  3IHR A;  2XAH B;  4LMK A;  4PW8 A;  2VWA A;  3AEG A;  2BVM A;  5EZY E;  3HI2 A;  3CQG B;  4YSZ A;  3A7M A;  4PNI A;  4F8H A;  5DQW A;  3UQ7 A;  2WNC A;  3C79 A;  4NZB A;  2BYQ A;  3ZCJ A;  1QLB A;  4U7Y A;  5JDG A;  3IA3 A;  3F31 A;  4AFG A;  4IDQ A;  4JI8 T;  4ZI3 D;  1EZ3 A;  4PK4 A;  5FMN A;  2X9H A;  5CGM A;  4JI0 T;  1XWM A;  2KWI B;  2XQ5 A;  1MMN A;  2QVA A;  3E08 A;  2Y6X A;  2BS4 A;  3VKH A;  3GWH A;  4PFP A;  4B3M T;  5AFH A;  3PUR A;  4P0B A;  4LF5 T;  4OK0 A;  2E9X B;  5HEG A;  4CXX A;  4QH1 A;  2QC1 B;  1WCR A;  4DUY T;  1E7P A;  3RIU C;  4BJN A;  2XZ5 A;  2LHN A;  4C91 A;  2JIW A;  1D1A A;  4EOZ B;  4PJM A;  5FY1 A;  4BJM A;  2VL8 A;  2WBL A;  3C4Z A;  2W0G A;  4DND A;  2VKO A;  2JMK A;  3UUB A;  1KK7 A;  3RRW A;  5L4E A;  3PE0 A;  2LRK A;  1YD8 G;  2MYS A;  5L3B B;  2JQQ A;  3BQI A;  4ZI2 C;  2Y7Y A;  2YK0 A;  1XMO T;  2LOS A;  3UU5 A;  4ZEY A;  3FZK B;  3PUY F;  2E5L T;  4KUM B;  3KBT A;  1CHU A;  3OYZ A;  1Z8U A;  1JNR A;  4H63 V;  2Z6E A;  4ZJT A;  3CPZ A;  5FL1 A;  2AE9 A;  4QHO A;  3ZPO A;  5JR9 C;  1IBM T;  5L4H A;  3O1J A;  5HXC A;  3FHN A;  5DJQ C;  4B3S T;  1D1C A;  1W0B A;  2E5V A;  4F6R C;  3ZMU B;  4HTE A;  2IW5 B;  2XQ3 A;  2FJE A;  1W0A A;  3ZKR A;  2ZM6 T;  5HYA A;  3ZT6 A;  4FJO A;  2C9T A;  5HEJ A;  3QB5 A;  4G2A A;  3SFE A;  3RX6 A;  5AQU B;  4JI2 T;  4JYA T;  1HS7 A;  3UUL A;  3O1H A;  3AB3 B;  4DV5 T;  5C2T A;  2N1G A;  3JCF A;  4JI1 T;  4O2B E;  1YKH B;  4PJJ A;  4EXT A;  4AFT A;  5JDH A;  1DU2 A;  4JBW F;  3N9O A;  2R6G F;  2XAG B;  1XMQ T;  2LM2 A;  3LFM A;  2WQY A;  1FMV A;  4NXM T;  2KSR A;  5AQF B;  4YT0 A;  5LG3 A;  4HQP A;  2CA5 A;  4U31 A;  3C51 A;  2BJ0 A;  5HXS A;  3UTK A;  4U33 A;  3WTK A;  2JPF A;  4JI7 T;  1D0Z A;  3RYC E;  4KI0 F;  4O4J E;  2SPC A;  4EEB A;  2N2N A;  3R6N A;  5EK4 A;  1I9B A;  2DWK A;  4CI2 B;  2V7M A;  2WCA A;  3M3Z B;  3ZST A;  2BG9 B;  3NBX X;  5F5W A;  3ANW B;  2BYR A;  3F57 A;  3K3O A;  1WR6 A;  3VHL A;  1Y64 B;  3ZMZ B;  2ACZ A;  1T7S A;  5HEO A;  2ZM0 A;  2JQ9 A;  2V8S V;  3P7I A;  4ZI3 C;  1O3X A;  2XY8 B;  3MJX A;  2J1D G;  1M62 A;  3T4M A;  5JRC B;  3UQ4 A;  2WDQ A;  2A72 A;  2LHR A;  3UU3 A;  2ZM8 A;  2ODU A;  2MOZ A;  2BBJ A;  3HKC E;  3PUQ A;  2Q9Q C;  1U5P A;  5KXJ A;  2BR7 A;  3JC6 C;  2Y48 B;  4UF0 A;  1OED E;  3U3I A;  4KHP T;  2X00 D;  4NUU A;  4HKA A;  2NW7 A;  4WNK A;  1S94 A;  2CWO A;  2XPK A;  3NRX A;  3SRZ A;  3ZJ1 A;  4UEM A;  4A5X A;  2BKP A;  5JVD E;  1VRB A;  4QX7 B;  4Z90 A;  5AIN A;  1JNZ A;  2CXL A;  2N9D A;  4UIG A;  2PGZ A;  5KE4 A;  4X5T A;  1T8B A;  5TVC A;  5FL0 A;  4IE4 A;  4O4L E;  1WRD A;  4YFS A;  4DR4 T;  4TN7 B;  3VRA A;  4QH5 A;  4UVA B;  2CRB A;  4YJ3 E;  2UXN B;  3AA6 B;  3C4X A;  4HWC A;  4ERR A;  4AKL A;  4A97 A;  2CBI A;  1N36 T;  3AE5 A;  4DV3 T;  1J5W A;  3RIF A;  2LRL A;  3UU8 A;  2HN1 A;  2VQF T;  2AXD S;  2D0U A;  3RHW A;  2FBW A;  3X1D A;  4WW0 A; 
#chains in the Genus database with same CATH homology
 4QAB A;  3WTN A;  3GUA A;  4ZJS A;  3TLU A;  2M6I A;  1OED B;  2XQ6 A;  4BQT A;  4LMJ A;  4ZZB A;  2XZ5 A;  2WN9 A;  4TNW A;  4ILB A;  4NPP A;  2WNJ A;  3IGQ A;  2W8F A;  2XQ7 A;  1UV6 A;  2LKG A;  4AFT A;  4WV9 A;  2X00 A;  3C84 A;  4QAA A;  5AFK A;  2LKH A;  3T4M A;  2LLY A;  3WTM A;  3WTL A;  3UQ4 A;  5AFJ A;  4D01 A;  3WTH A;  2XNU A;  4QH4 A;  3UU3 A;  4UXU A;  2LM2 A;  3UUB A;  5SYO A;  5FJV A;  5L4E A;  5J5H A;  4ZRU A;  3RQU A;  5AFM A;  2KSR A;  5L47 A;  4HFC A;  4IRE A;  4LMK A;  2BR7 A;  4QAC A;  2BG9 C;  2BG9 E;  2YOE A;  2XQ9 A;  3P4W A;  5LG3 A;  3PMZ A;  4HQP A;  1OED E;  4ILC A;  3WIP A;  2XYT A;  4EZ1 A;  5BP0 A;  4UM1 A;  4TWH A;  2BJ0 A;  2X00 D;  3JAD A;  5AFL A;  2BYN A;  2Y7Y A;  5BW2 A;  3EHZ A;  3WTK A;  2XQ8 A;  4HFD A;  5BRX A;  5AFM B;  5CO5 A;  4ALX A;  2W8G A;  3UU5 A;  2BG9 A;  2BYP A;  2XYS A;  5HCM A;  5J5I A;  2UZ6 A;  4ZR6 A;  3P50 A;  4Z91 A;  2XQ4 A;  4F8H A;  2BR8 A;  2WNL A;  1OED C;  4UY2 A;  3UQ7 A;  4Z90 A;  2WNC A;  3U8K A;  2Y58 A;  5AIN A;  3C79 A;  4UM3 S;  3U8L A;  4NZB A;  2BYQ A;  5J5G A;  2M6B A;  3SQ9 A;  3TLW A;  4UM3 P;  5HCJ A;  4HFE A;  3TLV A;  5CFB A;  2PGZ A;  2Y54 A;  5IUX A;  4ZJT A;  2YKS A;  2YN6 A;  3UU4 A;  5AFN A;  4B5D A;  5KE4 A;  4AFG A;  2YMD A;  2WZY A;  4X5T A;  3U8M A;  3UU6 A;  5TVC A;  1OED A;  2XNT A;  3U8N A;  3RIA A;  2YME A;  4XK9 A;  3WTJ A;  2XNV A;  3TLS A;  3LSV A;  4ZK1 A;  5L4H A;  4TWF A;  4QH5 A;  4HFH A;  2PH9 A;  5KZU A;  3ZDG A;  3JAF A;  5HEH A;  5HEU A;  4DBM A;  1I9B A;  2BYS A;  1UW6 A;  2XQ5 A;  2Y57 A;  5J5F A;  2MAW A;  3PEO A;  3U8J A;  4AFH A;  2XQA A;  3SH1 A;  3WTO A;  3JAE A;  4TWD A;  5JME A;  4COF A;  3SIO A;  3ZDH A;  4ILA A;  3TLT A;  2XQ3 A;  4ZZC A;  3EAM A;  4HFI A;  3ZKR A;  4IL9 A;  4FRR A;  4A97 A;  4PIR A;  4LML A;  5AFH A;  4BFQ A;  2BG9 B;  3RIF A;  4TNV A;  2ZJU A;  2C9T A;  5HEJ A;  2BYR A;  5LXB A;  3SQ6 A;  4HFB A;  3UU8 A;  1UX2 A;  5J0Z A;  2ZJV A;  4IL4 A;  5HEG A;  4UM3 A;  3RQW A;  4QH1 A;  4A98 A;  4ZK4 A;  2Y56 A;  3RI5 A;  3WTI A;  2QC1 B;  3EI0 A;  5HEO A;  3RHW A;  2VL0 A;  2XZ6 A;  4XHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...