4IL9A

The pentameric ligand-gated ion channel glic a237f in complex with bromide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4il9A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4il9A01
5HEUA 2BYQA 2XQ6A 2XQ9A 3RIAA 2PH9A 3C84A 4FRRA 4XK9A 4IL9A 1UV6A 5SYOA 5AFNA 5J5FA 2BR8A 4HFIA 5AINA 5HCJA 4LMKA 5HEHA 3P4WA 4XHEA 3WIPA 3WTJA 2YOEA 5HCMA 2Y57A 3WTKA 3ZDHA 1OEDA 4Z91A 4HFBA 2WZYA 3RQWA 2WNLA 2WNCA 2BG9A 2ZJVA 3U8NA 4BFQA 5HEGA 5L47A 5BP0A 4UM3P 5L4HA 5BRXA 4ZR6A 5AFMA 3LSVA 3GUAA 4QH5A 3TLSA 3RHWA 3U8KA 5J5HA 2LKGA 2XYTA 3UU6A 2XZ5A 2YMEA 2UZ6A 5HEJA 3TLWA 2YMDA 4UM3A 5FJVA 4ILCA 3T4MA 3UU5A 2BG9E 5CFBA 1OEDC 2M6BA 2VL0A 5TVCA 3PEOA 2BYPA 4UM3S 3UQ4A 4IL4A 2BG9C 3UU3A 1UX2A 4NPPA 5J0ZA 2W8FA 3C79A 4PIRA 4UM1A 3SH1A 3SIOA 4DBMA 4TNWA 2BJ0A 4ZK4A 2XQ8A 2BR7A 4ALXA 4LMLA 4TWHA 5AFKA 3TLVA 5JMEA 2LLYA 2WNJA 2X00A 4HFEA 5HEOA 3WTOA 2ZJUA 4F8HA 4COFA 1I9BA 2XNUA 4QABA 3P50A 3WTNA 4AFGA 2KSRA 4HFCA 3JADA 4UXUA 3ZKRA 4ZJSA 5AFJA 3U8JA 2XQ3A 4A97A 2XYSA 2BG9B 2WN9A 3WTIA 1OEDE 5J5IA 4QH4A 3RQUA 4B5DA 4ZZCA 2XZ6A 5IUXA 5AFMB 4ZRUA 2LKHA 2X00D 2XQ5A 3SQ6A 3U8LA 3JAFA 4TWDA 3WTMA 3UUBA 5L4EA 3TLTA 3UU4A 5AFHA 4AFTA 5J5GA 4AFHA 5CO5A 3SQ9A 4X5TA 4Z90A 3RI5A 3WTLA 4D01A 2BYNA 3EI0A 4LMJA 3JAEA 2YN6A 4HFHA 2PGZA 4QH1A 2XQAA 3UQ7A 1OEDB 3IGQA 2YKSA 2QC1B 2XQ7A 3TLUA 2XQ4A 4ZZBA 3PMZA 4QAAA 3ZDGA 4ZK1A 3EHZA 4TWFA 4A98A 2BYSA 2Y54A 5BW2A 4ILBA 3RIFA 4BQTA 2MAWA 2LM2A 2Y56A 5AFLA 2XNVA 4EZ1A 4IREA 2W8GA 4HQPA 1UW6A 3WTHA 4UY2A 3EAMA 5LXBA 2BYRA 4NZBA 2C9TA 3UU8A 4ILAA 2M6IA 3U8MA 4ZJTA 5KZUA 5LG3A 2Y58A 2XNTA 5KE4A 4TNVA 4QACA 4HFDA 4WV9A 2Y7YA
chains in the Genus database with same CATH superfamily
2J62A 4X20E 3HI2A 2VKDA 4ZEYA 4LF7T 2PBIA 3LK3B 3RF1A 2Y57A 1UCUA 3I9YA 3U3IA 4Z91A 5HXSA 1LVKA 2ES0A 2IHR1 4AIUA 2WB5A 5ADXL 4QXBB 5L4HA 5AFMA 1V9DA 3JCFA 1EZ3A 3E22E 3VRBA 5LCYA 4QX8B 4ZHQE 2XYTA 5LG4A 3VKGA 2E9XA 2JQHA 2BG9C 4NPPA 1DU2A 4IDZA 2BJ0A 2V7IA 5HWYA 3TLVA 4ZXLA 1KEYA 2KWHA 5AQRB 5HEOA 2MTQA 3KV5A 4G63A 4I50E 3WTNA 4AFGA 3NWIA 3ZKRA 2R6GF 3AEBA 2I0MA 3DTOA 4TWDA 1OWAA 2LEHA 3TLTA 3UU4A 2V5DA 5CA0E 1Z0PA 2X0HA 3PDYA 5LJNA 2FJAA 4AKGA 4CN4A 2C0SA 3CWZB 2K5BB 2CA5A 3N9NA 2VVSA 3ZSTA 2LM2A 3N2KE 4QHOA 4J2CA 3ZT5A 2FJBA 1HS7A 2RPAA 4PJJA 2UXNB 4HFDA 1KFYA 2XQ9A 5M4YA 1VOMA 3K3QC 2DLRA 3RC8A 4KX6A 5AINA 5HEHA 3P4QA 1IBMT 1QSDA 1W09A 3L8RA 4IE6A 4AISA 3M65A 2WNLA 3KV6A 1SUMB 5HEGA 4H9SE 2MYSA 2H3RA 3D0TA 5BR8T 4AQYT 5JDMA 4U7IA 3ETUA 4UEMA 4MALA 3PJAJ 2LE8A 4DNDA 4PFPA 3K3NA 3UU3A 2BR7A 3VR9A 3PU8A 3AEAA 2CXLA 2LSKA 4CXXA 4YTPA 2NOXA 2KWIB 2K48A 3B57A 3AXJA 2LHRA 4NXMT 2LSYA 3Q2MA 2UU9T 4DV1T 5LBQB 5JDHA 1N33T 4ZI7E 4O4JE 3RKOA 4P0AA 1ZHCA 1I6ZA 5ABHA 4YSYA 2BVLA 1FEWA 4KHZF 3KV9A 2WMOA 1OEDB 3IGQA 4HEAA 4YLHA 2E5VA 4UVCB 3ZYKA 2XQ4A 3PMZA 2LRLA 3AB3B 4IDPA 3P4SA 2ODVA 2X68A 4DMVA 3N9QA 2MPKA 5L3EB 1MIWA 3AE6A 4TNVA 3MJXA 2LOSA 2WU5A 4XHEA 5BMVE 4DV5T 5FXVA 5HAXA 4HFBA 4UVBB 2JRKA 2DL1A 1I94T 2UXXB 4EXTA 2CM0A 3LSVA 2V7LA 2X9HA 4ANJA 4PW8A 2C5JA 2JMHA 3RHWA 2LSIA 2XAJB 3QK6A 3RC3A 3FHNA 4H9OC 1OEDC 3ZYLA 2W8FA 4QX7B 4JI4T 4P0BA 5AQFB 4TWHA 5AFKA 3JC6D 5LGTB 5L3CB 2MBGA 4E7ZA 4V1Av 1WYBA 3N9LA 2EHOB 3ESLA 3ABVA 3AE1A 1G73A 2XQ5A 5HYAA 4IIJE 5A1LA 4MLKA 4KHPT 3ZPOA 2ZM6T 4YY3T 3M3ZB 2BYNA 3BK9A 3MZKB 4LMJA 5JDGA 2V8SV 3RH3A 2HPLA 3ZN1B 3UQ7A 2ODUA 3TLUA 1SHZC 3ZDGA 4B3RT 2VKOA 4DUYT 2X9YA 3O9XA 3UTKA 4N78D 2XSBA 3GMIA 4UXNB 3EVYA 3AA7B 2IAKA 4IE4A 4ZJTA 3AE7A 4HN9A 3CX6B 3RRCA 3SQ9A 5ABFB 5L2LA 5GONE 3WIPA 4DR2T 2GK9A 3C4XA 1D1CA 1BR1A 2EHOA 2LOPA 2JIWA 2BS3A 5BRXA 5FNVE 4ZR6A 4LF9T 4YFSA 3C4WA 4JI1T 4DV7T 1T72A 2CMRA 2L9QA 3LJCA 1AJ3A 1H7CA 1HTJF 4TNWA 3HKDE 3RKGA 1VRBA 4DUZT 4ZI2C 3NZQA 2A2FX 5J2UE 3PU3A 2KMFA 1FIOA 4AKRB 4K0KT 4B3TT 2V7MA 4Q25A 4KMCA 2I59A 3E0ZA 4E7SA 3NKZA 2H89A 3H37A 4JI2T 5AQQB 5ABFA 2J1DG 3N9OA 3Q5EA 1N34T 3AAAB 2WBLA 2VB6A 3J9X1 3RIFA 2KT9A 4DMWA 2VL8A 4ZS2A 4NZBA 2C9TA 5H6RB 2UUBT 1S35A 1L0VA 1YQ3A 2Y7YA 3AE9A 5LMUT 1UV6A 2UUAT 2UXCT 2Y8DA 4HFIA 3RYIE 5FXXA 2IC9A 4CI2B 5HXHA 5C3JA 3BQLA 2YU2A 3U8KA 4ASKA 2XZ5A 2OA5A 2UZ6A 1XDOA 3W15B 3TLWA 4EEDA 3UU5A 3E08A 3NVOA 2VL0A 5JRCB 4QWNB 1HNWT 3P7IA 1UUSA 4WYVA 1ZP0A 4DR1T 2WMNA 2X0LB 2JQ9A 4M1PA 3A8YC 4HFEA 3RYHE 1NAFA 1XZYA 4TUYE 5AQMB 1YXRA 4CZZB 4JI6T 3N2OA 5EK4A 3O1IA 1VCSA 5FMNA 3UUBA 5L3FB 4CI1B 4UIGA 4ZI3D 2LJLA 4DR3T 4HWIB 2WSSV 2VKJA 2YU1A 2LRKA 5IHYA 3LK42 1FJGT 4ZZBA 4O8SA 4ZK1A 1ZV4X 4WNKA 2Y56A 3FXDB 3ZLIA 1KNRA 4GYRA 4UF0B 4EIWA 4AXPA 2E9XB 3UU8A 3UULA 5JDNA 3B5MA 2Q9QB 4WV9A 2BBHA 1JNRA 2WDRA 3I0OA 2XHEB 2AXDS 2CLYB 2V6XA 3AA0B 5FY0A 3PUSA 3IHRA 5JR9C 2WAUA 2C5KT 3C98B 3GUAA 5AQPB 2UXBT 3HKBE 3L3PA 2W63A 3LK2B 4UM3A 2QRXA 3OJAA 5LOVE 1WCRA 4JUYA 2X66A 4YTMA 3OBVE 5LYJE 1HF8A 1R8IA 1LVFA 1YKHB 1E7PA 4ZK4A 4CXYA 2WCAA 3C51A 5FL1A 3ZJ2A 3UFEA 3CQXC 4COFA 3J7Yq 3KBUA 4WW0A 2E9XC 1X79A 4AQFA 2JQKA 3ANWB 3FZMB 2Q9QC 2H7OA 3LBXB 2W67A 2XAQB 1J1JA 4UF0A 4ZRUA 4GYSA 3SQ6A 1NEKA 4O4LE 3AE3A 4DV0T 2LT3A 2Q9QA 4AKLA 2CLYC 2ZMAA 3P4RA 2KXPB 3FZKB 3AVRA 4WBOA 4AKIA 4GKKT 5AQKB 5LMNT 1CUNA 2Y54A 4ILBA 2WS3A 1MIYA 2ZM0A 2ACXA 1X9BA 2WDVA 2UXDT 5LXBA 1QLBA 4AQGA 2CXDA 4ILAA 5LP6E 4QACA 2QVAA 4HTEA 2WQYA 5LNKA 4UV9B 3P4WA 2NW9A 3Q5XA 5J1GA 4JI5T 3C64A 2YOEA 3AXJB 5IYZE 4XAXB 3CMLA 3EABA 4LFBT 2N2NA 2WNCA 2Y48B 3ANWA 2ZJVA 1UURA 5LXTE 2DWKA 2XASB 3LBXA 2CCQA 2WU2A 2NP9A 3MK7C 3F2EA 5TVCA 4DV3T 2BYPA 2L3LA 4UM1A 4BJNA 1E2AA 3SFDA 4PJMA 3WAJA 3KV4A 2NTXA 3G06A 4EGWA 2WNJA 5KX5E 2XNUA 4U74A 2OV9A 3LFMA 5HXRA 4YTNA 4UXUA 3U8JA 2WN9A 1OEDE 2CHOA 3RIUA 3NZPA 2X00D 5FY1A 3OTOT 3ZN0B 4CQIA 1IAPA 1UX5A 3ZJ1A 5LHIB 2L8KA 2A72A 2E2AA 3N9PA 4EB6E 4GKJT 1W9RA 3JAEA 3KVBA 2PGZA 5HWXA 3KINB 2KLQA 5LJMA 5JH7E 3MA9A 4DO0A 2BYSA 2W62A 2CEAA 2NR4A 2PJQA 2VURA 2XY8B 5AQSB 4IGUA 3HA4A 3ZYMA 2XQ6A 2PH9A 3LDQB 5AFNA 2NTYA 1YKEB 4IT4A 4XZCA 4ISSA 5ABGA 3ZT6A 3V5SA 3MKDA 3QB5K 1M7KA 1D1BA 4JI0T 3FZFB 3AE4A 3HKCE 4L5GA 5LA6E 4OHFA 3FBZA 1XMQT 2H88A 2IUBA 3LG7A 3QNUA 4CXWA 3L39A 5LGNB 1SE7A 1XNQT 3H3MA 4ALXA 5JMEA 3RGLA 3QUJA 1MIVA 2FUPA 2X0YA 4KBMB 5KDMC 2XQ3A 5FYMA 4GOUA 4PFOA 5L4EA 5EK3A 3ZT7A 5AFHA 5C8YE 4AFTA 2V5CA 4HFHA 3I0QA 4YT0A 2J4GA 1HX8A 2XQ7A 3IBPA 3VRAA 1IBLT 3KBTA 4G2AA 4TWFA 5HXCA 2MAWA 3GWHA 4K0UA 4L0RA 4UY2A 2XPKA 3ZC0A 4JYAT 2HPJA 2E5LT 2V1DB 3T1HT 1MMDA 4O2BE 3MXZA 2BYQA 3RIAA 1J5WA 4LF8T 4IL9A 5J5FA 4PK5A 1IJ6A 2ZM8A 1IJ5A 3VHLA 2PFVA 3KVAA 3SOLA 4OFZA 4DR4T 4IE7A 4F6RC 3RQWA 3PJAA 3JC6C 2BZBA 5J5HA 2LKGA 2N1GA 3UU6A 1WR0A 2KINB 3P8CD 3PEOA 4UM3S 3UQ4A 4PIRA 2EHOC 4X1IE 3C79A 3UUMA 4WBNE 4KP3C 3GA8A 4ZI2D 4LMLA 3SFEA 5AQTB 3ZMZB 5JVDE 2W66A 3PURA 3WTOA 3IF8B 3NBXX 1CHUA 3PE0A 4HWHA 4DV4T 4JI8T 3ZCIA 1YW0A 4A97A 1UX4A 1YD8G 2DWGA 4TZ4C 4HGAA 4OX9T 3SS1A 5CJ5A 3S4UA 4P09A 4I55E 4IDNA 2QYWA 5AQHB 3WTLA 4X1YE 4JI3T 2KZ7B 3ZMUB 5BW2A 3EHZA 3UUNA 5IWAT 1HNZT 4BQTA 2VASA 1W0BA 4IREA 3WI3A 2W8GA 2NW8A 2HN1A 1UW6A 1YQ4A 2IC6A 2D2SA 4UELA 2B1EA 4X65T 4ZS3A 5F8PA 2ACZA 1BR4A 4YJ2E 1IBKT 5E0OA 5KE4A 4DBQA 4IDOA 2YK0A 2YINA 4UV8B 5FY7A 3WTJA 5J2TE 3AA1B 5DQWA 3F57A 4JLEA 4ERRA 4LF4T 4LF5T 4PNIA 5KXJA 1MNEA 2BKOA 5CFBA 5FKYA 1D1AA 3VR8A 4FJOA 3DJBA 2BS2A 3Q9DA 2X9XA 2YDRA 4EYUA 1I9BA 4HFCA 4NUUA 3WTIA 1QUUA 3EDVA 4OYKA 3RQUA 2W00A 2XZ6A 4B3ST 5TAOA 3HKEE 1UGOA 3U8LA 3N5LA 4BAYB 3FB2A 3Q5DA 4D01A 1BR0A 4HWCA 2E8IA 3K3OA 2W2UA 2C5IT 4U72A 4EZ1A 3K1SA 2A3DA 3AE5A 3RX6A 3PUVF 2NW7A 4TV8E 2V6YB 4I43B 2D5UA 4QKNA 3CQGB 2JPFA 2BBJA 4XK9A 3C84A 2BR8A 1IZNB 1FMWA 2D9DA 2K24A 4AKHA 3UUXB 2WZHA 4I4TE 1OXZA 2CBIA 4TN7B 4PK6A 2CWYA 2I6HA 2YMEA 4B6XA 2IMLA 5LBMA 2PTFA 2M6BA 3SH1A 4NIQA 5FP3A 4HWFA 4TV9E 4ZI3C 4JEUB 3OPCA 3P50A 1KNZA 1E1HB 3JADA 4PAGA 2BG9B 4GIWA 3T1YT 4B3MT 5C2TA 2V6YA 3PUZF 4YJ3E 5CA1E 4YXDA 5EK2A 4AQFC 1UK5A 2WM9A 1U5PA 4QH1A 1N32T 2XAHB 5F3JA 3FBLA 2CBJA 4DVDA 2DI4A 3UFGA 2FBWA 2XZEA 4HQPA 1Y64B 1Z8UA 2J47A 2UUCT 1NWMX 2M6IA 5L3DB 5KZUA 3CVRA 4U31A 1D0ZA 4NXNT 5HEUA 4X62T 4UR9A 2Z6EA 3R84B 5HCJA 4LMKA 5CGMA 3AEGA 2VK9A 5AQGB 4UVAB 3AEDA 5FVKA 2BG9A 4X1KE 2QGSA 4YSXA 3U8NA 2XAGB 3HR0A 3PUAA 4QH5A 1T8BA 2H7VC 3H3AA 2D0UA 4JBWF 4A56A 3O1HA 2K3WA 3FZLB 4H9NC 2LM9A 4DV2T 5JQGE 2LHNA 4O4IE 4Z8XA 4JV5T 4F8HA 3OYXA 4OK0A 2QA7A 5AFUL 3N9MA 4O2AE 4B5DA 1WFDA 3PV0F 3AECA 2ZLYA 2LKHA 2WWVA 3CQCB 3PUWF 2IIUA 4DR7T 4AFHA 4U2ZA 2HN2A 4X5TA 4Z90A 4HKAA 1ZEEA 1HR0T 4CN1A 3RIUC 5AQNB 2N9DA 4YHHT 5EZYE 3WTHA 2WDQA 2CRBA 3T8OA 3AA6B 4QXHB 3AEEA 3AE2A 2Y58A 2VQFT 3QC9A 2W61A 5F5WA 5HCMA 3KFWX 4EEBA 2XQYA 1HG5A 5AQUB 4MFRA 4ISTA 2VWAA 3BQKA 3T4MA 5JTGA 3ZCJA 2A9UA 3K8PC 4DV6T 2YEVC 2BKNA 5DJQC 3SIOA 2V7JA 2OLTA 2XQ8A 1NENA 4H9PC 2X00A 3R6NA 3C50A 2ZJUA 1HNXT 1Y01A 4ZJSA 2X9WA 5AFJA 2DCFA 2XYSA 2DHRA 4HFVA 4BJMA 2XJ7A 4ZZCA 2VKHA 2BDEA 5AQVB 3JAFA 3WTMA 1N36T 2G0UA 1ZKEA 4U33A 4P1NA 2YN6A 3UT5E 3CK6A 4IE0A 4X64T 1XDPA 3A7MA 3I1AA 3PUQA 4X66T 4LF6T 3AE8A 3OYZA 4DBRA 4H63H 5JDLA 3ONXA 5AQIB 5L3GB 2CHNA 3TKLB 3SWHA 3DP7A 2AE9A 1MMAA 2XNTA 2BVMA 2JMKA 1HG2A 3MACA 2CXFA 3PUXF 3EUHA 3WTKA 1OEDA 1XNRT 3O1JA 4H9QC 1VCTA 4BFQA 4FI5A 3CX8B 5ABEA 4PJLA 3QOFA 2BS4A 2YMDA 2X67A 2V7KA 4ILCA 4CN6A 2EHOD 2LSGA 4IL4A 3CPZA 5AQLB 3ZMVB 3PUGA 1ZOYA 2K9AA 4QABA 3EDUA 4QH4A 5LHGB 2B76A 4H63V 3V5UA 5DQVA 1WYCA 2MOZA 1MNDA 2CPTA 1J5ET 2WP9A 3C4ZA 2SPCA 5LB7B 3A5XA 1HX1B 1JNZA 3B13A 4JEHB 3Q5WA 4CI3B 4PJNA 4O4HE 2QC1B 2JQQA 4A98A 2XTLA 3QB5A 5LGUB 5FVLA 2XUEA 3RYCE 2XAFB 4L9IA 4ILUA 5AQOB 5DABA 1WLXA 2Y6XA 2VVNA 1MMNA 5LG3A 3CX7B 2RP4A 5JDQA 1MMGA 5SYOA 4BA9A 2NWBA 3AVSA 3ZDHA 1B7TA 2WZYA 1T7SA 3CIRA 5L47A 5BP0A 2XSAA 4LFCT 3PUYF 3TLSA 3ETVA 4MBQA 5FJVA 3RLFF 4I0UA 3NRXA 3L09A 3RPUA 4YSZA 2KNDA 1UX2A 5J0ZA 4KUMB 3VU7H 1HFAA 2D0TA 2FJEA 3SRZA 1HCIA 2LLYA 4KI0F 5JREA 1WR6A 3ZSSA 1GQEA 3ONLC 4GK5E 2KSRA 2HH7A 3RYFE 5H6QB 1S94A 3U78A 1KF6A 3N2GE 4YHJA 5JDFA 5IUXA 2BKPA 1WRDA 4IDQA 4XBFB 2FJDA 1US7B 4HE8A 3OKQA 5CO5A 2XM1A 3RI5A 2W0GA 3EI0A 5LHHB 3KDSE 1W0AA 1SA0E 2IDOB 2XQAA 2ZM2A 1LRZA 4QAAA 3IEEA 3P4PA 3VKHA 2IW5B 5AFLA 5ETWA 2RA1A 3WAKA 3IA3A 4ZOLE 1O3XA 2F4VT 2BYRA 3I9WA 3GN5B 4AI6A 2XM2A 4MHCA 3U8MA 2M67A 4U7YA 3AAIA 4NUVA 4IHJE 1M62A 3ZMSB 1BR2A 1XWMA 2WWUA 4FRRA 5J5IA 2WZIA 1U4QA 4U2YA 4H9RC 1T98A 1KK7A 3AAEB 3BQIA 2LSJA 4ADZA 4PK4A 3PTRB 4EZHA 4DIDB 4IE5A 3FXEB 4GK0E 4UM3P 4DR5T 5HXEA 3OVUA 3FZHB 4EOZB 2YDQA 3F31A 5CB4E 3ZC1A 5HEJA 2JJ9A 2BG9E 4WZXA 5AQJB 4DBMA 3CKDA 5JR9B 4DR6T 4LFAT 3AEFA 1D0XA 4TX5A 2DNXA 1KNPA 2CWOA 4C91A 3HL6A 5FL0A 2CE7A 5L3BB 3ONJA 5FXZA 3GN5A 4HWDA 1FMVA 5AFMB 5J5GA 4C90A 3ZEFB 2WY2A 3RRWA 2PG8A 4EV6A 5JRCA 2E9XD 4U3CA 2YKSA 1LKXA 4EAHA 2YDSA 4QXCB 2Q9QD 2HHHT 1D0YA 5FXWA 3O4XE 4JI7T 4OYJA 1XMOT 2VQET 2XNVA 5KMGP 3NRYA 3EAMA 2V26A 2W4XA 4A5XA 2X51A 2P9BA 3X1DA 3ZMTB 1G8XA 4EYYR 4EZ4A 5JR9A
chains in the Genus database with same CATH topology
5HEUA 2BYQA 2XQ6A 2XQ9A 3RIAA 2PH9A 3C84A 4FRRA 4XK9A 4IL9A 1UV6A 5SYOA 5AFNA 5J5FA 2BR8A 4HFIA 5AINA 5HCJA 4LMKA 5HEHA 3P4WA 4XHEA 3WIPA 3WTJA 2YOEA 5HCMA 2Y57A 3WTKA 3ZDHA 1OEDA 4Z91A 4HFBA 2WZYA 3RQWA 2WNLA 2WNCA 2BG9A 2ZJVA 3U8NA 4BFQA 5HEGA 5L47A 5BP0A 4UM3P 5L4HA 5BRXA 4ZR6A 5AFMA 3LSVA 3GUAA 4QH5A 3TLSA 3RHWA 3U8KA 5J5HA 2LKGA 2XYTA 3UU6A 2XZ5A 2YMEA 2UZ6A 5HEJA 3TLWA 2YMDA 4UM3A 5FJVA 4ILCA 3T4MA 3UU5A 2BG9E 5CFBA 1OEDC 2M6BA 2VL0A 5TVCA 3PEOA 2BYPA 4UM3S 3UQ4A 4IL4A 2BG9C 3UU3A 1UX2A 4NPPA 5J0ZA 2W8FA 3C79A 4PIRA 4UM1A 3SH1A 3SIOA 4DBMA 4TNWA 2BJ0A 4ZK4A 2XQ8A 2BR7A 4ALXA 4LMLA 4TWHA 5AFKA 3TLVA 5JMEA 2LLYA 2WNJA 2X00A 4HFEA 5HEOA 3WTOA 2ZJUA 4F8HA 4COFA 1I9BA 2XNUA 4QABA 3P50A 3WTNA 4AFGA 2KSRA 4HFCA 3JADA 4UXUA 3ZKRA 4ZJSA 5AFJA 3U8JA 2XQ3A 4A97A 2XYSA 2BG9B 2WN9A 3WTIA 1OEDE 5J5IA 4QH4A 3RQUA 4B5DA 4ZZCA 2XZ6A 5IUXA 5AFMB 4ZRUA 2LKHA 2X00D 2XQ5A 3SQ6A 3U8LA 3JAFA 4TWDA 3WTMA 3UUBA 5L4EA 3TLTA 3UU4A 5AFHA 4AFTA 5J5GA 4AFHA 5CO5A 3SQ9A 4X5TA 4Z90A 3RI5A 3WTLA 4D01A 2BYNA 3EI0A 4LMJA 3JAEA 2YN6A 4HFHA 2PGZA 4QH1A 2XQAA 3UQ7A 1OEDB 3IGQA 2YKSA 2QC1B 2XQ7A 3TLUA 2XQ4A 4ZZBA 3PMZA 4QAAA 3ZDGA 4ZK1A 3EHZA 4TWFA 4A98A 2BYSA 2Y54A 5BW2A 4ILBA 3RIFA 4BQTA 2MAWA 2LM2A 2Y56A 5AFLA 2XNVA 4EZ1A 4IREA 2W8GA 4HQPA 1UW6A 3WTHA 4UY2A 3EAMA 5LXBA 2BYRA 4NZBA 2C9TA 3UU8A 4ILAA 2M6IA 3U8MA 4ZJTA 5KZUA 5LG3A 2Y58A 2XNTA 5KE4A 4TNVA 4QACA 4HFDA 4WV9A 2Y7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEU A;  2BYQ A;  2XQ6 A;  2XQ9 A;  3RIA A;  2PH9 A;  3C84 A;  4FRR A;  4XK9 A;  4IL9 A;  1UV6 A;  5SYO A;  5AFN A;  5J5F A;  2BR8 A;  4HFI A;  5AIN A;  5HCJ A;  4LMK A;  5HEH A;  3P4W A;  4XHE A;  3WIP A;  3WTJ A;  2YOE A;  5HCM A;  2Y57 A;  3WTK A;  3ZDH A;  1OED A;  4Z91 A;  4HFB A;  2WZY A;  3RQW A;  2WNL A;  2WNC A;  2BG9 A;  2ZJV A;  3U8N A;  4BFQ A;  5HEG A;  5L47 A;  5BP0 A;  4UM3 P;  5L4H A;  5BRX A;  4ZR6 A;  5AFM A;  3LSV A;  3GUA A;  4QH5 A;  3TLS A;  3RHW A;  3U8K A;  5J5H A;  2LKG A;  2XYT A;  3UU6 A;  2XZ5 A;  2YME A;  2UZ6 A;  5HEJ A;  3TLW A;  2YMD A;  4UM3 A;  5FJV A;  4ILC A;  3T4M A;  3UU5 A;  2BG9 E;  5CFB A;  1OED C;  2M6B A;  2VL0 A;  5TVC A;  3PEO A;  2BYP A;  4UM3 S;  3UQ4 A;  4IL4 A;  2BG9 C;  3UU3 A;  1UX2 A;  4NPP A;  5J0Z A;  2W8F A;  3C79 A;  4PIR A;  4UM1 A;  3SH1 A;  3SIO A;  4DBM A;  4TNW A;  2BJ0 A;  4ZK4 A;  2XQ8 A;  2BR7 A;  4ALX A;  4LML A;  4TWH A;  5AFK A;  3TLV A;  5JME A;  2LLY A;  2WNJ A;  2X00 A;  4HFE A;  5HEO A;  3WTO A;  2ZJU A;  4F8H A;  4COF A;  1I9B A;  2XNU A;  4QAB A;  3P50 A;  3WTN A;  4AFG A;  2KSR A;  4HFC A;  3JAD A;  4UXU A;  3ZKR A;  4ZJS A;  5AFJ A;  3U8J A;  2XQ3 A;  4A97 A;  2XYS A;  2BG9 B;  2WN9 A;  3WTI A;  1OED E;  5J5I A;  4QH4 A;  3RQU A;  4B5D A;  4ZZC A;  2XZ6 A;  5IUX A;  5AFM B;  4ZRU A;  2LKH A;  2X00 D;  2XQ5 A;  3SQ6 A;  3U8L A;  3JAF A;  4TWD A;  3WTM A;  3UUB A;  5L4E A;  3TLT A;  3UU4 A;  5AFH A;  4AFT A;  5J5G A;  4AFH A;  5CO5 A;  3SQ9 A;  4X5T A;  4Z90 A;  3RI5 A;  3WTL A;  4D01 A;  2BYN A;  3EI0 A;  4LMJ A;  3JAE A;  2YN6 A;  4HFH A;  2PGZ A;  4QH1 A;  2XQA A;  3UQ7 A;  1OED B;  3IGQ A;  2YKS A;  2QC1 B;  2XQ7 A;  3TLU A;  2XQ4 A;  4ZZB A;  3PMZ A;  4QAA A;  3ZDG A;  4ZK1 A;  3EHZ A;  4TWF A;  4A98 A;  2BYS A;  2Y54 A;  5BW2 A;  4ILB A;  3RIF A;  4BQT A;  2MAW A;  2LM2 A;  2Y56 A;  5AFL A;  2XNV A;  4EZ1 A;  4IRE A;  2W8G A;  4HQP A;  1UW6 A;  3WTH A;  4UY2 A;  3EAM A;  5LXB A;  2BYR A;  4NZB A;  2C9T A;  3UU8 A;  4ILA A;  2M6I A;  3U8M A;  4ZJT A;  5KZU A;  5LG3 A;  2Y58 A;  2XNT A;  5KE4 A;  4TNV A;  4QAC A;  4HFD A;  4WV9 A;  2Y7Y A; 
#chains in the Genus database with same CATH topology
 2J62 A;  4X20 E;  3HI2 A;  2VKD A;  4ZEY A;  4LF7 T;  2PBI A;  3LK3 B;  3RF1 A;  2Y57 A;  1UCU A;  3I9Y A;  3U3I A;  4Z91 A;  5HXS A;  1LVK A;  2ES0 A;  2IHR 1;  4AIU A;  2WB5 A;  5ADX L;  4QXB B;  5L4H A;  5AFM A;  1V9D A;  3JCF A;  1EZ3 A;  3E22 E;  3VRB A;  5LCY A;  4QX8 B;  4ZHQ E;  2XYT A;  5LG4 A;  3VKG A;  2E9X A;  2JQH A;  2BG9 C;  4NPP A;  1DU2 A;  4IDZ A;  2BJ0 A;  2V7I A;  5HWY A;  3TLV A;  4ZXL A;  1KEY A;  2KWH A;  5AQR B;  5HEO A;  2MTQ A;  3KV5 A;  4G63 A;  4I50 E;  3WTN A;  4AFG A;  3NWI A;  3ZKR A;  2R6G F;  3AEB A;  2I0M A;  3DTO A;  4TWD A;  1OWA A;  2LEH A;  3TLT A;  3UU4 A;  2V5D A;  5CA0 E;  1Z0P A;  2X0H A;  3PDY A;  5LJN A;  2FJA A;  4AKG A;  4CN4 A;  2C0S A;  3CWZ B;  2K5B B;  2CA5 A;  3N9N A;  2VVS A;  3ZST A;  2LM2 A;  3N2K E;  4QHO A;  4J2C A;  3ZT5 A;  2FJB A;  1HS7 A;  2RPA A;  4PJJ A;  2UXN B;  4HFD A;  1KFY A;  2XQ9 A;  5M4Y A;  1VOM A;  3K3Q C;  2DLR A;  3RC8 A;  4KX6 A;  5AIN A;  5HEH A;  3P4Q A;  1IBM T;  1QSD A;  1W09 A;  3L8R A;  4IE6 A;  4AIS A;  3M65 A;  2WNL A;  3KV6 A;  1SUM B;  5HEG A;  4H9S E;  2MYS A;  2H3R A;  3D0T A;  5BR8 T;  4AQY T;  5JDM A;  4U7I A;  3ETU A;  4UEM A;  4MAL A;  3PJA J;  2LE8 A;  4DND A;  4PFP A;  3K3N A;  3UU3 A;  2BR7 A;  3VR9 A;  3PU8 A;  3AEA A;  2CXL A;  2LSK A;  4CXX A;  4YTP A;  2NOX A;  2KWI B;  2K48 A;  3B57 A;  3AXJ A;  2LHR A;  4NXM T;  2LSY A;  3Q2M A;  2UU9 T;  4DV1 T;  5LBQ B;  5JDH A;  1N33 T;  4ZI7 E;  4O4J E;  3RKO A;  4P0A A;  1ZHC A;  1I6Z A;  5ABH A;  4YSY A;  2BVL A;  1FEW A;  4KHZ F;  3KV9 A;  2WMO A;  1OED B;  3IGQ A;  4HEA A;  4YLH A;  2E5V A;  4UVC B;  3ZYK A;  2XQ4 A;  3PMZ A;  2LRL A;  3AB3 B;  4IDP A;  3P4S A;  2ODV A;  2X68 A;  4DMV A;  3N9Q A;  2MPK A;  5L3E B;  1MIW A;  3AE6 A;  4TNV A;  3MJX A;  2LOS A;  2WU5 A;  4XHE A;  5BMV E;  4DV5 T;  5FXV A;  5HAX A;  4HFB A;  4UVB B;  2JRK A;  2DL1 A;  1I94 T;  2UXX B;  4EXT A;  2CM0 A;  3LSV A;  2V7L A;  2X9H A;  4ANJ A;  4PW8 A;  2C5J A;  2JMH A;  3RHW A;  2LSI A;  2XAJ B;  3QK6 A;  3RC3 A;  3FHN A;  4H9O C;  1OED C;  3ZYL A;  2W8F A;  4QX7 B;  4JI4 T;  4P0B A;  5AQF B;  4TWH A;  5AFK A;  3JC6 D;  5LGT B;  5L3C B;  2MBG A;  4E7Z A;  4V1A v;  1WYB A;  3N9L A;  2EHO B;  3ESL A;  3ABV A;  3AE1 A;  1G73 A;  2XQ5 A;  5HYA A;  4IIJ E;  5A1L A;  4MLK A;  4KHP T;  3ZPO A;  2ZM6 T;  4YY3 T;  3M3Z B;  2BYN A;  3BK9 A;  3MZK B;  4LMJ A;  5JDG A;  2V8S V;  3RH3 A;  2HPL A;  3ZN1 B;  3UQ7 A;  2ODU A;  3TLU A;  1SHZ C;  3ZDG A;  4B3R T;  2VKO A;  4DUY T;  2X9Y A;  3O9X A;  3UTK A;  4N78 D;  2XSB A;  3GMI A;  4UXN B;  3EVY A;  3AA7 B;  2IAK A;  4IE4 A;  4ZJT A;  3AE7 A;  4HN9 A;  3CX6 B;  3RRC A;  3SQ9 A;  5ABF B;  5L2L A;  5GON E;  3WIP A;  4DR2 T;  2GK9 A;  3C4X A;  1D1C A;  1BR1 A;  2EHO A;  2LOP A;  2JIW A;  2BS3 A;  5BRX A;  5FNV E;  4ZR6 A;  4LF9 T;  4YFS A;  3C4W A;  4JI1 T;  4DV7 T;  1T72 A;  2CMR A;  2L9Q A;  3LJC A;  1AJ3 A;  1H7C A;  1HTJ F;  4TNW A;  3HKD E;  3RKG A;  1VRB A;  4DUZ T;  4ZI2 C;  3NZQ A;  2A2F X;  5J2U E;  3PU3 A;  2KMF A;  1FIO A;  4AKR B;  4K0K T;  4B3T T;  2V7M A;  4Q25 A;  4KMC A;  2I59 A;  3E0Z A;  4E7S A;  3NKZ A;  2H89 A;  3H37 A;  4JI2 T;  5AQQ B;  5ABF A;  2J1D G;  3N9O A;  3Q5E A;  1N34 T;  3AAA B;  2WBL A;  2VB6 A;  3J9X 1;  3RIF A;  2KT9 A;  4DMW A;  2VL8 A;  4ZS2 A;  4NZB A;  2C9T A;  5H6R B;  2UUB T;  1S35 A;  1L0V A;  1YQ3 A;  2Y7Y A;  3AE9 A;  5LMU T;  1UV6 A;  2UUA T;  2UXC T;  2Y8D A;  4HFI A;  3RYI E;  5FXX A;  2IC9 A;  4CI2 B;  5HXH A;  5C3J A;  3BQL A;  2YU2 A;  3U8K A;  4ASK A;  2XZ5 A;  2OA5 A;  2UZ6 A;  1XDO A;  3W15 B;  3TLW A;  4EED A;  3UU5 A;  3E08 A;  3NVO A;  2VL0 A;  5JRC B;  4QWN B;  1HNW T;  3P7I A;  1UUS A;  4WYV A;  1ZP0 A;  4DR1 T;  2WMN A;  2X0L B;  2JQ9 A;  4M1P A;  3A8Y C;  4HFE A;  3RYH E;  1NAF A;  1XZY A;  4TUY E;  5AQM B;  1YXR A;  4CZZ B;  4JI6 T;  3N2O A;  5EK4 A;  3O1I A;  1VCS A;  5FMN A;  3UUB A;  5L3F B;  4CI1 B;  4UIG A;  4ZI3 D;  2LJL A;  4DR3 T;  4HWI B;  2WSS V;  2VKJ A;  2YU1 A;  2LRK A;  5IHY A;  3LK4 2;  1FJG T;  4ZZB A;  4O8S A;  4ZK1 A;  1ZV4 X;  4WNK A;  2Y56 A;  3FXD B;  3ZLI A;  1KNR A;  4GYR A;  4UF0 B;  4EIW A;  4AXP A;  2E9X B;  3UU8 A;  3UUL A;  5JDN A;  3B5M A;  2Q9Q B;  4WV9 A;  2BBH A;  1JNR A;  2WDR A;  3I0O A;  2XHE B;  2AXD S;  2CLY B;  2V6X A;  3AA0 B;  5FY0 A;  3PUS A;  3IHR A;  5JR9 C;  2WAU A;  2C5K T;  3C98 B;  3GUA A;  5AQP B;  2UXB T;  3HKB E;  3L3P A;  2W63 A;  3LK2 B;  4UM3 A;  2QRX A;  3OJA A;  5LOV E;  1WCR A;  4JUY A;  2X66 A;  4YTM A;  3OBV E;  5LYJ E;  1HF8 A;  1R8I A;  1LVF A;  1YKH B;  1E7P A;  4ZK4 A;  4CXY A;  2WCA A;  3C51 A;  5FL1 A;  3ZJ2 A;  3UFE A;  3CQX C;  4COF A;  3J7Y q;  3KBU A;  4WW0 A;  2E9X C;  1X79 A;  4AQF A;  2JQK A;  3ANW B;  3FZM B;  2Q9Q C;  2H7O A;  3LBX B;  2W67 A;  2XAQ B;  1J1J A;  4UF0 A;  4ZRU A;  4GYS A;  3SQ6 A;  1NEK A;  4O4L E;  3AE3 A;  4DV0 T;  2LT3 A;  2Q9Q A;  4AKL A;  2CLY C;  2ZMA A;  3P4R A;  2KXP B;  3FZK B;  3AVR A;  4WBO A;  4AKI A;  4GKK T;  5AQK B;  5LMN T;  1CUN A;  2Y54 A;  4ILB A;  2WS3 A;  1MIY A;  2ZM0 A;  2ACX A;  1X9B A;  2WDV A;  2UXD T;  5LXB A;  1QLB A;  4AQG A;  2CXD A;  4ILA A;  5LP6 E;  4QAC A;  2QVA A;  4HTE A;  2WQY A;  5LNK A;  4UV9 B;  3P4W A;  2NW9 A;  3Q5X A;  5J1G A;  4JI5 T;  3C64 A;  2YOE A;  3AXJ B;  5IYZ E;  4XAX B;  3CML A;  3EAB A;  4LFB T;  2N2N A;  2WNC A;  2Y48 B;  3ANW A;  2ZJV A;  1UUR A;  5LXT E;  2DWK A;  2XAS B;  3LBX A;  2CCQ A;  2WU2 A;  2NP9 A;  3MK7 C;  3F2E A;  5TVC A;  4DV3 T;  2BYP A;  2L3L A;  4UM1 A;  4BJN A;  1E2A A;  3SFD A;  4PJM A;  3WAJ A;  3KV4 A;  2NTX A;  3G06 A;  4EGW A;  2WNJ A;  5KX5 E;  2XNU A;  4U74 A;  2OV9 A;  3LFM A;  5HXR A;  4YTN A;  4UXU A;  3U8J A;  2WN9 A;  1OED E;  2CHO A;  3RIU A;  3NZP A;  2X00 D;  5FY1 A;  3OTO T;  3ZN0 B;  4CQI A;  1IAP A;  1UX5 A;  3ZJ1 A;  5LHI B;  2L8K A;  2A72 A;  2E2A A;  3N9P A;  4EB6 E;  4GKJ T;  1W9R A;  3JAE A;  3KVB A;  2PGZ A;  5HWX A;  3KIN B;  2KLQ A;  5LJM A;  5JH7 E;  3MA9 A;  4DO0 A;  2BYS A;  2W62 A;  2CEA A;  2NR4 A;  2PJQ A;  2VUR A;  2XY8 B;  5AQS B;  4IGU A;  3HA4 A;  3ZYM A;  2XQ6 A;  2PH9 A;  3LDQ B;  5AFN A;  2NTY A;  1YKE B;  4IT4 A;  4XZC A;  4ISS A;  5ABG A;  3ZT6 A;  3V5S A;  3MKD A;  3QB5 K;  1M7K A;  1D1B A;  4JI0 T;  3FZF B;  3AE4 A;  3HKC E;  4L5G A;  5LA6 E;  4OHF A;  3FBZ A;  1XMQ T;  2H88 A;  2IUB A;  3LG7 A;  3QNU A;  4CXW A;  3L39 A;  5LGN B;  1SE7 A;  1XNQ T;  3H3M A;  4ALX A;  5JME A;  3RGL A;  3QUJ A;  1MIV A;  2FUP A;  2X0Y A;  4KBM B;  5KDM C;  2XQ3 A;  5FYM A;  4GOU A;  4PFO A;  5L4E A;  5EK3 A;  3ZT7 A;  5AFH A;  5C8Y E;  4AFT A;  2V5C A;  4HFH A;  3I0Q A;  4YT0 A;  2J4G A;  1HX8 A;  2XQ7 A;  3IBP A;  3VRA A;  1IBL T;  3KBT A;  4G2A A;  4TWF A;  5HXC A;  2MAW A;  3GWH A;  4K0U A;  4L0R A;  4UY2 A;  2XPK A;  3ZC0 A;  4JYA T;  2HPJ A;  2E5L T;  2V1D B;  3T1H T;  1MMD A;  4O2B E;  3MXZ A;  2BYQ A;  3RIA A;  1J5W A;  4LF8 T;  4IL9 A;  5J5F A;  4PK5 A;  1IJ6 A;  2ZM8 A;  1IJ5 A;  3VHL A;  2PFV A;  3KVA A;  3SOL A;  4OFZ A;  4DR4 T;  4IE7 A;  4F6R C;  3RQW A;  3PJA A;  3JC6 C;  2BZB A;  5J5H A;  2LKG A;  2N1G A;  3UU6 A;  1WR0 A;  2KIN B;  3P8C D;  3PEO A;  4UM3 S;  3UQ4 A;  4PIR A;  2EHO C;  4X1I E;  3C79 A;  3UUM A;  4WBN E;  4KP3 C;  3GA8 A;  4ZI2 D;  4LML A;  3SFE A;  5AQT B;  3ZMZ B;  5JVD E;  2W66 A;  3PUR A;  3WTO A;  3IF8 B;  3NBX X;  1CHU A;  3PE0 A;  4HWH A;  4DV4 T;  4JI8 T;  3ZCI A;  1YW0 A;  4A97 A;  1UX4 A;  1YD8 G;  2DWG A;  4TZ4 C;  4HGA A;  4OX9 T;  3SS1 A;  5CJ5 A;  3S4U A;  4P09 A;  4I55 E;  4IDN A;  2QYW A;  5AQH B;  3WTL A;  4X1Y E;  4JI3 T;  2KZ7 B;  3ZMU B;  5BW2 A;  3EHZ A;  3UUN A;  5IWA T;  1HNZ T;  4BQT A;  2VAS A;  1W0B A;  4IRE A;  3WI3 A;  2W8G A;  2NW8 A;  2HN1 A;  1UW6 A;  1YQ4 A;  2IC6 A;  2D2S A;  4UEL A;  2B1E A;  4X65 T;  4ZS3 A;  5F8P A;  2ACZ A;  1BR4 A;  4YJ2 E;  1IBK T;  5E0O A;  5KE4 A;  4DBQ A;  4IDO A;  2YK0 A;  2YIN A;  4UV8 B;  5FY7 A;  3WTJ A;  5J2T E;  3AA1 B;  5DQW A;  3F57 A;  4JLE A;  4ERR A;  4LF4 T;  4LF5 T;  4PNI A;  5KXJ A;  1MNE A;  2BKO A;  5CFB A;  5FKY A;  1D1A A;  3VR8 A;  4FJO A;  3DJB A;  2BS2 A;  3Q9D A;  2X9X A;  2YDR A;  4EYU A;  1I9B A;  4HFC A;  4NUU A;  3WTI A;  1QUU A;  3EDV A;  4OYK A;  3RQU A;  2W00 A;  2XZ6 A;  4B3S T;  5TAO A;  3HKE E;  1UGO A;  3U8L A;  3N5L A;  4BAY B;  3FB2 A;  3Q5D A;  4D01 A;  1BR0 A;  4HWC A;  2E8I A;  3K3O A;  2W2U A;  2C5I T;  4U72 A;  4EZ1 A;  3K1S A;  2A3D A;  3AE5 A;  3RX6 A;  3PUV F;  2NW7 A;  4TV8 E;  2V6Y B;  4I43 B;  2D5U A;  4QKN A;  3CQG B;  2JPF A;  2BBJ A;  4XK9 A;  3C84 A;  2BR8 A;  1IZN B;  1FMW A;  2D9D A;  2K24 A;  4AKH A;  3UUX B;  2WZH A;  4I4T E;  1OXZ A;  2CBI A;  4TN7 B;  4PK6 A;  2CWY A;  2I6H A;  2YME A;  4B6X A;  2IML A;  5LBM A;  2PTF A;  2M6B A;  3SH1 A;  4NIQ A;  5FP3 A;  4HWF A;  4TV9 E;  4ZI3 C;  4JEU B;  3OPC A;  3P50 A;  1KNZ A;  1E1H B;  3JAD A;  4PAG A;  2BG9 B;  4GIW A;  3T1Y T;  4B3M T;  5C2T A;  2V6Y A;  3PUZ F;  4YJ3 E;  5CA1 E;  4YXD A;  5EK2 A;  4AQF C;  1UK5 A;  2WM9 A;  1U5P A;  4QH1 A;  1N32 T;  2XAH B;  5F3J A;  3FBL A;  2CBJ A;  4DVD A;  2DI4 A;  3UFG A;  2FBW A;  2XZE A;  4HQP A;  1Y64 B;  1Z8U A;  2J47 A;  2UUC T;  1NWM X;  2M6I A;  5L3D B;  5KZU A;  3CVR A;  4U31 A;  1D0Z A;  4NXN T;  5HEU A;  4X62 T;  4UR9 A;  2Z6E A;  3R84 B;  5HCJ A;  4LMK A;  5CGM A;  3AEG A;  2VK9 A;  5AQG B;  4UVA B;  3AED A;  5FVK A;  2BG9 A;  4X1K E;  2QGS A;  4YSX A;  3U8N A;  2XAG B;  3HR0 A;  3PUA A;  4QH5 A;  1T8B A;  2H7V C;  3H3A A;  2D0U A;  4JBW F;  4A56 A;  3O1H A;  2K3W A;  3FZL B;  4H9N C;  2LM9 A;  4DV2 T;  5JQG E;  2LHN A;  4O4I E;  4Z8X A;  4JV5 T;  4F8H A;  3OYX A;  4OK0 A;  2QA7 A;  5AFU L;  3N9M A;  4O2A E;  4B5D A;  1WFD A;  3PV0 F;  3AEC A;  2ZLY A;  2LKH A;  2WWV A;  3CQC B;  3PUW F;  2IIU A;  4DR7 T;  4AFH A;  4U2Z A;  2HN2 A;  4X5T A;  4Z90 A;  4HKA A;  1ZEE A;  1HR0 T;  4CN1 A;  3RIU C;  5AQN B;  2N9D A;  4YHH T;  5EZY E;  3WTH A;  2WDQ A;  2CRB A;  3T8O A;  3AA6 B;  4QXH B;  3AEE A;  3AE2 A;  2Y58 A;  2VQF T;  3QC9 A;  2W61 A;  5F5W A;  5HCM A;  3KFW X;  4EEB A;  2XQY A;  1HG5 A;  5AQU B;  4MFR A;  4IST A;  2VWA A;  3BQK A;  3T4M A;  5JTG A;  3ZCJ A;  2A9U A;  3K8P C;  4DV6 T;  2YEV C;  2BKN A;  5DJQ C;  3SIO A;  2V7J A;  2OLT A;  2XQ8 A;  1NEN A;  4H9P C;  2X00 A;  3R6N A;  3C50 A;  2ZJU A;  1HNX T;  1Y01 A;  4ZJS A;  2X9W A;  5AFJ A;  2DCF A;  2XYS A;  2DHR A;  4HFV A;  4BJM A;  2XJ7 A;  4ZZC A;  2VKH A;  2BDE A;  5AQV B;  3JAF A;  3WTM A;  1N36 T;  2G0U A;  1ZKE A;  4U33 A;  4P1N A;  2YN6 A;  3UT5 E;  3CK6 A;  4IE0 A;  4X64 T;  1XDP A;  3A7M A;  3I1A A;  3PUQ A;  4X66 T;  4LF6 T;  3AE8 A;  3OYZ A;  4DBR A;  4H63 H;  5JDL A;  3ONX A;  5AQI B;  5L3G B;  2CHN A;  3TKL B;  3SWH A;  3DP7 A;  2AE9 A;  1MMA A;  2XNT A;  2BVM A;  2JMK A;  1HG2 A;  3MAC A;  2CXF A;  3PUX F;  3EUH A;  3WTK A;  1OED A;  1XNR T;  3O1J A;  4H9Q C;  1VCT A;  4BFQ A;  4FI5 A;  3CX8 B;  5ABE A;  4PJL A;  3QOF A;  2BS4 A;  2YMD A;  2X67 A;  2V7K A;  4ILC A;  4CN6 A;  2EHO D;  2LSG A;  4IL4 A;  3CPZ A;  5AQL B;  3ZMV B;  3PUG A;  1ZOY A;  2K9A A;  4QAB A;  3EDU A;  4QH4 A;  5LHG B;  2B76 A;  4H63 V;  3V5U A;  5DQV A;  1WYC A;  2MOZ A;  1MND A;  2CPT A;  1J5E T;  2WP9 A;  3C4Z A;  2SPC A;  5LB7 B;  3A5X A;  1HX1 B;  1JNZ A;  3B13 A;  4JEH B;  3Q5W A;  4CI3 B;  4PJN A;  4O4H E;  2QC1 B;  2JQQ A;  4A98 A;  2XTL A;  3QB5 A;  5LGU B;  5FVL A;  2XUE A;  3RYC E;  2XAF B;  4L9I A;  4ILU A;  5AQO B;  5DAB A;  1WLX A;  2Y6X A;  2VVN A;  1MMN A;  5LG3 A;  3CX7 B;  2RP4 A;  5JDQ A;  1MMG A;  5SYO A;  4BA9 A;  2NWB A;  3AVS A;  3ZDH A;  1B7T A;  2WZY A;  1T7S A;  3CIR A;  5L47 A;  5BP0 A;  2XSA A;  4LFC T;  3PUY F;  3TLS A;  3ETV A;  4MBQ A;  5FJV A;  3RLF F;  4I0U A;  3NRX A;  3L09 A;  3RPU A;  4YSZ A;  2KND A;  1UX2 A;  5J0Z A;  4KUM B;  3VU7 H;  1HFA A;  2D0T A;  2FJE A;  3SRZ A;  1HCI A;  2LLY A;  4KI0 F;  5JRE A;  1WR6 A;  3ZSS A;  1GQE A;  3ONL C;  4GK5 E;  2KSR A;  2HH7 A;  3RYF E;  5H6Q B;  1S94 A;  3U78 A;  1KF6 A;  3N2G E;  4YHJ A;  5JDF A;  5IUX A;  2BKP A;  1WRD A;  4IDQ A;  4XBF B;  2FJD A;  1US7 B;  4HE8 A;  3OKQ A;  5CO5 A;  2XM1 A;  3RI5 A;  2W0G A;  3EI0 A;  5LHH B;  3KDS E;  1W0A A;  1SA0 E;  2IDO B;  2XQA A;  2ZM2 A;  1LRZ A;  4QAA A;  3IEE A;  3P4P A;  3VKH A;  2IW5 B;  5AFL A;  5ETW A;  2RA1 A;  3WAK A;  3IA3 A;  4ZOL E;  1O3X A;  2F4V T;  2BYR A;  3I9W A;  3GN5 B;  4AI6 A;  2XM2 A;  4MHC A;  3U8M A;  2M67 A;  4U7Y A;  3AAI A;  4NUV A;  4IHJ E;  1M62 A;  3ZMS B;  1BR2 A;  1XWM A;  2WWU A;  4FRR A;  5J5I A;  2WZI A;  1U4Q A;  4U2Y A;  4H9R C;  1T98 A;  1KK7 A;  3AAE B;  3BQI A;  2LSJ A;  4ADZ A;  4PK4 A;  3PTR B;  4EZH A;  4DID B;  4IE5 A;  3FXE B;  4GK0 E;  4UM3 P;  4DR5 T;  5HXE A;  3OVU A;  3FZH B;  4EOZ B;  2YDQ A;  3F31 A;  5CB4 E;  3ZC1 A;  5HEJ A;  2JJ9 A;  2BG9 E;  4WZX A;  5AQJ B;  4DBM A;  3CKD A;  5JR9 B;  4DR6 T;  4LFA T;  3AEF A;  1D0X A;  4TX5 A;  2DNX A;  1KNP A;  2CWO A;  4C91 A;  3HL6 A;  5FL0 A;  2CE7 A;  5L3B B;  3ONJ A;  5FXZ A;  3GN5 A;  4HWD A;  1FMV A;  5AFM B;  5J5G A;  4C90 A;  3ZEF B;  2WY2 A;  3RRW A;  2PG8 A;  4EV6 A;  5JRC A;  2E9X D;  4U3C A;  2YKS A;  1LKX A;  4EAH A;  2YDS A;  4QXC B;  2Q9Q D;  2HHH T;  1D0Y A;  5FXW A;  3O4X E;  4JI7 T;  4OYJ A;  1XMO T;  2VQE T;  2XNV A;  5KMG P;  3NRY A;  3EAM A;  2V26 A;  2W4X A;  4A5X A;  2X51 A;  2P9B A;  3X1D A;  3ZMT B;  1G8X A;  4EYY R;  4EZ4 A;  5JR9 A; 
#chains in the Genus database with same CATH homology
 5HEU A;  2BYQ A;  2XQ6 A;  2XQ9 A;  3RIA A;  2PH9 A;  3C84 A;  4FRR A;  4XK9 A;  4IL9 A;  1UV6 A;  5SYO A;  5AFN A;  5J5F A;  2BR8 A;  4HFI A;  5AIN A;  5HCJ A;  4LMK A;  5HEH A;  3P4W A;  4XHE A;  3WIP A;  3WTJ A;  2YOE A;  5HCM A;  2Y57 A;  3WTK A;  3ZDH A;  1OED A;  4Z91 A;  4HFB A;  2WZY A;  3RQW A;  2WNL A;  2WNC A;  2BG9 A;  2ZJV A;  3U8N A;  4BFQ A;  5HEG A;  5L47 A;  5BP0 A;  4UM3 P;  5L4H A;  5BRX A;  4ZR6 A;  5AFM A;  3LSV A;  3GUA A;  4QH5 A;  3TLS A;  3RHW A;  3U8K A;  5J5H A;  2LKG A;  2XYT A;  3UU6 A;  2XZ5 A;  2YME A;  2UZ6 A;  5HEJ A;  3TLW A;  2YMD A;  4UM3 A;  5FJV A;  4ILC A;  3T4M A;  3UU5 A;  2BG9 E;  5CFB A;  1OED C;  2M6B A;  2VL0 A;  5TVC A;  3PEO A;  2BYP A;  4UM3 S;  3UQ4 A;  4IL4 A;  2BG9 C;  3UU3 A;  1UX2 A;  4NPP A;  5J0Z A;  2W8F A;  3C79 A;  4PIR A;  4UM1 A;  3SH1 A;  3SIO A;  4DBM A;  4TNW A;  2BJ0 A;  4ZK4 A;  2XQ8 A;  2BR7 A;  4ALX A;  4LML A;  4TWH A;  5AFK A;  3TLV A;  5JME A;  2LLY A;  2WNJ A;  2X00 A;  4HFE A;  5HEO A;  3WTO A;  2ZJU A;  4F8H A;  4COF A;  1I9B A;  2XNU A;  4QAB A;  3P50 A;  3WTN A;  4AFG A;  2KSR A;  4HFC A;  3JAD A;  4UXU A;  3ZKR A;  4ZJS A;  5AFJ A;  3U8J A;  2XQ3 A;  4A97 A;  2XYS A;  2BG9 B;  2WN9 A;  3WTI A;  1OED E;  5J5I A;  4QH4 A;  3RQU A;  4B5D A;  4ZZC A;  2XZ6 A;  5IUX A;  5AFM B;  4ZRU A;  2LKH A;  2X00 D;  2XQ5 A;  3SQ6 A;  3U8L A;  3JAF A;  4TWD A;  3WTM A;  3UUB A;  5L4E A;  3TLT A;  3UU4 A;  5AFH A;  4AFT A;  5J5G A;  4AFH A;  5CO5 A;  3SQ9 A;  4X5T A;  4Z90 A;  3RI5 A;  3WTL A;  4D01 A;  2BYN A;  3EI0 A;  4LMJ A;  3JAE A;  2YN6 A;  4HFH A;  2PGZ A;  4QH1 A;  2XQA A;  3UQ7 A;  1OED B;  3IGQ A;  2YKS A;  2QC1 B;  2XQ7 A;  3TLU A;  2XQ4 A;  4ZZB A;  3PMZ A;  4QAA A;  3ZDG A;  4ZK1 A;  3EHZ A;  4TWF A;  4A98 A;  2BYS A;  2Y54 A;  5BW2 A;  4ILB A;  3RIF A;  4BQT A;  2MAW A;  2LM2 A;  2Y56 A;  5AFL A;  2XNV A;  4EZ1 A;  4IRE A;  2W8G A;  4HQP A;  1UW6 A;  3WTH A;  4UY2 A;  3EAM A;  5LXB A;  2BYR A;  4NZB A;  2C9T A;  3UU8 A;  4ILA A;  2M6I A;  3U8M A;  4ZJT A;  5KZU A;  5LG3 A;  2Y58 A;  2XNT A;  5KE4 A;  4TNV A;  4QAC A;  4HFD A;  4WV9 A;  2Y7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...