4IL9A

The pentameric ligand-gated ion channel glic a237f in complex with bromide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4il9A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4il9A01
5CFBA 2Y57A 3ZKRA 3UU3A 4UXUA 2X00A 3U8NA 2XQ6A 5HEJA 2XYTA 5LG3A 4QH4A 4UM3A 2XQ9A 4FRRA 4BFQA 4DBMA 4HFCA 2ZJVA 2KSRA 4UY2A 3SQ9A 5AFKA 4B5DA 2XNUA 3WTJA 3SH1A 5J5FA 5AFJA 5BRXA 5JMEA 5J5GA 4ILCA 2XNTA 3UU5A 2YKSA 3JAEA 4HFHA 3WTLA 3RIAA 2BYSA 2XZ5A 3IGQA 5HEGA 3SIOA 5J5HA 2LM2A 5J0ZA 4AFGA 2BG9B 1OEDC 4QH1A 2WNJA 5KZUA 2QC1B 3RI5A 2BYRA 2UZ6A 2VL0A 5BW2A 4EZ1A 4XK9A 3UQ7A 4A98A 2XQ3A 5HEOA 5L47A 4TNVA 2PH9A 3RIFA 5FJVA 2BG9E 4UM1A 4IREA 5J5IA 5AFLA 2M6BA 4LMJA 3WTKA 4ILBA 2Y56A 2Y54A 3TLTA 5AFMA 2W8GA 4LMLA 2BR7A 3U8MA 2YN6A 4QH5A 4ZZBA 5AFHA 4QACA 5CO5A 2XZ6A 3GUAA 2BG9A 4HQPA 4ZZCA 2M6IA 4NZBA 4QABA 5HEHA 4TWFA 4HFDA 1OEDB 5L4HA 4IL4A 3P50A 3WTOA 4WV9A 4A97A 2BYPA 2LKGA 2LKHA 2Y58A 2LLYA 4QAAA 3WTMA 5AINA 5BP0A 5L4EA 3JADA 2XNVA 3JAFA 2Y7YA 3TLUA 3C84A 2X00D 2YOEA 4COFA 2W8FA 3U8KA 5TVCA 5AFMB 3RHWA 1OEDE 2BYNA 3UU6A 1I9BA 4TNWA 2ZJUA 2XQ5A 2YMEA 2BJ0A 4HFIA 4IL9A 3RQWA 3UUBA 3C79A 2WNLA 3PMZA 4UM3S 3TLVA 3EI0A 3LSVA 2C9TA 2XYSA 4X5TA 1OEDA 5IUXA 3UQ4A 4TWDA 5AFNA 3TLWA 2XQ8A 2XQ4A 4HFBA 2PGZA 2XQAA 5HEUA 3P4WA 4PIRA 5SYOA 4UM3P 3SQ6A 4ALXA 5KE4A 2MAWA 1UX2A 2WZYA 2WNCA 4LMKA 4ZJTA 3WIPA 4TWHA 3WTIA 3UU4A 3WTNA 3TLSA 1UV6A 5HCMA 3U8JA 4BQTA 4Z91A 2BR8A 3WTHA 2BG9C 3EAMA 4HFEA 4XHEA 4ZJSA 1UW6A 3PEOA 4ZK4A 4ZK1A 4AFHA 2YMDA 3EHZA 4ZRUA 4D01A 3ZDGA 5HCJA 3U8LA 4ILAA 3RQUA 4AFTA 4F8HA 4Z90A 3ZDHA 5LXBA 2WN9A 2XQ7A 3UU8A 4ZR6A 3T4MA 4NPPA 2BYQA
chains in the Genus database with same CATH superfamily
3NZQA 3KDSE 2WBLA 4A5XA 4DBMA 3AE6A 3G06A 5J5GA 2QVAA 1MIYA 3RLFF 5KX5E 2LJLA 2W63A 3KVBA 1M7KA 2L3LA 4I4TE 2UXNB 1HFAA 1BR4A 3P4RA 1MNEA 2X0YA 2ZM2A 2ZLYA 3RRCA 2LSIA 4IE4A 4O4LE 1NAFA 3I1AA 2WQYA 2JIWA 4JUYA 4UVBB 4ZHQE 4WV9A 4CXXA 4LF6T 4PFPA 3GMIA 1YQ3A 5LJMA 3RKOA 3IA3A 2HPLA 3IF8B 3PMZA 1FMWA 4ZI3C 4DV6T 1HG2A 2NOXA 3EI0A 5FP3A 4LF8T 2XYSA 2MOZA 4AISA 5ABHA 2XQ8A 4WZXA 4I55E 4ALXA 1MMAA 4TV8E 4DR6T 4DIDB 3FZKB 3GN5B 4ZJTA 2XSAA 1UW6A 4ZI3D 2XHEB 4TN7B 4NXNT 5EK4A 3OJAA 1HS7A 3UU8A 3RKGA 1HF8A 4H63V 1UK5A 3AE7A 3ZJ2A 1HNZT 4O8SA 4MLKA 4YSYA 2UUAT 4AKLA 4AQFA 3K3OA 5AQRB 2NTXA 3O9XA 2CPTA 5FJVA 4UM1A 3PURA 2A2FX 1IBMT 3WTKA 2WMOA 2C5JA 2AE9A 3C4WA 2WY2A 4LMLA 3O1JA 5EK2A 2ACZA 2YDRA 3V5SA 3PE0A 2BKOA 2ZM0A 2LKHA 3HI2A 2LLYA 4KX6A 4U7IA 3ONJA 2W66A 2Q9QC 5JVDE 1IBKT 2YK0A 2H3RA 4TNWA 1HNXT 3A7MA 3E0ZA 4CI2B 5AQVB 2WZHA 5E0OA 2CWYA 4UM3S 2X67A 3CQGB 3MK7C 2W2UA 2E9XC 2PBIA 4UM3P 4HTEA 3PDYA 3KV6A 4FJOA 4TWHA 3FZMB 3RC3A 4HFEA 4AXPA 2Q9QB 2K5BB 3N9PA 4AFHA 3DJBA 4NUVA 3ZDGA 3U8LA 1XDPA 1ZOYA 3H37A 1H7CA 3AE3A 3N2OA 4KUMB 4QXHB 5LBMA 2XQ6A 2V5DA 2XQ9A 3FB2A 3SWHA 3C50A 2XASB 5AFJA 5BRXA 3PV0F 4HWCA 2XJ7A 3SIOA 5J0ZA 2I59A 4AFGA 2BG9B 4PJNA 3DTOA 3T8OA 4DV4T 3NRXA 3FBZA 5L3GB 2XQ3A 3MKDA 2BG9E 1J1JA 3O1IA 4YTNA 4PK6A 5AFHA 4QACA 1NEKA 3GUAA 1VCTA 5HAXA 4E7ZA 5AQHB 5ABGA 4IGUA 4U72A 5L3CB 4YHJA 3U78A 2V7MA 2W4XA 4COFA 3AE1A 2YMEA 3CX6B 5J2UE 2D5UA 5FXZA 1MIVA 2PG8A 1FMVA 2KWHA 3PJAA 4TWDA 3NWIA 3UT5E 2MAWA 4DR2T 2WZYA 4GKKT 1ZKEA 3U8JA 4KHPT 1YKEB 2D9DA 2XTLA 4ZS2A 2PTFA 2C0SA 1Y01A 4IDPA 5AQFB 2WN9A 3HA4A 4UR9A 4DR3T 2V7JA 5LBQB 4B6XA 4JEUB 4QH4A 2X51A 4HWIB 4O4JE 4UY2A 5KDMC 5H6RB 5BR8T 4IT4A 3PJAJ 1W9RA 3RIUC 4JI6T 2FJDA 3MZKB 5F3JA 2VL0A 2UZ6A 4MFRA 5BW2A 3LFMA 4EZ1A 2CWOA 2AXDS 4AQGA 2HN1A 2Z6EA 3NVOA 4ILBA 2Y56A 2JQQA 2Y54A 3TLTA 5LYJE 3PUYF 2MPKA 3EUHA 2P9BA 2NW7A 5ABFA 4HQPA 3Q5WA 4LF7T 4P0AA 4HFDA 1HTJF 1IBLT 3S4UA 3CWZB 1IJ6A 1BR0A 2K48A 3RYCE 5FY7A 4IIJE 3N2KE 4X20E 2DI4A 2IDOB 2X00D 2VWAA 2OA5A 2WZIA 4YFSA 5LOVE 2X0LB 2BYNA 2N2NA 5HXEA 2XQ5A 4CZZB 3NBXX 2B1EA 3ZMUB 3JC6C 2MTQA 4X1YE 2J1DG 4OFZA 3PUGA 1NWMX 4X5TA 3E22E 3TLWA 3SQ6A 3P4WA 4IE0A 1WR6A 5IHYA 4X1KE 1UCUA 3L39A 3UUXB 4JBWF 4P09A 4EV6A 2X9WA 4EEDA 3L8RA 1KEYA 2CBJA 3CX7B 3LJCA 4AFTA 2YDQA 4P1NA 2XQ7A 2OLTA 3PU8A 4XZCA 4KMCA 1T7SA 1YXRA 4CXWA 5EK3A 3OTOT 2KSRA 4JI4T 2E2AA 4BA9A 5LXTE 3SRZA 4EZ4A 4HFHA 2LEHA 3Q2MA 2XAFB 3ONLC 5J5HA 1KNZA 4QH1A 4NXMT 1S94A 2DCFA 2XUEA 2LHRA 5L47A 4YXDA 5LGUB 4YJ3E 4X65T 5LMNT 4NIQA 5JDHA 4G63A 5AQNB 2W8GA 4FI5A 1MNDA 5ADXL 4NZBA 1OEDB 4WBOA 3P50A 2H7VC 5L3DB 4A97A 3P4PA 2BYPA 5J2TE 3VKGA 3CKDA 1S35A 2WS3A 4DV0T 4BAYB 1W0AA 1OEDE 3KFWX 4B3RT 4YT0A 2XQYA 3Q5XA 4TV9E 4CN1A 1ZEEA 5CA0E 3LSVA 2H7OA 5LCYA 3OKQA 2XQAA 5JDQA 2LT3A 1N34T 3ONXA 3WIPA 2LHNA 3ZT6A 5L3FB 3AE5A 3EAMA 3OVUA 2G0UA 5FL1A 3PUSA 4ZRUA 4ILAA 3N2GE 5LGNB 1J5WA 3ZEFB 5LB7B 5HEJA 2BBJA 3PUXF 3PTRB 1XNQT 4FRRA 5AFKA 3CMLA 4B5DA 1QLBA 2IAKA 3HKDE 4UIGA 4ZEYA 5JR9C 4Q25A 5C2TA 5JDLA 2SPCA 1T8BA 2BYRA 3VR8A 1D0XA 5C3JA 3LBXA 2I6HA 4ISSA 1T72A 5JDNA 3LG7A 1ZP0A 3M3ZB 2WM9A 1HX8A 2KINB 1OXZA 2J62A 3AEEA 3C98B 2DLRA 4PJMA 4JEHB 2V7KA 3AEBA 4PW8A 2BKNA 2CBIA 1UURA 2X9YA 3ZSSA 5TAOA 3ZT7A 3RX6A 2H89A 4EYUA 2VKOA 5KE4A 4OHFA 3CIRA 2UUBT 1IAPA 3TLSA 3I0OA 5JQGE 2JMHA 2BG9C 4ZK1A 2WWVA 2VKDA 3C51A 3QOFA 2CLYB 4KI0F 1CUNA 3FZFB 2DNXA 2E5VA 4DBRA 1MMDA 4LF5T 4BFQA 3R6NA 2ZJVA 1N33T 2WMNA 2I0MA 2Q9QD 3MXZA 2V5CA 3EDVA 5ETWA 4YSXA 4M1PA 3IBPA 5HEGA 5FYMA 5F5WA 2CCQA 5KZUA 3PU3A 5AQMB 2KWIB 3JC6D 3NRYA 1UX5A 3BK9A 1KNPA 3AAIA 3HL6A 2CXLA 4ZZBA 5AQSB 2CE7A 1D1BA 2X9HA 2E8IA 4I50E 5CO5A 4DV7T 2WAUA 2IMLA 1BR1A 4MBQA 4QABA 3SOLA 2D0TA 4TWFA 4UELA 2V7LA 1WYCA 5AINA 1EZ3A 1J5ET 2VKJA 4DV5T 2KZ7B 5FNVE 3AAAB 4O2AE 5AFMB 3CQCB 5LA6E 1MIWA 4EYYR 3TLVA 2X68A 3F57A 3N9MA 2LSGA 4ZI7E 3RPUA 4V1Av 2BKPA 3W15B 1T98A 3PUVF 3SFEA 3ZYLA 3A5XA 2W67A 4ZR6A 5CFBA 1D0YA 3WAKA 3UU3A 1WRDA 5JDFA 4HFCA 3KBTA 5AQUB 2XNTA 2MBGA 2JQKA 2Q9QA 5LG4A 3EABA 4TZ4C 2CEAA 4YJ2E 2LOPA 3ZPOA 2BZBA 3MJXA 1KFYA 4LFBT 4ZS3A 3ZLIA 3AA1B 5LGTB 2BS4A 2FJBA 4JV5T 1SUMB 4WBNE 4DR4T 2LE8A 1WCRA 5FXXA 3CVRA 4LF9T 4X64T 4GOUA 4ERRA 4G2AA 2XAQB 5L4HA 3OBVE 3EDUA 2Y58A 1WLXA 5GONE 1W0BA 3Q9DA 3L09A 3Q5DA 2W61A 3MACA 4ZOLE 3U8KA 5TVCA 4JI3T 4IHJE 2VASA 4QXCB 4IL9A 3C79A 2PFVA 2C5KT 3UUBA 2W00A 1XDOA 1FIOA 1VOMA 5IUXA 5HYAA 2HHHT 4H9NC 4LF4T 2WSSV 5SYOA 5HXRA 3K3QC 3AE4A 2KNDA 3U3IA 1I94T 2NR4A 4AIUA 3HR0A 3DP7A 3JCFA 4QX7B 1LVKA 3FZLB 4MALA 4EAHA 3EVYA 4F8HA 3B13A 3K3NA 4GYSA 3C4ZA 3KVAA 2BYQA 1IJ5A 5JTGA 1G8XA 1ZV4X 4PFOA 1R8IA 4JI7T 5FY0A 1Y64B 3T1YT 2X66A 2R6GF 4UVAB 3WTLA 2EHOD 4QWNB 2DWGA 3ETUA 4HN9A 1JNZA 2WU2A 1OEDC 5DABA 2WB5A 3VHLA 2KLQA 3RI5A 3C4XA 3RH3A 2V7IA 1LKXA 3AA7B 4HKAA 2WDVA 1HX1B 3WAJA 4TNVA 2M6BA 4LMJA 1HCIA 2LOSA 4JLEA 2M67A 4ASKA 2GK9A 4DO0A 1YQ4A 2QRXA 4CXYA 4IL4A 3LK2B 3ZYMA 5L3EB 4ISTA 1VRBA 4AQYT 2XNVA 4PK4A 3GN5A 2JPFA 4H63H 3AXJA 2W8FA 2NWBA 4O4IE 3QUJA 2B76A 4ANJA 4HFBA 2A3DA 2WNCA 1QSDA 5AQKB 3AECA 3PUQA 3AXJB 4K0UA 2F4VT 3QK6A 1FEWA 1W09A 2BDEA 2Y48B 4Z90A 2J4GA 1CHUA 4F6RC 2CXDA 2FJEA 5L2LA 2XAJB 4XBFB 3ZMVB 2C5IT 3ANWB 5ABEA 3AEDA 4IE6A 3WTJA 3ZMTB 5JMEA 4ZXLA 2XSBA 4ILUA 4XAXB 4TX5A 1AJ3A 3GA8A 3AEAA 1YW0A 2PH9A 4L5GA 5HXCA 3I9WA 5AFLA 4HWFA 2RA1A 2HN2A 2ACXA 3LDQB 2FBWA 1UGOA 4IDOA 2XZ6A 1HG5A 1YKHB 1M62A 2KXPB 4OYJA 5LHIB 5AQPB 5C8YE 2V26A 3ZMSB 3LBXB 2EHOA 3QB5A 3C84A 2D2SA 2NW9A 3C64A 4U31A 1I9BA 5AQJB 4EB6E 4HFIA 1B7TA 3HKCE 1N32T 5JDMA 4C91A 2V6XA 5LHHB 3VU7H 4GYRA 4B3TT 4IE7A 2IC9A 5HEUA 5FKYA 4CQIA 2WDRA 3ZC0A 5LHGB 2A9UA 3ZJ1A 2EHOB 4JI2T 2K24A 4AI6A 2K3WA 4ZJSA 3PEOA 5EZYE 4KBMB 5HCJA 1NENA 3AA6B 4J2CA 3E08A 1GQEA 3FXEB 3AEGA 3ZKRA 1X9BA 4UV8B 1WR0A 5LG3A 4EZHA 5CA1E 2L9QA 3SQ9A 5HWYA 4GIWA 3SH1A 4HWDA 4N78D 2OV9A 3ESLA 2ZM6T 5JH7E 3B57A 2XZ5A 4JI0T 3BQLA 5ABFB 2UU9T 2QC1B 5AQOB 2ZM8A 3UUNA 3UQ7A 2YU2A 1ZHCA 3F2EA 1XWMA 4DUZT 5CJ5A 5KXJA 4HEAA 3VRBA 4LFCT 3UFEA 4U3CA 2IC6A 3RYIE 5BP0A 3WTMA 3ZCIA 3JAFA 5BMVE 1UX4A 4JI8T 1KK7A 2W62A 1FJGT 3AVRA 4IE5A 2LSKA 2CA5A 2H88A 4ZI2D 3ZMZB 5JR9A 4GKJT 5LJNA 4PJLA 3H3MA 1QUUA 3UQ4A 2XQ4A 3F31A 4PIRA 2QGSA 2UUCT 5FXWA 3KV5A 3LK42 5CGMA 3P4SA 4HWHA 2Y8DA 1WYBA 4O4HE 1SA0E 5KMGP 1MMGA 4D01A 2Y6XA 1SHZC 2E9XB 3IEEA 5JREA 1MMNA 4U74A 2VQET 3PUWF 4PK5A 4UXUA 1G73A 3RYFE 2X00A 2XYTA 2VQFT 2D0UA 2V8SV 4QX8B 4I0UA 4EXTA 3UU5A 5FMNA 3K1SA 3RIAA 2RP4A 3IGQA 4PAGA 5JDGA 1OWAA 1I6ZA 4BJMA 2VL8A 5HXHA 1YD8G 2HPJA 1IZNB 3OPCA 3I9YA 4MHCA 4OYKA 3U8MA 2YN6A 4QH5A 3WI3A 3VR9A 3AAEB 2BG9A 3BQKA 2ODVA 5HEHA 3FBLA 2KT9A 2VVNA 3ABVA 2XM1A 2LKGA 4QAAA 1E1HB 3NKZA 2BBHA 1XNRT 2UXXB 3RHWA 4AQFC 5CB4E 4UXNB 2BJ0A 2XY8B 2UXDT 4CN4A 4A56A 3AB3B 1U5PA 2JRKA 1UX2A 4QHOA 3ANWA 3LK3B 5AFUL 3N9QA 2KMFA 4AKRB 2BR8A 4IDQA 1WFDA 4Z8XA 3KV4A 5AQGB 2BS3A 5JR9B 2JQ9A 2Y57A 2LRLA 3SS1A 1Z8UA 3R84B 4YTPA 4AKGA 4WW0A 2N1GA 4DR7T 3IHRA 5J5FA 3OYXA 2BVLA 3ZC1A 4QXBB 2DHRA 3ZN1B 2E9XA 4NUUA 3SFDA 4H9RC 3NZPA 4DR1T 3RYHE 1JNRA 2RPAA 4H9PC 3KINB 2XM2A 4CN6A 1UUSA 2X0HA 2BS2A 5DJQC 4YLHA 2NTYA 5LP6E 4U7YA 2A72A 2Y7YA 3AE2A 4ZI2C 5FVLA 2HH7A 3N9NA 3O1HA 4L0RA 2IW5B 4CI1B 4DMWA 5IWAT 1N36T 4EEBA 1L0VA 4AKHA 1E2AA 3TKLB 3VRAA 3UUMA 2XAHB 2YU1A 4JI5T 5HXSA 1UV6A 3WTHA 1LVFA 2YMDA 2JJ9A 3MA9A 3RQUA 5LNKA 3PUAA 4IDNA 4OK0A 3L3PA 4H9SE 3N9OA 5A1LA 2IIUA 3AE9A 2FUPA 4EGWA 3N5LA 2NP9A 1LRZA 4U2YA 4YSZA 3UULA 4WYVA 4EOZB 4DV2T 4ILCA 4UV9B 4HFVA 3ZN0B 5FVKA 3D0TA 2BYSA 3ETVA 3OYZA 3T1HT 2E9XD 2DL1A 3RF1A 4CI3B 3ZSTA 5AQIB 4IREA 2CHNA 3FXDB 4PNIA 1DU2A 1D0ZA 4YHHT 1BR2A 4DUYT 2WDQA 1HR0T 2MYSA 4E7SA 2DWKA 2LSYA 4DR5T 4KHZF 3JADA 4GK0E 5DQVA 3TLUA 2IHR1 3ZYKA 4HE8A 2CRBA 4C90A 4L9IA 4EIWA 2E5LT 3FZHB 3RIUA 4DMVA 2XZEA 2ZMAA 3I0QA 4JYAT 4YY3T 1OEDA 3HKEE 5AFNA 4X66T 5J1GA 3RC8A 3J7Yq 2LM9A 3UU4A 4BQTA 4LFAT 4DVDA 2IUBA 2XPKA 4GK5E 2BVMA 5IYZE 2J47A 5LXBA 4BJNA 2FJAA 4P0BA 4NPPA 2N9DA 4U33A 3U8NA 4DNDA 3N9LA 1US7B 4DBQA 4ADZA 4DV1T 2VVSA 2NW8A 2WP9A 3AEFA 2UXCT 1D1AA 2XNUA 1KF6A 2PJQA 4WNKA 2YKSA 3JAEA 4KP3C 2VB6A 3A8YC 3AVSA 3AE8A 2JQHA 2WNJA 3H3AA 3P8CD 5AQLB 4XK9A 4A98A 5HEOA 3RIFA 3O4XE 5FXVA 5AFMA 2BR7A 5F8PA 2LSJA 1U4QA 1SE7A 3M65A 2M6IA 1XZYA 1D1CA 4UF0A 3PUZF 5DQWA 3CK6A 5HWXA 2ZJUA 5AQTB 4H9OC 3RQWA 2WNLA 2W0GA 1XMOT 2CXFA 4UF0B 2CMRA 1X79A 2VKHA 1Z0PA 2WU5A 3QB5K 2UXBT 2CHOA 4UEMA 4LMKA 2YEVC 3CPZA 4TUYE 3Q5EA 5HCMA 4OX9T 5JRCA 4XHEA 4ZK4A 4H9QC 2K9AA 3V5UA 2JMKA 4X1IE 3T4MA 1HNWT 4K0KT 1E7PA 1KNRA 3UFGA 3CQXC 4UVCB 3HKBE 4UM3A 2L8KA 4QKNA 2V1DB 3P7IA 4JI1T 2EHOC 5JRCB 2LM2A 4O2BE 3GWHA 2CLYC 5FL0A 3VKHA 2LRKA 3J9X1 5FY1A 3QNUA 5H6QB 4DV3T 4AKIA 5J5IA 3RRWA 5AQQB 1VCSA 3K8PC 3ZT5A 3ZCJA 3X1DA 1O3XA 3CX8B 4ZZCA 5M4YA 5L3BB 5LMUT 2WCAA 4PJJA 3QC9A 3WTOA 2YINA 3BQIA 3RGLA 5L4EA 2CM0A 4IDZA 2YOEA 3KBUA 2V6YB 4I43B 3UU6A 2X9XA 3B5MA 2ES0A 2YDSA 3AA0B 4U2ZA 4B3MT 2C9TA 3UTKA 3FHNA 2PGZA 2ODUA 2QA7A 4HGAA 4YTMA 2XAGB 3P4QA 3WTIA 3WTNA 2QYWA 2WWUA 2VK9A 2V6YA 1XMQT 4Z91A 3EHZA 2VURA 4B3ST 3ZDHA 3KV9A 1V9DA 4X62T
chains in the Genus database with same CATH topology
5CFBA 2Y57A 3ZKRA 3UU3A 4UXUA 2X00A 3U8NA 2XQ6A 5HEJA 2XYTA 5LG3A 4QH4A 4UM3A 2XQ9A 4FRRA 4BFQA 4DBMA 4HFCA 2ZJVA 2KSRA 4UY2A 3SQ9A 5AFKA 4B5DA 2XNUA 3WTJA 3SH1A 5J5FA 5AFJA 5BRXA 5JMEA 5J5GA 4ILCA 2XNTA 3UU5A 2YKSA 3JAEA 4HFHA 3WTLA 3RIAA 2BYSA 2XZ5A 3IGQA 5HEGA 3SIOA 5J5HA 2LM2A 5J0ZA 4AFGA 2BG9B 1OEDC 4QH1A 2WNJA 5KZUA 2QC1B 3RI5A 2BYRA 2UZ6A 2VL0A 5BW2A 4EZ1A 4XK9A 3UQ7A 4A98A 2XQ3A 5HEOA 5L47A 4TNVA 2PH9A 3RIFA 5FJVA 2BG9E 4UM1A 4IREA 5J5IA 5AFLA 2M6BA 4LMJA 3WTKA 4ILBA 2Y56A 2Y54A 3TLTA 5AFMA 2W8GA 4LMLA 2BR7A 3U8MA 2YN6A 4QH5A 4ZZBA 5AFHA 4QACA 5CO5A 2XZ6A 3GUAA 2BG9A 4HQPA 4ZZCA 2M6IA 4NZBA 4QABA 5HEHA 4TWFA 4HFDA 1OEDB 5L4HA 4IL4A 3P50A 3WTOA 4WV9A 4A97A 2BYPA 2LKGA 2LKHA 2Y58A 2LLYA 4QAAA 3WTMA 5AINA 5BP0A 5L4EA 3JADA 2XNVA 3JAFA 2Y7YA 3TLUA 3C84A 2X00D 2YOEA 4COFA 2W8FA 3U8KA 5TVCA 5AFMB 3RHWA 1OEDE 2BYNA 3UU6A 1I9BA 4TNWA 2ZJUA 2XQ5A 2YMEA 2BJ0A 4HFIA 4IL9A 3RQWA 3UUBA 3C79A 2WNLA 3PMZA 4UM3S 3TLVA 3EI0A 3LSVA 2C9TA 2XYSA 4X5TA 1OEDA 5IUXA 3UQ4A 4TWDA 5AFNA 3TLWA 2XQ8A 2XQ4A 4HFBA 2PGZA 2XQAA 5HEUA 3P4WA 4PIRA 5SYOA 4UM3P 3SQ6A 4ALXA 5KE4A 2MAWA 1UX2A 2WZYA 2WNCA 4LMKA 4ZJTA 3WIPA 4TWHA 3WTIA 3UU4A 3WTNA 3TLSA 1UV6A 5HCMA 3U8JA 4BQTA 4Z91A 2BR8A 3WTHA 2BG9C 3EAMA 4HFEA 4XHEA 4ZJSA 1UW6A 3PEOA 4ZK4A 4ZK1A 4AFHA 2YMDA 3EHZA 4ZRUA 4D01A 3ZDGA 5HCJA 3U8LA 4ILAA 3RQUA 4AFTA 4F8HA 4Z90A 3ZDHA 5LXBA 2WN9A 2XQ7A 3UU8A 4ZR6A 3T4MA 4NPPA 2BYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFB A;  2Y57 A;  3ZKR A;  3UU3 A;  4UXU A;  2X00 A;  3U8N A;  2XQ6 A;  5HEJ A;  2XYT A;  5LG3 A;  4QH4 A;  4UM3 A;  2XQ9 A;  4FRR A;  4BFQ A;  4DBM A;  4HFC A;  2ZJV A;  2KSR A;  4UY2 A;  3SQ9 A;  5AFK A;  4B5D A;  2XNU A;  3WTJ A;  3SH1 A;  5J5F A;  5AFJ A;  5BRX A;  5JME A;  5J5G A;  4ILC A;  2XNT A;  3UU5 A;  2YKS A;  3JAE A;  4HFH A;  3WTL A;  3RIA A;  2BYS A;  2XZ5 A;  3IGQ A;  5HEG A;  3SIO A;  5J5H A;  2LM2 A;  5J0Z A;  4AFG A;  2BG9 B;  1OED C;  4QH1 A;  2WNJ A;  5KZU A;  2QC1 B;  3RI5 A;  2BYR A;  2UZ6 A;  2VL0 A;  5BW2 A;  4EZ1 A;  4XK9 A;  3UQ7 A;  4A98 A;  2XQ3 A;  5HEO A;  5L47 A;  4TNV A;  2PH9 A;  3RIF A;  5FJV A;  2BG9 E;  4UM1 A;  4IRE A;  5J5I A;  5AFL A;  2M6B A;  4LMJ A;  3WTK A;  4ILB A;  2Y56 A;  2Y54 A;  3TLT A;  5AFM A;  2W8G A;  4LML A;  2BR7 A;  3U8M A;  2YN6 A;  4QH5 A;  4ZZB A;  5AFH A;  4QAC A;  5CO5 A;  2XZ6 A;  3GUA A;  2BG9 A;  4HQP A;  4ZZC A;  2M6I A;  4NZB A;  4QAB A;  5HEH A;  4TWF A;  4HFD A;  1OED B;  5L4H A;  4IL4 A;  3P50 A;  3WTO A;  4WV9 A;  4A97 A;  2BYP A;  2LKG A;  2LKH A;  2Y58 A;  2LLY A;  4QAA A;  3WTM A;  5AIN A;  5BP0 A;  5L4E A;  3JAD A;  2XNV A;  3JAF A;  2Y7Y A;  3TLU A;  3C84 A;  2X00 D;  2YOE A;  4COF A;  2W8F A;  3U8K A;  5TVC A;  5AFM B;  3RHW A;  1OED E;  2BYN A;  3UU6 A;  1I9B A;  4TNW A;  2ZJU A;  2XQ5 A;  2YME A;  2BJ0 A;  4HFI A;  4IL9 A;  3RQW A;  3UUB A;  3C79 A;  2WNL A;  3PMZ A;  4UM3 S;  3TLV A;  3EI0 A;  3LSV A;  2C9T A;  2XYS A;  4X5T A;  1OED A;  5IUX A;  3UQ4 A;  4TWD A;  5AFN A;  3TLW A;  2XQ8 A;  2XQ4 A;  4HFB A;  2PGZ A;  2XQA A;  5HEU A;  3P4W A;  4PIR A;  5SYO A;  4UM3 P;  3SQ6 A;  4ALX A;  5KE4 A;  2MAW A;  1UX2 A;  2WZY A;  2WNC A;  4LMK A;  4ZJT A;  3WIP A;  4TWH A;  3WTI A;  3UU4 A;  3WTN A;  3TLS A;  1UV6 A;  5HCM A;  3U8J A;  4BQT A;  4Z91 A;  2BR8 A;  3WTH A;  2BG9 C;  3EAM A;  4HFE A;  4XHE A;  4ZJS A;  1UW6 A;  3PEO A;  4ZK4 A;  4ZK1 A;  4AFH A;  2YMD A;  3EHZ A;  4ZRU A;  4D01 A;  3ZDG A;  5HCJ A;  3U8L A;  4ILA A;  3RQU A;  4AFT A;  4F8H A;  4Z90 A;  3ZDH A;  5LXB A;  2WN9 A;  2XQ7 A;  3UU8 A;  4ZR6 A;  3T4M A;  4NPP A;  2BYQ A; 
#chains in the Genus database with same CATH topology
 3NZQ A;  3KDS E;  2WBL A;  4A5X A;  4DBM A;  3AE6 A;  3G06 A;  5J5G A;  2QVA A;  1MIY A;  3RLF F;  5KX5 E;  2LJL A;  2W63 A;  3KVB A;  1M7K A;  2L3L A;  4I4T E;  2UXN B;  1HFA A;  1BR4 A;  3P4R A;  1MNE A;  2X0Y A;  2ZM2 A;  2ZLY A;  3RRC A;  2LSI A;  4IE4 A;  4O4L E;  1NAF A;  3I1A A;  2WQY A;  2JIW A;  4JUY A;  4UVB B;  4ZHQ E;  4WV9 A;  4CXX A;  4LF6 T;  4PFP A;  3GMI A;  1YQ3 A;  5LJM A;  3RKO A;  3IA3 A;  2HPL A;  3IF8 B;  3PMZ A;  1FMW A;  4ZI3 C;  4DV6 T;  1HG2 A;  2NOX A;  3EI0 A;  5FP3 A;  4LF8 T;  2XYS A;  2MOZ A;  4AIS A;  5ABH A;  2XQ8 A;  4WZX A;  4I55 E;  4ALX A;  1MMA A;  4TV8 E;  4DR6 T;  4DID B;  3FZK B;  3GN5 B;  4ZJT A;  2XSA A;  1UW6 A;  4ZI3 D;  2XHE B;  4TN7 B;  4NXN T;  5EK4 A;  3OJA A;  1HS7 A;  3UU8 A;  3RKG A;  1HF8 A;  4H63 V;  1UK5 A;  3AE7 A;  3ZJ2 A;  1HNZ T;  4O8S A;  4MLK A;  4YSY A;  2UUA T;  4AKL A;  4AQF A;  3K3O A;  5AQR B;  2NTX A;  3O9X A;  2CPT A;  5FJV A;  4UM1 A;  3PUR A;  2A2F X;  1IBM T;  3WTK A;  2WMO A;  2C5J A;  2AE9 A;  3C4W A;  2WY2 A;  4LML A;  3O1J A;  5EK2 A;  2ACZ A;  2YDR A;  3V5S A;  3PE0 A;  2BKO A;  2ZM0 A;  2LKH A;  3HI2 A;  2LLY A;  4KX6 A;  4U7I A;  3ONJ A;  2W66 A;  2Q9Q C;  5JVD E;  1IBK T;  2YK0 A;  2H3R A;  4TNW A;  1HNX T;  3A7M A;  3E0Z A;  4CI2 B;  5AQV B;  2WZH A;  5E0O A;  2CWY A;  4UM3 S;  2X67 A;  3CQG B;  3MK7 C;  2W2U A;  2E9X C;  2PBI A;  4UM3 P;  4HTE A;  3PDY A;  3KV6 A;  4FJO A;  4TWH A;  3FZM B;  3RC3 A;  4HFE A;  4AXP A;  2Q9Q B;  2K5B B;  3N9P A;  4AFH A;  3DJB A;  4NUV A;  3ZDG A;  3U8L A;  1XDP A;  1ZOY A;  3H37 A;  1H7C A;  3AE3 A;  3N2O A;  4KUM B;  4QXH B;  5LBM A;  2XQ6 A;  2V5D A;  2XQ9 A;  3FB2 A;  3SWH A;  3C50 A;  2XAS B;  5AFJ A;  5BRX A;  3PV0 F;  4HWC A;  2XJ7 A;  3SIO A;  5J0Z A;  2I59 A;  4AFG A;  2BG9 B;  4PJN A;  3DTO A;  3T8O A;  4DV4 T;  3NRX A;  3FBZ A;  5L3G B;  2XQ3 A;  3MKD A;  2BG9 E;  1J1J A;  3O1I A;  4YTN A;  4PK6 A;  5AFH A;  4QAC A;  1NEK A;  3GUA A;  1VCT A;  5HAX A;  4E7Z A;  5AQH B;  5ABG A;  4IGU A;  4U72 A;  5L3C B;  4YHJ A;  3U78 A;  2V7M A;  2W4X A;  4COF A;  3AE1 A;  2YME A;  3CX6 B;  5J2U E;  2D5U A;  5FXZ A;  1MIV A;  2PG8 A;  1FMV A;  2KWH A;  3PJA A;  4TWD A;  3NWI A;  3UT5 E;  2MAW A;  4DR2 T;  2WZY A;  4GKK T;  1ZKE A;  3U8J A;  4KHP T;  1YKE B;  2D9D A;  2XTL A;  4ZS2 A;  2PTF A;  2C0S A;  1Y01 A;  4IDP A;  5AQF B;  2WN9 A;  3HA4 A;  4UR9 A;  4DR3 T;  2V7J A;  5LBQ B;  4B6X A;  4JEU B;  4QH4 A;  2X51 A;  4HWI B;  4O4J E;  4UY2 A;  5KDM C;  5H6R B;  5BR8 T;  4IT4 A;  3PJA J;  1W9R A;  3RIU C;  4JI6 T;  2FJD A;  3MZK B;  5F3J A;  2VL0 A;  2UZ6 A;  4MFR A;  5BW2 A;  3LFM A;  4EZ1 A;  2CWO A;  2AXD S;  4AQG A;  2HN1 A;  2Z6E A;  3NVO A;  4ILB A;  2Y56 A;  2JQQ A;  2Y54 A;  3TLT A;  5LYJ E;  3PUY F;  2MPK A;  3EUH A;  2P9B A;  2NW7 A;  5ABF A;  4HQP A;  3Q5W A;  4LF7 T;  4P0A A;  4HFD A;  1HTJ F;  1IBL T;  3S4U A;  3CWZ B;  1IJ6 A;  1BR0 A;  2K48 A;  3RYC E;  5FY7 A;  4IIJ E;  3N2K E;  4X20 E;  2DI4 A;  2IDO B;  2X00 D;  2VWA A;  2OA5 A;  2WZI A;  4YFS A;  5LOV E;  2X0L B;  2BYN A;  2N2N A;  5HXE A;  2XQ5 A;  4CZZ B;  3NBX X;  2B1E A;  3ZMU B;  3JC6 C;  2MTQ A;  4X1Y E;  2J1D G;  4OFZ A;  3PUG A;  1NWM X;  4X5T A;  3E22 E;  3TLW A;  3SQ6 A;  3P4W A;  4IE0 A;  1WR6 A;  5IHY A;  4X1K E;  1UCU A;  3L39 A;  3UUX B;  4JBW F;  4P09 A;  4EV6 A;  2X9W A;  4EED A;  3L8R A;  1KEY A;  2CBJ A;  3CX7 B;  3LJC A;  4AFT A;  2YDQ A;  4P1N A;  2XQ7 A;  2OLT A;  3PU8 A;  4XZC A;  4KMC A;  1T7S A;  1YXR A;  4CXW A;  5EK3 A;  3OTO T;  2KSR A;  4JI4 T;  2E2A A;  4BA9 A;  5LXT E;  3SRZ A;  4EZ4 A;  4HFH A;  2LEH A;  3Q2M A;  2XAF B;  3ONL C;  5J5H A;  1KNZ A;  4QH1 A;  4NXM T;  1S94 A;  2DCF A;  2XUE A;  2LHR A;  5L47 A;  4YXD A;  5LGU B;  4YJ3 E;  4X65 T;  5LMN T;  4NIQ A;  5JDH A;  4G63 A;  5AQN B;  2W8G A;  4FI5 A;  1MND A;  5ADX L;  4NZB A;  1OED B;  4WBO A;  3P50 A;  2H7V C;  5L3D B;  4A97 A;  3P4P A;  2BYP A;  5J2T E;  3VKG A;  3CKD A;  1S35 A;  2WS3 A;  4DV0 T;  4BAY B;  1W0A A;  1OED E;  3KFW X;  4B3R T;  4YT0 A;  2XQY A;  3Q5X A;  4TV9 E;  4CN1 A;  1ZEE A;  5CA0 E;  3LSV A;  2H7O A;  5LCY A;  3OKQ A;  2XQA A;  5JDQ A;  2LT3 A;  1N34 T;  3ONX A;  3WIP A;  2LHN A;  3ZT6 A;  5L3F B;  3AE5 A;  3EAM A;  3OVU A;  2G0U A;  5FL1 A;  3PUS A;  4ZRU A;  4ILA A;  3N2G E;  5LGN B;  1J5W A;  3ZEF B;  5LB7 B;  5HEJ A;  2BBJ A;  3PUX F;  3PTR B;  1XNQ T;  4FRR A;  5AFK A;  3CML A;  4B5D A;  1QLB A;  2IAK A;  3HKD E;  4UIG A;  4ZEY A;  5JR9 C;  4Q25 A;  5C2T A;  5JDL A;  2SPC A;  1T8B A;  2BYR A;  3VR8 A;  1D0X A;  5C3J A;  3LBX A;  2I6H A;  4ISS A;  1T72 A;  5JDN A;  3LG7 A;  1ZP0 A;  3M3Z B;  2WM9 A;  1HX8 A;  2KIN B;  1OXZ A;  2J62 A;  3AEE A;  3C98 B;  2DLR A;  4PJM A;  4JEH B;  2V7K A;  3AEB A;  4PW8 A;  2BKN A;  2CBI A;  1UUR A;  2X9Y A;  3ZSS A;  5TAO A;  3ZT7 A;  3RX6 A;  2H89 A;  4EYU A;  2VKO A;  5KE4 A;  4OHF A;  3CIR A;  2UUB T;  1IAP A;  3TLS A;  3I0O A;  5JQG E;  2JMH A;  2BG9 C;  4ZK1 A;  2WWV A;  2VKD A;  3C51 A;  3QOF A;  2CLY B;  4KI0 F;  1CUN A;  3FZF B;  2DNX A;  2E5V A;  4DBR A;  1MMD A;  4LF5 T;  4BFQ A;  3R6N A;  2ZJV A;  1N33 T;  2WMN A;  2I0M A;  2Q9Q D;  3MXZ A;  2V5C A;  3EDV A;  5ETW A;  4YSX A;  4M1P A;  3IBP A;  5HEG A;  5FYM A;  5F5W A;  2CCQ A;  5KZU A;  3PU3 A;  5AQM B;  2KWI B;  3JC6 D;  3NRY A;  1UX5 A;  3BK9 A;  1KNP A;  3AAI A;  3HL6 A;  2CXL A;  4ZZB A;  5AQS B;  2CE7 A;  1D1B A;  2X9H A;  2E8I A;  4I50 E;  5CO5 A;  4DV7 T;  2WAU A;  2IML A;  1BR1 A;  4MBQ A;  4QAB A;  3SOL A;  2D0T A;  4TWF A;  4UEL A;  2V7L A;  1WYC A;  5AIN A;  1EZ3 A;  1J5E T;  2VKJ A;  4DV5 T;  2KZ7 B;  5FNV E;  3AAA B;  4O2A E;  5AFM B;  3CQC B;  5LA6 E;  1MIW A;  4EYY R;  3TLV A;  2X68 A;  3F57 A;  3N9M A;  2LSG A;  4ZI7 E;  3RPU A;  4V1A v;  2BKP A;  3W15 B;  1T98 A;  3PUV F;  3SFE A;  3ZYL A;  3A5X A;  2W67 A;  4ZR6 A;  5CFB A;  1D0Y A;  3WAK A;  3UU3 A;  1WRD A;  5JDF A;  4HFC A;  3KBT A;  5AQU B;  2XNT A;  2MBG A;  2JQK A;  2Q9Q A;  5LG4 A;  3EAB A;  4TZ4 C;  2CEA A;  4YJ2 E;  2LOP A;  3ZPO A;  2BZB A;  3MJX A;  1KFY A;  4LFB T;  4ZS3 A;  3ZLI A;  3AA1 B;  5LGT B;  2BS4 A;  2FJB A;  4JV5 T;  1SUM B;  4WBN E;  4DR4 T;  2LE8 A;  1WCR A;  5FXX A;  3CVR A;  4LF9 T;  4X64 T;  4GOU A;  4ERR A;  4G2A A;  2XAQ B;  5L4H A;  3OBV E;  3EDU A;  2Y58 A;  1WLX A;  5GON E;  1W0B A;  3Q9D A;  3L09 A;  3Q5D A;  2W61 A;  3MAC A;  4ZOL E;  3U8K A;  5TVC A;  4JI3 T;  4IHJ E;  2VAS A;  4QXC B;  4IL9 A;  3C79 A;  2PFV A;  2C5K T;  3UUB A;  2W00 A;  1XDO A;  1FIO A;  1VOM A;  5IUX A;  5HYA A;  2HHH T;  4H9N C;  4LF4 T;  2WSS V;  5SYO A;  5HXR A;  3K3Q C;  3AE4 A;  2KND A;  3U3I A;  1I94 T;  2NR4 A;  4AIU A;  3HR0 A;  3DP7 A;  3JCF A;  4QX7 B;  1LVK A;  3FZL B;  4MAL A;  4EAH A;  3EVY A;  4F8H A;  3B13 A;  3K3N A;  4GYS A;  3C4Z A;  3KVA A;  2BYQ A;  1IJ5 A;  5JTG A;  1G8X A;  1ZV4 X;  4PFO A;  1R8I A;  4JI7 T;  5FY0 A;  1Y64 B;  3T1Y T;  2X66 A;  2R6G F;  4UVA B;  3WTL A;  2EHO D;  4QWN B;  2DWG A;  3ETU A;  4HN9 A;  1JNZ A;  2WU2 A;  1OED C;  5DAB A;  2WB5 A;  3VHL A;  2KLQ A;  3RI5 A;  3C4X A;  3RH3 A;  2V7I A;  1LKX A;  3AA7 B;  4HKA A;  2WDV A;  1HX1 B;  3WAJ A;  4TNV A;  2M6B A;  4LMJ A;  1HCI A;  2LOS A;  4JLE A;  2M67 A;  4ASK A;  2GK9 A;  4DO0 A;  1YQ4 A;  2QRX A;  4CXY A;  4IL4 A;  3LK2 B;  3ZYM A;  5L3E B;  4IST A;  1VRB A;  4AQY T;  2XNV A;  4PK4 A;  3GN5 A;  2JPF A;  4H63 H;  3AXJ A;  2W8F A;  2NWB A;  4O4I E;  3QUJ A;  2B76 A;  4ANJ A;  4HFB A;  2A3D A;  2WNC A;  1QSD A;  5AQK B;  3AEC A;  3PUQ A;  3AXJ B;  4K0U A;  2F4V T;  3QK6 A;  1FEW A;  1W09 A;  2BDE A;  2Y48 B;  4Z90 A;  2J4G A;  1CHU A;  4F6R C;  2CXD A;  2FJE A;  5L2L A;  2XAJ B;  4XBF B;  3ZMV B;  2C5I T;  3ANW B;  5ABE A;  3AED A;  4IE6 A;  3WTJ A;  3ZMT B;  5JME A;  4ZXL A;  2XSB A;  4ILU A;  4XAX B;  4TX5 A;  1AJ3 A;  3GA8 A;  3AEA A;  1YW0 A;  2PH9 A;  4L5G A;  5HXC A;  3I9W A;  5AFL A;  4HWF A;  2RA1 A;  2HN2 A;  2ACX A;  3LDQ B;  2FBW A;  1UGO A;  4IDO A;  2XZ6 A;  1HG5 A;  1YKH B;  1M62 A;  2KXP B;  4OYJ A;  5LHI B;  5AQP B;  5C8Y E;  2V26 A;  3ZMS B;  3LBX B;  2EHO A;  3QB5 A;  3C84 A;  2D2S A;  2NW9 A;  3C64 A;  4U31 A;  1I9B A;  5AQJ B;  4EB6 E;  4HFI A;  1B7T A;  3HKC E;  1N32 T;  5JDM A;  4C91 A;  2V6X A;  5LHH B;  3VU7 H;  4GYR A;  4B3T T;  4IE7 A;  2IC9 A;  5HEU A;  5FKY A;  4CQI A;  2WDR A;  3ZC0 A;  5LHG B;  2A9U A;  3ZJ1 A;  2EHO B;  4JI2 T;  2K24 A;  4AI6 A;  2K3W A;  4ZJS A;  3PEO A;  5EZY E;  4KBM B;  5HCJ A;  1NEN A;  3AA6 B;  4J2C A;  3E08 A;  1GQE A;  3FXE B;  3AEG A;  3ZKR A;  1X9B A;  4UV8 B;  1WR0 A;  5LG3 A;  4EZH A;  5CA1 E;  2L9Q A;  3SQ9 A;  5HWY A;  4GIW A;  3SH1 A;  4HWD A;  4N78 D;  2OV9 A;  3ESL A;  2ZM6 T;  5JH7 E;  3B57 A;  2XZ5 A;  4JI0 T;  3BQL A;  5ABF B;  2UU9 T;  2QC1 B;  5AQO B;  2ZM8 A;  3UUN A;  3UQ7 A;  2YU2 A;  1ZHC A;  3F2E A;  1XWM A;  4DUZ T;  5CJ5 A;  5KXJ A;  4HEA A;  3VRB A;  4LFC T;  3UFE A;  4U3C A;  2IC6 A;  3RYI E;  5BP0 A;  3WTM A;  3ZCI A;  3JAF A;  5BMV E;  1UX4 A;  4JI8 T;  1KK7 A;  2W62 A;  1FJG T;  3AVR A;  4IE5 A;  2LSK A;  2CA5 A;  2H88 A;  4ZI2 D;  3ZMZ B;  5JR9 A;  4GKJ T;  5LJN A;  4PJL A;  3H3M A;  1QUU A;  3UQ4 A;  2XQ4 A;  3F31 A;  4PIR A;  2QGS A;  2UUC T;  5FXW A;  3KV5 A;  3LK4 2;  5CGM A;  3P4S A;  4HWH A;  2Y8D A;  1WYB A;  4O4H E;  1SA0 E;  5KMG P;  1MMG A;  4D01 A;  2Y6X A;  1SHZ C;  2E9X B;  3IEE A;  5JRE A;  1MMN A;  4U74 A;  2VQE T;  3PUW F;  4PK5 A;  4UXU A;  1G73 A;  3RYF E;  2X00 A;  2XYT A;  2VQF T;  2D0U A;  2V8S V;  4QX8 B;  4I0U A;  4EXT A;  3UU5 A;  5FMN A;  3K1S A;  3RIA A;  2RP4 A;  3IGQ A;  4PAG A;  5JDG A;  1OWA A;  1I6Z A;  4BJM A;  2VL8 A;  5HXH A;  1YD8 G;  2HPJ A;  1IZN B;  3OPC A;  3I9Y A;  4MHC A;  4OYK A;  3U8M A;  2YN6 A;  4QH5 A;  3WI3 A;  3VR9 A;  3AAE B;  2BG9 A;  3BQK A;  2ODV A;  5HEH A;  3FBL A;  2KT9 A;  2VVN A;  3ABV A;  2XM1 A;  2LKG A;  4QAA A;  1E1H B;  3NKZ A;  2BBH A;  1XNR T;  2UXX B;  3RHW A;  4AQF C;  5CB4 E;  4UXN B;  2BJ0 A;  2XY8 B;  2UXD T;  4CN4 A;  4A56 A;  3AB3 B;  1U5P A;  2JRK A;  1UX2 A;  4QHO A;  3ANW A;  3LK3 B;  5AFU L;  3N9Q A;  2KMF A;  4AKR B;  2BR8 A;  4IDQ A;  1WFD A;  4Z8X A;  3KV4 A;  5AQG B;  2BS3 A;  5JR9 B;  2JQ9 A;  2Y57 A;  2LRL A;  3SS1 A;  1Z8U A;  3R84 B;  4YTP A;  4AKG A;  4WW0 A;  2N1G A;  4DR7 T;  3IHR A;  5J5F A;  3OYX A;  2BVL A;  3ZC1 A;  4QXB B;  2DHR A;  3ZN1 B;  2E9X A;  4NUU A;  3SFD A;  4H9R C;  3NZP A;  4DR1 T;  3RYH E;  1JNR A;  2RPA A;  4H9P C;  3KIN B;  2XM2 A;  4CN6 A;  1UUS A;  2X0H A;  2BS2 A;  5DJQ C;  4YLH A;  2NTY A;  5LP6 E;  4U7Y A;  2A72 A;  2Y7Y A;  3AE2 A;  4ZI2 C;  5FVL A;  2HH7 A;  3N9N A;  3O1H A;  4L0R A;  2IW5 B;  4CI1 B;  4DMW A;  5IWA T;  1N36 T;  4EEB A;  1L0V A;  4AKH A;  1E2A A;  3TKL B;  3VRA A;  3UUM A;  2XAH B;  2YU1 A;  4JI5 T;  5HXS A;  1UV6 A;  3WTH A;  1LVF A;  2YMD A;  2JJ9 A;  3MA9 A;  3RQU A;  5LNK A;  3PUA A;  4IDN A;  4OK0 A;  3L3P A;  4H9S E;  3N9O A;  5A1L A;  2IIU A;  3AE9 A;  2FUP A;  4EGW A;  3N5L A;  2NP9 A;  1LRZ A;  4U2Y A;  4YSZ A;  3UUL A;  4WYV A;  4EOZ B;  4DV2 T;  4ILC A;  4UV9 B;  4HFV A;  3ZN0 B;  5FVK A;  3D0T A;  2BYS A;  3ETV A;  3OYZ A;  3T1H T;  2E9X D;  2DL1 A;  3RF1 A;  4CI3 B;  3ZST A;  5AQI B;  4IRE A;  2CHN A;  3FXD B;  4PNI A;  1DU2 A;  1D0Z A;  4YHH T;  1BR2 A;  4DUY T;  2WDQ A;  1HR0 T;  2MYS A;  4E7S A;  2DWK A;  2LSY A;  4DR5 T;  4KHZ F;  3JAD A;  4GK0 E;  5DQV A;  3TLU A;  2IHR 1;  3ZYK A;  4HE8 A;  2CRB A;  4C90 A;  4L9I A;  4EIW A;  2E5L T;  3FZH B;  3RIU A;  4DMV A;  2XZE A;  2ZMA A;  3I0Q A;  4JYA T;  4YY3 T;  1OED A;  3HKE E;  5AFN A;  4X66 T;  5J1G A;  3RC8 A;  3J7Y q;  2LM9 A;  3UU4 A;  4BQT A;  4LFA T;  4DVD A;  2IUB A;  2XPK A;  4GK5 E;  2BVM A;  5IYZ E;  2J47 A;  5LXB A;  4BJN A;  2FJA A;  4P0B A;  4NPP A;  2N9D A;  4U33 A;  3U8N A;  4DND A;  3N9L A;  1US7 B;  4DBQ A;  4ADZ A;  4DV1 T;  2VVS A;  2NW8 A;  2WP9 A;  3AEF A;  2UXC T;  1D1A A;  2XNU A;  1KF6 A;  2PJQ A;  4WNK A;  2YKS A;  3JAE A;  4KP3 C;  2VB6 A;  3A8Y C;  3AVS A;  3AE8 A;  2JQH A;  2WNJ A;  3H3A A;  3P8C D;  5AQL B;  4XK9 A;  4A98 A;  5HEO A;  3RIF A;  3O4X E;  5FXV A;  5AFM A;  2BR7 A;  5F8P A;  2LSJ A;  1U4Q A;  1SE7 A;  3M65 A;  2M6I A;  1XZY A;  1D1C A;  4UF0 A;  3PUZ F;  5DQW A;  3CK6 A;  5HWX A;  2ZJU A;  5AQT B;  4H9O C;  3RQW A;  2WNL A;  2W0G A;  1XMO T;  2CXF A;  4UF0 B;  2CMR A;  1X79 A;  2VKH A;  1Z0P A;  2WU5 A;  3QB5 K;  2UXB T;  2CHO A;  4UEM A;  4LMK A;  2YEV C;  3CPZ A;  4TUY E;  3Q5E A;  5HCM A;  4OX9 T;  5JRC A;  4XHE A;  4ZK4 A;  4H9Q C;  2K9A A;  3V5U A;  2JMK A;  4X1I E;  3T4M A;  1HNW T;  4K0K T;  1E7P A;  1KNR A;  3UFG A;  3CQX C;  4UVC B;  3HKB E;  4UM3 A;  2L8K A;  4QKN A;  2V1D B;  3P7I A;  4JI1 T;  2EHO C;  5JRC B;  2LM2 A;  4O2B E;  3GWH A;  2CLY C;  5FL0 A;  3VKH A;  2LRK A;  3J9X 1;  5FY1 A;  3QNU A;  5H6Q B;  4DV3 T;  4AKI A;  5J5I A;  3RRW A;  5AQQ B;  1VCS A;  3K8P C;  3ZT5 A;  3ZCJ A;  3X1D A;  1O3X A;  3CX8 B;  4ZZC A;  5M4Y A;  5L3B B;  5LMU T;  2WCA A;  4PJJ A;  3QC9 A;  3WTO A;  2YIN A;  3BQI A;  3RGL A;  5L4E A;  2CM0 A;  4IDZ A;  2YOE A;  3KBU A;  2V6Y B;  4I43 B;  3UU6 A;  2X9X A;  3B5M A;  2ES0 A;  2YDS A;  3AA0 B;  4U2Z A;  4B3M T;  2C9T A;  3UTK A;  3FHN A;  2PGZ A;  2ODU A;  2QA7 A;  4HGA A;  4YTM A;  2XAG B;  3P4Q A;  3WTI A;  3WTN A;  2QYW A;  2WWU A;  2VK9 A;  2V6Y A;  1XMQ T;  4Z91 A;  3EHZ A;  2VUR A;  4B3S T;  3ZDH A;  3KV9 A;  1V9D A;  4X62 T; 
#chains in the Genus database with same CATH homology
 5CFB A;  2Y57 A;  3ZKR A;  3UU3 A;  4UXU A;  2X00 A;  3U8N A;  2XQ6 A;  5HEJ A;  2XYT A;  5LG3 A;  4QH4 A;  4UM3 A;  2XQ9 A;  4FRR A;  4BFQ A;  4DBM A;  4HFC A;  2ZJV A;  2KSR A;  4UY2 A;  3SQ9 A;  5AFK A;  4B5D A;  2XNU A;  3WTJ A;  3SH1 A;  5J5F A;  5AFJ A;  5BRX A;  5JME A;  5J5G A;  4ILC A;  2XNT A;  3UU5 A;  2YKS A;  3JAE A;  4HFH A;  3WTL A;  3RIA A;  2BYS A;  2XZ5 A;  3IGQ A;  5HEG A;  3SIO A;  5J5H A;  2LM2 A;  5J0Z A;  4AFG A;  2BG9 B;  1OED C;  4QH1 A;  2WNJ A;  5KZU A;  2QC1 B;  3RI5 A;  2BYR A;  2UZ6 A;  2VL0 A;  5BW2 A;  4EZ1 A;  4XK9 A;  3UQ7 A;  4A98 A;  2XQ3 A;  5HEO A;  5L47 A;  4TNV A;  2PH9 A;  3RIF A;  5FJV A;  2BG9 E;  4UM1 A;  4IRE A;  5J5I A;  5AFL A;  2M6B A;  4LMJ A;  3WTK A;  4ILB A;  2Y56 A;  2Y54 A;  3TLT A;  5AFM A;  2W8G A;  4LML A;  2BR7 A;  3U8M A;  2YN6 A;  4QH5 A;  4ZZB A;  5AFH A;  4QAC A;  5CO5 A;  2XZ6 A;  3GUA A;  2BG9 A;  4HQP A;  4ZZC A;  2M6I A;  4NZB A;  4QAB A;  5HEH A;  4TWF A;  4HFD A;  1OED B;  5L4H A;  4IL4 A;  3P50 A;  3WTO A;  4WV9 A;  4A97 A;  2BYP A;  2LKG A;  2LKH A;  2Y58 A;  2LLY A;  4QAA A;  3WTM A;  5AIN A;  5BP0 A;  5L4E A;  3JAD A;  2XNV A;  3JAF A;  2Y7Y A;  3TLU A;  3C84 A;  2X00 D;  2YOE A;  4COF A;  2W8F A;  3U8K A;  5TVC A;  5AFM B;  3RHW A;  1OED E;  2BYN A;  3UU6 A;  1I9B A;  4TNW A;  2ZJU A;  2XQ5 A;  2YME A;  2BJ0 A;  4HFI A;  4IL9 A;  3RQW A;  3UUB A;  3C79 A;  2WNL A;  3PMZ A;  4UM3 S;  3TLV A;  3EI0 A;  3LSV A;  2C9T A;  2XYS A;  4X5T A;  1OED A;  5IUX A;  3UQ4 A;  4TWD A;  5AFN A;  3TLW A;  2XQ8 A;  2XQ4 A;  4HFB A;  2PGZ A;  2XQA A;  5HEU A;  3P4W A;  4PIR A;  5SYO A;  4UM3 P;  3SQ6 A;  4ALX A;  5KE4 A;  2MAW A;  1UX2 A;  2WZY A;  2WNC A;  4LMK A;  4ZJT A;  3WIP A;  4TWH A;  3WTI A;  3UU4 A;  3WTN A;  3TLS A;  1UV6 A;  5HCM A;  3U8J A;  4BQT A;  4Z91 A;  2BR8 A;  3WTH A;  2BG9 C;  3EAM A;  4HFE A;  4XHE A;  4ZJS A;  1UW6 A;  3PEO A;  4ZK4 A;  4ZK1 A;  4AFH A;  2YMD A;  3EHZ A;  4ZRU A;  4D01 A;  3ZDG A;  5HCJ A;  3U8L A;  4ILA A;  3RQU A;  4AFT A;  4F8H A;  4Z90 A;  3ZDH A;  5LXB A;  2WN9 A;  2XQ7 A;  3UU8 A;  4ZR6 A;  3T4M A;  4NPP A;  2BYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...