4IL9A

The pentameric ligand-gated ion channel glic a237f in complex with bromide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIFFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Structural basis for ion permeation mechanism in pentameric ligand-gated ion channels.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 98
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 4il9A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4il9A01
2XQ5A 3TLUA 4LMJA 3TLTA 2W8FA 4UM3S 2YKSA 1UX2A 3U8NA 2BR8A 3P4WA 5L47A 2BR7A 3U8LA 5LXBA 3P50A 4TNVA 5FJVA 4IREA 4IL9A 4BFQA 5AFMB 4QH4A 2MAWA 3U8MA 1OEDB 4B5DA 3EHZA 3WTIA 2BG9C 5AFKA 5AFMA 5LG3A 2BYQA 2YOEA 1OEDA 2BYNA 4ZRUA 4HFCA 3C79A 2W8GA 4ZK1A 4PIRA 4IL4A 4UM1A 3WTKA 5HEHA 5HCJA 2BJ0A 4LMKA 4QABA 2XYSA 3TLVA 4UY2A 3RIFA 4XHEA 2PH9A 2WZYA 5BRXA 2Y54A 2PGZA 2XYTA 3EI0A 5BW2A 3LSVA 5CO5A 4QACA 4ZZCA 4UM3P 2LLYA 3JAFA 1I9BA 4ILCA 3WIPA 3WTNA 4X5TA 5CFBA 4HFIA 2XQ4A 2C9TA 2WNCA 4ILBA 3GUAA 4AFHA 4ZJSA 2KSRA 3EAMA 4ZK4A 4HFBA 3UUBA 2XZ5A 3U8JA 3T4MA 4HFEA 1UW6A 4D01A 4ZZBA 1OEDC 2X00D 3WTJA 4LMLA 4QAAA 3RQUA 2Y56A 4UM3A 4Z90A 2WNJA 3SQ9A 3C84A 4ZR6A 5AINA 4NZBA 4ILAA 2WNLA 3ZDGA 2Y57A 4EZ1A 5IUXA 5HCMA 2XQ3A 5HEGA 3SIOA 4WV9A 4AFGA 2BG9E 4QH5A 3UU8A 3UU6A 2M6BA 2ZJUA 4AFTA 3RI5A 4UXUA 4DBMA 3RQWA 3PEOA 5KZUA 3SQ6A 2UZ6A 5L4EA 5AFJA 2XQ9A 3RHWA 2Y7YA 4HQPA 4XK9A 2XZ6A 4HFHA 3PMZA 3WTHA 4ALXA 3UU4A 2YN6A 2LM2A 2XNVA 2BYSA 2LKHA 5AFNA 4TWHA 3UQ4A 4TWDA 2Y58A 2XNUA 2ZJVA 4HFDA 3WTMA 3UQ7A 5J5FA 3UU5A 2XQ6A 4QH1A 4A97A 5BP0A 5L4HA 3UU3A 3ZDHA 2LKGA 4A98A 2BG9B 4TWFA 2WN9A 4COFA 2XQAA 3WTOA 3ZKRA 3RIAA 2X00A 3IGQA 1UV6A 2YMDA 2XQ7A 5KE4A 2BG9A 1OEDE 3U8KA 2XQ8A 4ZJTA 5SYOA 4Z91A 3JADA 4TNWA 2BYRA 5J5IA 5J5GA 3JAEA 2YMEA 2VL0A 4F8HA 5TVCA 5J0ZA 2BYPA 2QC1B 2M6IA 4BQTA 5JMEA 5J5HA 5HEJA 3SH1A 5HEOA 4FRRA 5AFHA 4NPPA 5AFLA 3WTLA 3TLWA 5HEUA 3TLSA 2XNTA
chains in the Genus database with same CATH superfamily
2W8FA 2YKSA 3U8NA 2WBLA 1HCIA 4IREA 5LCYA 2MAWA 3EVYA 5FVLA 1XWMA 3QNUA 5AFMA 2C5KT 2BYQA 4FJOA 1XNRT 2W8GA 1FMVA 3ZN0B 3AAIA 2XAHB 4IL4A 4P1NA 4QWNB 2X66A 2JMKA 3CQGB 4IDNA 2KXPB 2WZYA 2IMLA 5CO5A 3WIPA 1HNWT 2WNCA 2C9TA 1ZOYA 3GUAA 4ASKA 3ONXA 4HFEA 1YD8G 2BZBA 5ETWA 4UM3A 5JDHA 2A9UA 3PUGA 4ZR6A 4GKJT 4IDOA 5F5WA 4PJMA 2Y57A 2J4GA 4G2AA 4CI1B 3C4ZA 2X68A 5FYMA 1IJ5A 5TAOA 1R8IA 5AFJA 2XQ9A 2JJ9A 4YTPA 3RGLA 2K24A 4JI4T 3JC6D 2DLRA 4OX9T 2C5IT 2KNDA 4ADZA 1U5PA 3ANWB 3DP7A 3N2OA 3CX7B 2CEAA 3W15B 2JQHA 1UV6A 4V1Av 5J5IA 1WR0A 2X9HA 4EV6A 2LRLA 2V7IA 3JCFA 3RYHE 2XAQB 4NPPA 2E9XB 5HEUA 4H9NC 1GQEA 2XNTA 5KXJA 3NRYA 4QKNA 3PUWF 4UR9A 4B3RT 4X1KE 5LMUT 2OLTA 2PFVA 1HS7A 3RYIE 4JBWF 3B5MA 5C3JA 1ZKEA 4ZEYA 2X0YA 4ZI7E 1WYCA 3MKDA 2D0UA 4ZI3C 4AXPA 5FNVE 3RIFA 4I55E 1M62A 2XYTA 5BW2A 3CMLA 5ADXL 3ZN1B 5BRXA 3KBUA 4ZZBA 4QXCB 3WTJA 2ES0A 2VKOA 3VKGA 2KINB 1YQ3A 3PJAJ 1Y64B 3GMIA 3IEEA 1UX4A 4WV9A 3VR9A 4AFGA 4YY3T 2D9DA 2L9QA 3M3ZB 1CHUA 4UXNB 5FXXA 2D5UA 1SA0E 3VU7H 1NWMX 2QYWA 3ONJA 2WWVA 1L0VA 3HL6A 3UQ4A 1VCTA 4JI5T 2N2NA 2WMOA 1MIVA 3BQLA 2BKOA 1QSDA 2UU9T 2XQ6A 3ZMTB 2DL1A 4LF6T 4GYRA 2BG9B 1UK5A 3ZKRA 3RIAA 3F31A 5JDFA 1OEDE 3SFDA 1HF8A 4AKHA 2YU1A 5DQVA 5AQRB 5HEOA 1I94T 5AFHA 4DO0A 4YSZA 3QK6A 4LMJA 2ZM0A 3AE3A 3NZPA 4XAXB 5FY7A 2YU2A 2VKDA 3EHZA 3ZT7A 5CGMA 3X1DA 2WDRA 1KK7A 4LF5T 4KUMB 2WDVA 2X67A 4LFBT 3PU3A 3EI0A 3M65A 3UUXB 3F2EA 2XAJB 5HXCA 4ZK4A 2CWOA 2C5JA 3FZKB 4EZ4A 4UELA 2CLYC 2UUCT 4MHCA 3ZSTA 4H9SE 4AKGA 3RKGA 1N34T 5LGTB 2XJ7A 2XPKA 3CQXC 1MIYA 3OYZA 4IDZA 2HHHT 4JI2T 2NWBA 4OHFA 4EIWA 4DV5T 3FZMB 3VKHA 5J1GA 2QVAA 2ACZA 2IC9A 5FY0A 2JQQA 1E1HB 3RLFF 5JDNA 5FY1A 4CI3B 2H7VC 4A56A 3V5UA 3DJBA 4DUYT 2W62A 2KT9A 2VQET 5HEJA 5FL1A 4JEHB 1XDOA 1UCUA 2XSAA 4KHZF 3B57A 3ZYKA 4O2BE 3AEDA 3OPCA 4PK6A 3WI3A 2X0LB 4AKIA 4JI7T 1X9BA 2RP4A 1FJGT 3AA1B 3ZT6A 4O4JE 3UULA 4ZRUA 2XM1A 4NIQA 3A5XA 2Z6EA 3FBLA 2BJ0A 4LMKA 1NEKA 2X9XA 3BQKA 4KHPT 4Q25A 2WS3A 4QACA 4UM3P 1HR0T 5KX5E 2IAKA 4DR1T 2PBIA 4DV4T 2XQ4A 1KNRA 2V7LA 4HFVA 5GONE 1XNQT 1FIOA 3I9YA 5L3EB 2W67A 2OV9A 1WFDA 3UU8A 2LHRA 4UXUA 3PEOA 4O8SA 4YSXA 3RHWA 2XNVA 5ABHA 3VR8A 5AQPB 3AVRA 4YSYA 2VKHA 4HFDA 4C90A 1SUMB 2V26A 3UU3A 4EXTA 4U3CA 4A98A 5AQGB 1DU2A 3QOFA 4UF0B 2YMDA 3PV0F 3CPZA 4ZJTA 4PAGA 4AQYT 4TNWA 4YHHT 1BR0A 2BYRA 2F4VT 4LF4T 4F8HA 3ZT5A 4EZHA 3KV5A 4JI0T 4UVBB 4QX7B 3I9WA 3KINB 5AQJB 5LXBA 2BBJA 3U78A 3EDUA 1XMOT 3H37A 3QC9A 5IWAT 4B5DA 2VKJA 5ABFB 2UXDT 4PW8A 5L3CB 4HGAA 1WLXA 4ZI2D 2WQYA 4PK4A 3ZC0A 3ZEFB 4ZZCA 5HXHA 3WAJA 1HG5A 3H3MA 3EUHA 3NVOA 3AA0B 2MYSA 2UUAT 3C84A 3VHLA 4I0UA 3L39A 2BVLA 3GN5B 5KZUA 4KX6A 2N9DA 4EEDA 2Y6XA 1J5WA 5AQSB 3E08A 3I0QA 4KI0F 3O1JA 3GA8A 4TWDA 5HAXA 2JQ9A 5FP3A 5IHYA 3LDQB 2H3RA 4A97A 4H63V 3O1IA 4L0RA 4ISTA 5LJMA 4OFZA 1H7CA 2CXLA 1KNPA 4J2CA 1O3XA 2BVMA 5HYAA 4EYUA 4AQFC 5C2TA 2LSYA 4H9QC 1LVFA 2GK9A 2XTLA 5JDLA 1BR1A 5LYJE 4OYKA 1KEYA 2BBHA 4CXXA 3KDSE 2BS2A 4CXWA 3K8PC 4IE4A 4NUUA 2WAUA 2ZM2A 3P4SA 1OEDA 2CLYB 5EK2A 4MALA 2IUBA 2VQFT 4TV8E 4YXDA 4KMCA 2FJBA 1HG2A 1MMNA 2Y54A 3T1HT 4DR2T 3AE2A 2NW8A 5AQTB 2NOXA 4X1IE 3IA3A 2XZEA 2W00A 2XASB 4JI3T 4TV9E 4ERRA 3AXJA 4O4IE 4Z90A 3N9QA 3HKCE 4BJNA 4BAYB 5HCMA 1B7TA 1MMGA 2LSJA 4YHJA 3RI5A 3ZMUB 1LRZA 3RYCE 2LEHA 2LSKA 2N1GA 5LOVE 5AQQB 1D0YA 1BR2A 3O1HA 5HWXA 1UURA 4IHJE 3PUXF 2D0TA 2Y48B 5BP0A 3NKZA 2Q9QD 5LGUB 4QXHB 4ISSA 5LB7B 3UFEA 4CN6A 3AE9A 4AQFA 2UZ6A 3LBXA 5AFKA 1SHZC 2XQ5A 3WAKA 1WRDA 1UX5A 3F57A 2BR8A 3AE6A 4TNVA 3P4RA 4IE0A 2CMRA 2PTFA 2V7MA 3L8RA 3PUQA 2HPLA 2JPFA 2RPAA 4AISA 4BA9A 2H89A 5HWYA 4XHEA 5LHHB 2M67A 5DQWA 3RKOA 4E7SA 2HN1A 4ZI3D 3KVBA 4UV8B 2EHOD 4P0AA 5JDMA 1OXZA 1Z0PA 4JUYA 4I50E 5JDGA 2Y56A 3ZMZB 3RPUA 3SOLA 4DV3T 1VCSA 3ZLIA 5JTGA 3UU6A 3RYFE 2WMNA 4HWIB 2MTQA 4DUZT 4X20E 4ZS2A 4HQPA 2XZ6A 4HFHA 2BDEA 2LJLA 2LSGA 3AE4A 2LKHA 1W9RA 4U33A 5JRCB 1ZEEA 4O4LE 3UQ7A 3ONLC 1QLBA 4PJNA 3QUJA 4HEAA 4JEUB 2V5DA 2LRKA 5IYZE 2XM2A 3AE7A 4B3TT 5TVCA 5KDMC 3HKBE 2QC1B 3FZLB 4IE5A 1IBKT 4PFPA 2BS4A 1OWAA 1ZP0A 3TLUA 3TLTA 3P4WA 5LXTE 4EGWA 1UGOA 5AFMB 2WWUA 3N2GE 4HN9A 3PTRB 3AXJB 3UTKA 3FXEB 4EB6E 1WR6A 2YOEA 1BR4A 2BYNA 2XQYA 2VASA 2YEVC 4TUYE 2UUBT 4QABA 2YK0A 4L9IA 3K1SA 4EYYR 3AA7B 3PUYF 4DV1T 2J1DG 2K5BB 5CFBA 2QRXA 1KNZA 1G8XA 3ABVA 5LP6E 3VRAA 5H6QB 2OA5A 3MK7C 2BG9E 4YT0A 1YXRA 2KMFA 4DR6T 2J47A 2LHNA 1E7PA 5L3BB 3OBVE 3LBXB 2K9AA 4ZHQE 4TWHA 1YW0A 5M4YA 2XNUA 1E2AA 4HKAA 4DIDB 3QB5A 2IW5B 2VVNA 3CWZB 3CKDA 3EDVA 2WN9A 2VL8A 3FXDB 2W61A 5JREA 2WDQA 4OYJA 4CN1A 2YMEA 4LF8T 5CA0E 1T7SA 2B1EA 2KWHA 1N32T 3P4QA 2W2UA 4AKRB 3C98B 5DABA 5HXSA 2G0UA 3L09A 2QA7A 2WSSV 4WZXA 4PNIA 4CZZB 1T8BA 4U2ZA 4UIGA 3ZSSA 3PE0A 4H9OC 3C4XA 4PJJA 3C79A 3KV6A 5LMNT 3MXZA 1G73A 3FB2A 5FXVA 2V1DB 4I4TE 1D1BA 5JR9C 3HR0A 4B3MT 3O4XE 2P9BA 3CQCB 4DNDA 5AFUL 3AECA 3GWHA 4ZOLE 3SQ9A 4YFSA 4M1PA 5AQKB 4NZBA 1T72A 4ILAA 2WNLA 4EZ1A 4UVAB 3H3AA 4IDPA 4KP3C 3MACA 2XAGB 4JI8T 3UUMA 3RIUA 5LG4A 4MLKA 2E9XD 4F6RC 3N2KE 4GYSA 3ZJ1A 4PJLA 4YTMA 4U7YA 2ZJVA 1AJ3A 2L3LA 1HTJF 1WYBA 5L4HA 2PJQA 2CHOA 3N9NA 3ZJ2A 3WTOA 3V5SA 3U3IA 3JADA 2VURA 1D1AA 2XUEA 4X66T 3AE1A 1W0BA 2BKPA 4CN4A 3UT5E 5A1LA 3I0OA 4ILUA 3OJAA 4QH4A 4DV0T 2XHEB 3U8MA 2DHRA 2JQKA 3LFMA 4MBQA 3AEAA 1FEWA 3ZYMA 3VRBA 4GK5E 2V6XA 5DJQC 1LVKA 1MNDA 4I43B 3N9OA 3RX6A 5JR9A 2XAFB 5FVKA 4JI6T 1X79A 2H7OA 1JNRA 2D2SA 4WW0A 3N5LA 4AFHA 2BKNA 3AAEB 4HFBA 3UUBA 1YKHB 3U8JA 3T1YT 4HWHA 4N78D 1OEDC 3HKEE 2CWYA 5H6RB 4QAAA 2LT3A 5FXZA 2I6HA 3SWHA 4YLHA 3NBXX 2JMHA 1UUSA 5L2LA 1J5ET 5L4EA 2Y7YA 2NP9A 4HWFA 2WU5A 5AFNA 1XZYA 4TZ4C 4DBQA 2W66A 2WB5A 5CJ5A 5LA6E 3PUVF 4EEBA 3ANWA 3FBZA 3RRCA 1I6ZA 5E0OA 3PURA 1JNZA 2HH7A 4HE8A 2H88A 3J7Yq 4ZI2C 5J0ZA 2CBIA 4BQTA 3AA6B 4DMWA 4KBMB 3C50A 4U31A 3TLSA 1MMDA 4DV2T 3NRXA 4QX8B 2E9XA 4IT4A 4EOZB 2UXNB 5CB4E 3Q5WA 4BFQA 4BJMA 2VVSA 1KFYA 4B6XA 2YDQA 1LKXA 4HFCA 3ESLA 4ZS3A 4UM1A 5HEHA 4P0BA 4AKLA 4DBRA 5AQNB 3PUZF 1I9BA 4ILCA 5JQGE 3WTNA 2ACXA 2KSRA 2W0GA 3P8CD 2K3WA 3RC3A 5AINA 3Q5DA 2XQ3A 5HXRA 4CQIA 2FBWA 2NR4A 2B76A 2ZJUA 4AFTA 4DBMA 2X51A 4G63A 3ZMSB 1MNEA 3FZHB 3LK3B 2ZLYA 3TKLB 3RH3A 1VOMA 2ZM6T 5BMVE 3G06A 2V8SV 2VB6A 2KZ7B 2LKGA 2WU2A 3KV4A 4MFRA 3P7IA 4IIJE 2BG9A 2A3DA 1NENA 1IJ6A 4YTNA 2V5CA 4U2YA 3LK2B 5J5HA 4FRRA 2XY8B 5JR9B 4GK0E 4PK5A 1HFAA 4IDQA 1UX2A 1MMAA 1S94A 4ZXLA 3U8LA 3P50A 3P4PA 3ETUA 4WYVA 3D0TA 5LG3A 1D1CA 3PJAA 4GIWA 4A5XA 5LBMA 5L3FB 5HCJA 3UFGA 4HWCA 2IDOB 5LJNA 2E2AA 3A8YC 2DI4A 4TX5A 3K3NA 2LE8A 2DWKA 4AIUA 3AEEA 3AAAB 2PG8A 3HI2A 3PUAA 1EZ3A 3ZMVB 4JV5T 3EAMA 4D01A 4GKKT 5HXEA 4CXYA 4QHOA 3N9MA 4LF9T 4GOUA 3ZDGA 4JI1T 2Q9QC 4O4HE 4UVCB 1J1JA 4JLEA 4YJ3E 4DV7T 1YQ4A 2SPCA 1IZNB 2IIUA 2V7JA 2W4XA 3JC6C 4XK9A 5LNKA 3R6NA 4PFOA 5ABGA 2NW7A 2HPJA 3CX8B 2X9YA 4U72A 2J62A 2CXFA 3MZKB 5J5FA 3UU5A 3S4UA 3EABA 3Q2MA 3E22E 1D0ZA 2JRKA 3AEGA 5FMNA 2I0MA 4E7ZA 5JH7E 3JAEA 4K0UA 5F3JA 2BYPA 4DMVA 2ZMAA 3FHNA 1MIWA 5JMEA 3K3OA 3SH1A 1IAPA 3E0ZA 2CM0A 2E8IA 3CK6A 2EHOC 4UM3S 2I59A 4NXMT 5FJVA 3PDYA 4U7IA 3R84B 2KLQA 1OEDB 3OTOT 2IHR1 3Q9DA 4PIRA 3AEBA 3TLVA 4UY2A 4X65T 2PH9A 2WP9A 2YDRA 3KVAA 3C4WA 5AQIB 2LLYA 2ZM8A 3T8OA 3RF1A 3SFEA 3KV9A 1IBLT 5J2UE 3MA9A 4DR7T 1ZHCA 2Q9QA 4LF7T 3AE8A 4P09A 1FMWA 1Y01A 2E5VA 2Y8DA 3LJCA 2IC6A 2YN6A 4YJ2E 5AQFB 1XMQT 5KMGP 3LG7A 4QH1A 1XDPA 2LOSA 4IE7A 5ABEA 1NAFA 3K3QC 4AQGA 2XQ8A 3RIUC 4UF0A 4CI2B 2M6IA 4NXNT 5EZYE 2JIWA 4XZCA 3TLWA 4ANJA 3J9X1 2EHOA 5L47A 2BR7A 5BR8T 2ODVA 2WM9A 5FL0A 3OKQA 1QUUA 2BS3A 3AVSA 5ABFA 3CVRA 2V6YA 4H63H 4EAHA 2UXBT 2DWGA 5FXWA 4K0KT 1N36T 2XYSA 3QB5K 3LSVA 3JAFA 3C64A 2CE7A 5FKYA 2LSIA 2WZIA 4ILBA 4X62T 2AE9A 4ZJSA 3ZPOA 2XZ5A 2X00D 2DNXA 4UEMA 4LFCT 2UXCT 2R6GF 5HEGA 3SIOA 3FZFB 4QH5A 2M6BA 3RRWA 3GN5A 4AI6A 5LBQB 3WTHA 4ALXA 3SS1A 2BYSA 4UV9B 2Y58A 2MPKA 3ZCJA 1HX8A 3OVUA 3HKDE 3I1AA 4TWFA 4XBFB 4WBNE 4COFA 2XQAA 2V7KA 3IF8B 3IGQA 1SE7A 3MJXA 1W09A 5J5GA 2VL0A 1US7B 5C8YE 4DR5T 5CA1E 5L3GB 3UUNA 1ZV4X 5AFLA 4WBOA 4HWDA 5AQUB 2CRBA 3LK42 4O2AE 2CA5A 4IL9A 2X9WA 2FJAA 2X0HA 3PU8A 3ZYLA 1Z8UA 3KFWX 2Q9QB 2FUPA 3RC8A 2CCQA 4IE6A 3WTKA 2LM9A 2PGZA 1HNZT 4B3ST 5LHIB 3C51A 2E9XC 1V9DA 3NZQA 1HNXT 4X5TA 3BQIA 4HFIA 2VK9A 1CUNA 1N33T 3T4MA 3OYXA 3O9XA 3B13A 4H9RC 3N9PA 2WNJA 3L3PA 2NW9A 5IUXA 3NWIA 2NTYA 3AE5A 4OK0A 3ZCIA 3SRZA 2WY2A 4C91A 2KWIB 5EK3A 2RA1A 3SQ6A 2LOPA 5LHGB 1S35A 2EHOB 3AEFA 2YINA 5JDQA 5J2TE 2CBJA 1VRBA 2E5LT 4X64T 2X00A 2MBGA 2V6YB 3U8KA 4NUVA 5SYOA 5L3DB 4Z91A 2CPTA 2WZHA 3CX6B 4IGUA 5EK4A 1IBMT 3WTLA 1W0AA 3BK9A 2C0SA 2MOZA 2UXXB 2QGSA 3CIRA 3A7MA 3WTIA 3N9LA 2BG9C 2FJEA 4DV6T 3Q5XA 2CXDA 4FI5A 4ZK1A 4TN7B 4WNKA 1YKEB 4DR3T 2AXDS 3PUSA 4HTEA 4QXBB 4Z8XA 4LFAT 2A2FX 3ETVA 2A72A 5LGNB 2NTXA 1D0XA 4U74A 2ODUA 5JVDE 3Q5EA 5AQOB 1UW6A 4LMLA 1WCRA 3RQUA 4X1YE 2XSBA 1T98A 5AQVB 2HN2A 2VWAA 4DR4T 3RQWA 2W63A 2WCAA 3PMZA 3UU4A 2LM2A 2K48A 1U4QA 3HA4A 4L5GA 3WTMA 3ZC1A 1KF6A 2YDSA 3AB3B 5JRCA 5AQLB 4JYAT 5AQHB 5AQMB 2L8KA 5F8PA 3ZDHA 4H9PC 3DTOA 1HX1B 4DVDA 1M7KA 2XQ7A 5KE4A 3IHRA 3KBTA 2CHNA 2FJDA 3IBPA 2DCFA
chains in the Genus database with same CATH topology
2XQ5A 3TLUA 4LMJA 3TLTA 2W8FA 4UM3S 2YKSA 1UX2A 3U8NA 2BR8A 3P4WA 5L47A 2BR7A 3U8LA 5LXBA 3P50A 4TNVA 5FJVA 4IREA 4IL9A 4BFQA 5AFMB 4QH4A 2MAWA 3U8MA 1OEDB 4B5DA 3EHZA 3WTIA 2BG9C 5AFKA 5AFMA 5LG3A 2BYQA 2YOEA 1OEDA 2BYNA 4ZRUA 4HFCA 3C79A 2W8GA 4ZK1A 4PIRA 4IL4A 4UM1A 3WTKA 5HEHA 5HCJA 2BJ0A 4LMKA 4QABA 2XYSA 3TLVA 4UY2A 3RIFA 4XHEA 2PH9A 2WZYA 5BRXA 2Y54A 2PGZA 2XYTA 3EI0A 5BW2A 3LSVA 5CO5A 4QACA 4ZZCA 4UM3P 2LLYA 3JAFA 1I9BA 4ILCA 3WIPA 3WTNA 4X5TA 5CFBA 4HFIA 2XQ4A 2C9TA 2WNCA 4ILBA 3GUAA 4AFHA 4ZJSA 2KSRA 3EAMA 4ZK4A 4HFBA 3UUBA 2XZ5A 3U8JA 3T4MA 4HFEA 1UW6A 4D01A 4ZZBA 1OEDC 2X00D 3WTJA 4LMLA 4QAAA 3RQUA 2Y56A 4UM3A 4Z90A 2WNJA 3SQ9A 3C84A 4ZR6A 5AINA 4NZBA 4ILAA 2WNLA 3ZDGA 2Y57A 4EZ1A 5IUXA 5HCMA 2XQ3A 5HEGA 3SIOA 4WV9A 4AFGA 2BG9E 4QH5A 3UU8A 3UU6A 2M6BA 2ZJUA 4AFTA 3RI5A 4UXUA 4DBMA 3RQWA 3PEOA 5KZUA 3SQ6A 2UZ6A 5L4EA 5AFJA 2XQ9A 3RHWA 2Y7YA 4HQPA 4XK9A 2XZ6A 4HFHA 3PMZA 3WTHA 4ALXA 3UU4A 2YN6A 2LM2A 2XNVA 2BYSA 2LKHA 5AFNA 4TWHA 3UQ4A 4TWDA 2Y58A 2XNUA 2ZJVA 4HFDA 3WTMA 3UQ7A 5J5FA 3UU5A 2XQ6A 4QH1A 4A97A 5BP0A 5L4HA 3UU3A 3ZDHA 2LKGA 4A98A 2BG9B 4TWFA 2WN9A 4COFA 2XQAA 3WTOA 3ZKRA 3RIAA 2X00A 3IGQA 1UV6A 2YMDA 2XQ7A 5KE4A 2BG9A 1OEDE 3U8KA 2XQ8A 4ZJTA 5SYOA 4Z91A 3JADA 4TNWA 2BYRA 5J5IA 5J5GA 3JAEA 2YMEA 2VL0A 4F8HA 5TVCA 5J0ZA 2BYPA 2QC1B 2M6IA 4BQTA 5JMEA 5J5HA 5HEJA 3SH1A 5HEOA 4FRRA 5AFHA 4NPPA 5AFLA 3WTLA 3TLWA 5HEUA 3TLSA 2XNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ5 A;  3TLU A;  4LMJ A;  3TLT A;  2W8F A;  4UM3 S;  2YKS A;  1UX2 A;  3U8N A;  2BR8 A;  3P4W A;  5L47 A;  2BR7 A;  3U8L A;  5LXB A;  3P50 A;  4TNV A;  5FJV A;  4IRE A;  4IL9 A;  4BFQ A;  5AFM B;  4QH4 A;  2MAW A;  3U8M A;  1OED B;  4B5D A;  3EHZ A;  3WTI A;  2BG9 C;  5AFK A;  5AFM A;  5LG3 A;  2BYQ A;  2YOE A;  1OED A;  2BYN A;  4ZRU A;  4HFC A;  3C79 A;  2W8G A;  4ZK1 A;  4PIR A;  4IL4 A;  4UM1 A;  3WTK A;  5HEH A;  5HCJ A;  2BJ0 A;  4LMK A;  4QAB A;  2XYS A;  3TLV A;  4UY2 A;  3RIF A;  4XHE A;  2PH9 A;  2WZY A;  5BRX A;  2Y54 A;  2PGZ A;  2XYT A;  3EI0 A;  5BW2 A;  3LSV A;  5CO5 A;  4QAC A;  4ZZC A;  4UM3 P;  2LLY A;  3JAF A;  1I9B A;  4ILC A;  3WIP A;  3WTN A;  4X5T A;  5CFB A;  4HFI A;  2XQ4 A;  2C9T A;  2WNC A;  4ILB A;  3GUA A;  4AFH A;  4ZJS A;  2KSR A;  3EAM A;  4ZK4 A;  4HFB A;  3UUB A;  2XZ5 A;  3U8J A;  3T4M A;  4HFE A;  1UW6 A;  4D01 A;  4ZZB A;  1OED C;  2X00 D;  3WTJ A;  4LML A;  4QAA A;  3RQU A;  2Y56 A;  4UM3 A;  4Z90 A;  2WNJ A;  3SQ9 A;  3C84 A;  4ZR6 A;  5AIN A;  4NZB A;  4ILA A;  2WNL A;  3ZDG A;  2Y57 A;  4EZ1 A;  5IUX A;  5HCM A;  2XQ3 A;  5HEG A;  3SIO A;  4WV9 A;  4AFG A;  2BG9 E;  4QH5 A;  3UU8 A;  3UU6 A;  2M6B A;  2ZJU A;  4AFT A;  3RI5 A;  4UXU A;  4DBM A;  3RQW A;  3PEO A;  5KZU A;  3SQ6 A;  2UZ6 A;  5L4E A;  5AFJ A;  2XQ9 A;  3RHW A;  2Y7Y A;  4HQP A;  4XK9 A;  2XZ6 A;  4HFH A;  3PMZ A;  3WTH A;  4ALX A;  3UU4 A;  2YN6 A;  2LM2 A;  2XNV A;  2BYS A;  2LKH A;  5AFN A;  4TWH A;  3UQ4 A;  4TWD A;  2Y58 A;  2XNU A;  2ZJV A;  4HFD A;  3WTM A;  3UQ7 A;  5J5F A;  3UU5 A;  2XQ6 A;  4QH1 A;  4A97 A;  5BP0 A;  5L4H A;  3UU3 A;  3ZDH A;  2LKG A;  4A98 A;  2BG9 B;  4TWF A;  2WN9 A;  4COF A;  2XQA A;  3WTO A;  3ZKR A;  3RIA A;  2X00 A;  3IGQ A;  1UV6 A;  2YMD A;  2XQ7 A;  5KE4 A;  2BG9 A;  1OED E;  3U8K A;  2XQ8 A;  4ZJT A;  5SYO A;  4Z91 A;  3JAD A;  4TNW A;  2BYR A;  5J5I A;  5J5G A;  3JAE A;  2YME A;  2VL0 A;  4F8H A;  5TVC A;  5J0Z A;  2BYP A;  2QC1 B;  2M6I A;  4BQT A;  5JME A;  5J5H A;  5HEJ A;  3SH1 A;  5HEO A;  4FRR A;  5AFH A;  4NPP A;  5AFL A;  3WTL A;  3TLW A;  5HEU A;  3TLS A;  2XNT A; 
#chains in the Genus database with same CATH topology
 2W8F A;  2YKS A;  3U8N A;  2WBL A;  1HCI A;  4IRE A;  5LCY A;  2MAW A;  3EVY A;  5FVL A;  1XWM A;  3QNU A;  5AFM A;  2C5K T;  2BYQ A;  4FJO A;  1XNR T;  2W8G A;  1FMV A;  3ZN0 B;  3AAI A;  2XAH B;  4IL4 A;  4P1N A;  4QWN B;  2X66 A;  2JMK A;  3CQG B;  4IDN A;  2KXP B;  2WZY A;  2IML A;  5CO5 A;  3WIP A;  1HNW T;  2WNC A;  2C9T A;  1ZOY A;  3GUA A;  4ASK A;  3ONX A;  4HFE A;  1YD8 G;  2BZB A;  5ETW A;  4UM3 A;  5JDH A;  2A9U A;  3PUG A;  4ZR6 A;  4GKJ T;  4IDO A;  5F5W A;  4PJM A;  2Y57 A;  2J4G A;  4G2A A;  4CI1 B;  3C4Z A;  2X68 A;  5FYM A;  1IJ5 A;  5TAO A;  1R8I A;  5AFJ A;  2XQ9 A;  2JJ9 A;  4YTP A;  3RGL A;  2K24 A;  4JI4 T;  3JC6 D;  2DLR A;  4OX9 T;  2C5I T;  2KND A;  4ADZ A;  1U5P A;  3ANW B;  3DP7 A;  3N2O A;  3CX7 B;  2CEA A;  3W15 B;  2JQH A;  1UV6 A;  4V1A v;  5J5I A;  1WR0 A;  2X9H A;  4EV6 A;  2LRL A;  2V7I A;  3JCF A;  3RYH E;  2XAQ B;  4NPP A;  2E9X B;  5HEU A;  4H9N C;  1GQE A;  2XNT A;  5KXJ A;  3NRY A;  4QKN A;  3PUW F;  4UR9 A;  4B3R T;  4X1K E;  5LMU T;  2OLT A;  2PFV A;  1HS7 A;  3RYI E;  4JBW F;  3B5M A;  5C3J A;  1ZKE A;  4ZEY A;  2X0Y A;  4ZI7 E;  1WYC A;  3MKD A;  2D0U A;  4ZI3 C;  4AXP A;  5FNV E;  3RIF A;  4I55 E;  1M62 A;  2XYT A;  5BW2 A;  3CML A;  5ADX L;  3ZN1 B;  5BRX A;  3KBU A;  4ZZB A;  4QXC B;  3WTJ A;  2ES0 A;  2VKO A;  3VKG A;  2KIN B;  1YQ3 A;  3PJA J;  1Y64 B;  3GMI A;  3IEE A;  1UX4 A;  4WV9 A;  3VR9 A;  4AFG A;  4YY3 T;  2D9D A;  2L9Q A;  3M3Z B;  1CHU A;  4UXN B;  5FXX A;  2D5U A;  1SA0 E;  3VU7 H;  1NWM X;  2QYW A;  3ONJ A;  2WWV A;  1L0V A;  3HL6 A;  3UQ4 A;  1VCT A;  4JI5 T;  2N2N A;  2WMO A;  1MIV A;  3BQL A;  2BKO A;  1QSD A;  2UU9 T;  2XQ6 A;  3ZMT B;  2DL1 A;  4LF6 T;  4GYR A;  2BG9 B;  1UK5 A;  3ZKR A;  3RIA A;  3F31 A;  5JDF A;  1OED E;  3SFD A;  1HF8 A;  4AKH A;  2YU1 A;  5DQV A;  5AQR B;  5HEO A;  1I94 T;  5AFH A;  4DO0 A;  4YSZ A;  3QK6 A;  4LMJ A;  2ZM0 A;  3AE3 A;  3NZP A;  4XAX B;  5FY7 A;  2YU2 A;  2VKD A;  3EHZ A;  3ZT7 A;  5CGM A;  3X1D A;  2WDR A;  1KK7 A;  4LF5 T;  4KUM B;  2WDV A;  2X67 A;  4LFB T;  3PU3 A;  3EI0 A;  3M65 A;  3UUX B;  3F2E A;  2XAJ B;  5HXC A;  4ZK4 A;  2CWO A;  2C5J A;  3FZK B;  4EZ4 A;  4UEL A;  2CLY C;  2UUC T;  4MHC A;  3ZST A;  4H9S E;  4AKG A;  3RKG A;  1N34 T;  5LGT B;  2XJ7 A;  2XPK A;  3CQX C;  1MIY A;  3OYZ A;  4IDZ A;  2HHH T;  4JI2 T;  2NWB A;  4OHF A;  4EIW A;  4DV5 T;  3FZM B;  3VKH A;  5J1G A;  2QVA A;  2ACZ A;  2IC9 A;  5FY0 A;  2JQQ A;  1E1H B;  3RLF F;  5JDN A;  5FY1 A;  4CI3 B;  2H7V C;  4A56 A;  3V5U A;  3DJB A;  4DUY T;  2W62 A;  2KT9 A;  2VQE T;  5HEJ A;  5FL1 A;  4JEH B;  1XDO A;  1UCU A;  2XSA A;  4KHZ F;  3B57 A;  3ZYK A;  4O2B E;  3AED A;  3OPC A;  4PK6 A;  3WI3 A;  2X0L B;  4AKI A;  4JI7 T;  1X9B A;  2RP4 A;  1FJG T;  3AA1 B;  3ZT6 A;  4O4J E;  3UUL A;  4ZRU A;  2XM1 A;  4NIQ A;  3A5X A;  2Z6E A;  3FBL A;  2BJ0 A;  4LMK A;  1NEK A;  2X9X A;  3BQK A;  4KHP T;  4Q25 A;  2WS3 A;  4QAC A;  4UM3 P;  1HR0 T;  5KX5 E;  2IAK A;  4DR1 T;  2PBI A;  4DV4 T;  2XQ4 A;  1KNR A;  2V7L A;  4HFV A;  5GON E;  1XNQ T;  1FIO A;  3I9Y A;  5L3E B;  2W67 A;  2OV9 A;  1WFD A;  3UU8 A;  2LHR A;  4UXU A;  3PEO A;  4O8S A;  4YSX A;  3RHW A;  2XNV A;  5ABH A;  3VR8 A;  5AQP B;  3AVR A;  4YSY A;  2VKH A;  4HFD A;  4C90 A;  1SUM B;  2V26 A;  3UU3 A;  4EXT A;  4U3C A;  4A98 A;  5AQG B;  1DU2 A;  3QOF A;  4UF0 B;  2YMD A;  3PV0 F;  3CPZ A;  4ZJT A;  4PAG A;  4AQY T;  4TNW A;  4YHH T;  1BR0 A;  2BYR A;  2F4V T;  4LF4 T;  4F8H A;  3ZT5 A;  4EZH A;  3KV5 A;  4JI0 T;  4UVB B;  4QX7 B;  3I9W A;  3KIN B;  5AQJ B;  5LXB A;  2BBJ A;  3U78 A;  3EDU A;  1XMO T;  3H37 A;  3QC9 A;  5IWA T;  4B5D A;  2VKJ A;  5ABF B;  2UXD T;  4PW8 A;  5L3C B;  4HGA A;  1WLX A;  4ZI2 D;  2WQY A;  4PK4 A;  3ZC0 A;  3ZEF B;  4ZZC A;  5HXH A;  3WAJ A;  1HG5 A;  3H3M A;  3EUH A;  3NVO A;  3AA0 B;  2MYS A;  2UUA T;  3C84 A;  3VHL A;  4I0U A;  3L39 A;  2BVL A;  3GN5 B;  5KZU A;  4KX6 A;  2N9D A;  4EED A;  2Y6X A;  1J5W A;  5AQS B;  3E08 A;  3I0Q A;  4KI0 F;  3O1J A;  3GA8 A;  4TWD A;  5HAX A;  2JQ9 A;  5FP3 A;  5IHY A;  3LDQ B;  2H3R A;  4A97 A;  4H63 V;  3O1I A;  4L0R A;  4IST A;  5LJM A;  4OFZ A;  1H7C A;  2CXL A;  1KNP A;  4J2C A;  1O3X A;  2BVM A;  5HYA A;  4EYU A;  4AQF C;  5C2T A;  2LSY A;  4H9Q C;  1LVF A;  2GK9 A;  2XTL A;  5JDL A;  1BR1 A;  5LYJ E;  4OYK A;  1KEY A;  2BBH A;  4CXX A;  3KDS E;  2BS2 A;  4CXW A;  3K8P C;  4IE4 A;  4NUU A;  2WAU A;  2ZM2 A;  3P4S A;  1OED A;  2CLY B;  5EK2 A;  4MAL A;  2IUB A;  2VQF T;  4TV8 E;  4YXD A;  4KMC A;  2FJB A;  1HG2 A;  1MMN A;  2Y54 A;  3T1H T;  4DR2 T;  3AE2 A;  2NW8 A;  5AQT B;  2NOX A;  4X1I E;  3IA3 A;  2XZE A;  2W00 A;  2XAS B;  4JI3 T;  4TV9 E;  4ERR A;  3AXJ A;  4O4I E;  4Z90 A;  3N9Q A;  3HKC E;  4BJN A;  4BAY B;  5HCM A;  1B7T A;  1MMG A;  2LSJ A;  4YHJ A;  3RI5 A;  3ZMU B;  1LRZ A;  3RYC E;  2LEH A;  2LSK A;  2N1G A;  5LOV E;  5AQQ B;  1D0Y A;  1BR2 A;  3O1H A;  5HWX A;  1UUR A;  4IHJ E;  3PUX F;  2D0T A;  2Y48 B;  5BP0 A;  3NKZ A;  2Q9Q D;  5LGU B;  4QXH B;  4ISS A;  5LB7 B;  3UFE A;  4CN6 A;  3AE9 A;  4AQF A;  2UZ6 A;  3LBX A;  5AFK A;  1SHZ C;  2XQ5 A;  3WAK A;  1WRD A;  1UX5 A;  3F57 A;  2BR8 A;  3AE6 A;  4TNV A;  3P4R A;  4IE0 A;  2CMR A;  2PTF A;  2V7M A;  3L8R A;  3PUQ A;  2HPL A;  2JPF A;  2RPA A;  4AIS A;  4BA9 A;  2H89 A;  5HWY A;  4XHE A;  5LHH B;  2M67 A;  5DQW A;  3RKO A;  4E7S A;  2HN1 A;  4ZI3 D;  3KVB A;  4UV8 B;  2EHO D;  4P0A A;  5JDM A;  1OXZ A;  1Z0P A;  4JUY A;  4I50 E;  5JDG A;  2Y56 A;  3ZMZ B;  3RPU A;  3SOL A;  4DV3 T;  1VCS A;  3ZLI A;  5JTG A;  3UU6 A;  3RYF E;  2WMN A;  4HWI B;  2MTQ A;  4DUZ T;  4X20 E;  4ZS2 A;  4HQP A;  2XZ6 A;  4HFH A;  2BDE A;  2LJL A;  2LSG A;  3AE4 A;  2LKH A;  1W9R A;  4U33 A;  5JRC B;  1ZEE A;  4O4L E;  3UQ7 A;  3ONL C;  1QLB A;  4PJN A;  3QUJ A;  4HEA A;  4JEU B;  2V5D A;  2LRK A;  5IYZ E;  2XM2 A;  3AE7 A;  4B3T T;  5TVC A;  5KDM C;  3HKB E;  2QC1 B;  3FZL B;  4IE5 A;  1IBK T;  4PFP A;  2BS4 A;  1OWA A;  1ZP0 A;  3TLU A;  3TLT A;  3P4W A;  5LXT E;  4EGW A;  1UGO A;  5AFM B;  2WWU A;  3N2G E;  4HN9 A;  3PTR B;  3AXJ B;  3UTK A;  3FXE B;  4EB6 E;  1WR6 A;  2YOE A;  1BR4 A;  2BYN A;  2XQY A;  2VAS A;  2YEV C;  4TUY E;  2UUB T;  4QAB A;  2YK0 A;  4L9I A;  3K1S A;  4EYY R;  3AA7 B;  3PUY F;  4DV1 T;  2J1D G;  2K5B B;  5CFB A;  2QRX A;  1KNZ A;  1G8X A;  3ABV A;  5LP6 E;  3VRA A;  5H6Q B;  2OA5 A;  3MK7 C;  2BG9 E;  4YT0 A;  1YXR A;  2KMF A;  4DR6 T;  2J47 A;  2LHN A;  1E7P A;  5L3B B;  3OBV E;  3LBX B;  2K9A A;  4ZHQ E;  4TWH A;  1YW0 A;  5M4Y A;  2XNU A;  1E2A A;  4HKA A;  4DID B;  3QB5 A;  2IW5 B;  2VVN A;  3CWZ B;  3CKD A;  3EDV A;  2WN9 A;  2VL8 A;  3FXD B;  2W61 A;  5JRE A;  2WDQ A;  4OYJ A;  4CN1 A;  2YME A;  4LF8 T;  5CA0 E;  1T7S A;  2B1E A;  2KWH A;  1N32 T;  3P4Q A;  2W2U A;  4AKR B;  3C98 B;  5DAB A;  5HXS A;  2G0U A;  3L09 A;  2QA7 A;  2WSS V;  4WZX A;  4PNI A;  4CZZ B;  1T8B A;  4U2Z A;  4UIG A;  3ZSS A;  3PE0 A;  4H9O C;  3C4X A;  4PJJ A;  3C79 A;  3KV6 A;  5LMN T;  3MXZ A;  1G73 A;  3FB2 A;  5FXV A;  2V1D B;  4I4T E;  1D1B A;  5JR9 C;  3HR0 A;  4B3M T;  3O4X E;  2P9B A;  3CQC B;  4DND A;  5AFU L;  3AEC A;  3GWH A;  4ZOL E;  3SQ9 A;  4YFS A;  4M1P A;  5AQK B;  4NZB A;  1T72 A;  4ILA A;  2WNL A;  4EZ1 A;  4UVA B;  3H3A A;  4IDP A;  4KP3 C;  3MAC A;  2XAG B;  4JI8 T;  3UUM A;  3RIU A;  5LG4 A;  4MLK A;  2E9X D;  4F6R C;  3N2K E;  4GYS A;  3ZJ1 A;  4PJL A;  4YTM A;  4U7Y A;  2ZJV A;  1AJ3 A;  2L3L A;  1HTJ F;  1WYB A;  5L4H A;  2PJQ A;  2CHO A;  3N9N A;  3ZJ2 A;  3WTO A;  3V5S A;  3U3I A;  3JAD A;  2VUR A;  1D1A A;  2XUE A;  4X66 T;  3AE1 A;  1W0B A;  2BKP A;  4CN4 A;  3UT5 E;  5A1L A;  3I0O A;  4ILU A;  3OJA A;  4QH4 A;  4DV0 T;  2XHE B;  3U8M A;  2DHR A;  2JQK A;  3LFM A;  4MBQ A;  3AEA A;  1FEW A;  3ZYM A;  3VRB A;  4GK5 E;  2V6X A;  5DJQ C;  1LVK A;  1MND A;  4I43 B;  3N9O A;  3RX6 A;  5JR9 A;  2XAF B;  5FVK A;  4JI6 T;  1X79 A;  2H7O A;  1JNR A;  2D2S A;  4WW0 A;  3N5L A;  4AFH A;  2BKN A;  3AAE B;  4HFB A;  3UUB A;  1YKH B;  3U8J A;  3T1Y T;  4HWH A;  4N78 D;  1OED C;  3HKE E;  2CWY A;  5H6R B;  4QAA A;  2LT3 A;  5FXZ A;  2I6H A;  3SWH A;  4YLH A;  3NBX X;  2JMH A;  1UUS A;  5L2L A;  1J5E T;  5L4E A;  2Y7Y A;  2NP9 A;  4HWF A;  2WU5 A;  5AFN A;  1XZY A;  4TZ4 C;  4DBQ A;  2W66 A;  2WB5 A;  5CJ5 A;  5LA6 E;  3PUV F;  4EEB A;  3ANW A;  3FBZ A;  3RRC A;  1I6Z A;  5E0O A;  3PUR A;  1JNZ A;  2HH7 A;  4HE8 A;  2H88 A;  3J7Y q;  4ZI2 C;  5J0Z A;  2CBI A;  4BQT A;  3AA6 B;  4DMW A;  4KBM B;  3C50 A;  4U31 A;  3TLS A;  1MMD A;  4DV2 T;  3NRX A;  4QX8 B;  2E9X A;  4IT4 A;  4EOZ B;  2UXN B;  5CB4 E;  3Q5W A;  4BFQ A;  4BJM A;  2VVS A;  1KFY A;  4B6X A;  2YDQ A;  1LKX A;  4HFC A;  3ESL A;  4ZS3 A;  4UM1 A;  5HEH A;  4P0B A;  4AKL A;  4DBR A;  5AQN B;  3PUZ F;  1I9B A;  4ILC A;  5JQG E;  3WTN A;  2ACX A;  2KSR A;  2W0G A;  3P8C D;  2K3W A;  3RC3 A;  5AIN A;  3Q5D A;  2XQ3 A;  5HXR A;  4CQI A;  2FBW A;  2NR4 A;  2B76 A;  2ZJU A;  4AFT A;  4DBM A;  2X51 A;  4G63 A;  3ZMS B;  1MNE A;  3FZH B;  3LK3 B;  2ZLY A;  3TKL B;  3RH3 A;  1VOM A;  2ZM6 T;  5BMV E;  3G06 A;  2V8S V;  2VB6 A;  2KZ7 B;  2LKG A;  2WU2 A;  3KV4 A;  4MFR A;  3P7I A;  4IIJ E;  2BG9 A;  2A3D A;  1NEN A;  1IJ6 A;  4YTN A;  2V5C A;  4U2Y A;  3LK2 B;  5J5H A;  4FRR A;  2XY8 B;  5JR9 B;  4GK0 E;  4PK5 A;  1HFA A;  4IDQ A;  1UX2 A;  1MMA A;  1S94 A;  4ZXL A;  3U8L A;  3P50 A;  3P4P A;  3ETU A;  4WYV A;  3D0T A;  5LG3 A;  1D1C A;  3PJA A;  4GIW A;  4A5X A;  5LBM A;  5L3F B;  5HCJ A;  3UFG A;  4HWC A;  2IDO B;  5LJN A;  2E2A A;  3A8Y C;  2DI4 A;  4TX5 A;  3K3N A;  2LE8 A;  2DWK A;  4AIU A;  3AEE A;  3AAA B;  2PG8 A;  3HI2 A;  3PUA A;  1EZ3 A;  3ZMV B;  4JV5 T;  3EAM A;  4D01 A;  4GKK T;  5HXE A;  4CXY A;  4QHO A;  3N9M A;  4LF9 T;  4GOU A;  3ZDG A;  4JI1 T;  2Q9Q C;  4O4H E;  4UVC B;  1J1J A;  4JLE A;  4YJ3 E;  4DV7 T;  1YQ4 A;  2SPC A;  1IZN B;  2IIU A;  2V7J A;  2W4X A;  3JC6 C;  4XK9 A;  5LNK A;  3R6N A;  4PFO A;  5ABG A;  2NW7 A;  2HPJ A;  3CX8 B;  2X9Y A;  4U72 A;  2J62 A;  2CXF A;  3MZK B;  5J5F A;  3UU5 A;  3S4U A;  3EAB A;  3Q2M A;  3E22 E;  1D0Z A;  2JRK A;  3AEG A;  5FMN A;  2I0M A;  4E7Z A;  5JH7 E;  3JAE A;  4K0U A;  5F3J A;  2BYP A;  4DMV A;  2ZMA A;  3FHN A;  1MIW A;  5JME A;  3K3O A;  3SH1 A;  1IAP A;  3E0Z A;  2CM0 A;  2E8I A;  3CK6 A;  2EHO C;  4UM3 S;  2I59 A;  4NXM T;  5FJV A;  3PDY A;  4U7I A;  3R84 B;  2KLQ A;  1OED B;  3OTO T;  2IHR 1;  3Q9D A;  4PIR A;  3AEB A;  3TLV A;  4UY2 A;  4X65 T;  2PH9 A;  2WP9 A;  2YDR A;  3KVA A;  3C4W A;  5AQI B;  2LLY A;  2ZM8 A;  3T8O A;  3RF1 A;  3SFE A;  3KV9 A;  1IBL T;  5J2U E;  3MA9 A;  4DR7 T;  1ZHC A;  2Q9Q A;  4LF7 T;  3AE8 A;  4P09 A;  1FMW A;  1Y01 A;  2E5V A;  2Y8D A;  3LJC A;  2IC6 A;  2YN6 A;  4YJ2 E;  5AQF B;  1XMQ T;  5KMG P;  3LG7 A;  4QH1 A;  1XDP A;  2LOS A;  4IE7 A;  5ABE A;  1NAF A;  3K3Q C;  4AQG A;  2XQ8 A;  3RIU C;  4UF0 A;  4CI2 B;  2M6I A;  4NXN T;  5EZY E;  2JIW A;  4XZC A;  3TLW A;  4ANJ A;  3J9X 1;  2EHO A;  5L47 A;  2BR7 A;  5BR8 T;  2ODV A;  2WM9 A;  5FL0 A;  3OKQ A;  1QUU A;  2BS3 A;  3AVS A;  5ABF A;  3CVR A;  2V6Y A;  4H63 H;  4EAH A;  2UXB T;  2DWG A;  5FXW A;  4K0K T;  1N36 T;  2XYS A;  3QB5 K;  3LSV A;  3JAF A;  3C64 A;  2CE7 A;  5FKY A;  2LSI A;  2WZI A;  4ILB A;  4X62 T;  2AE9 A;  4ZJS A;  3ZPO A;  2XZ5 A;  2X00 D;  2DNX A;  4UEM A;  4LFC T;  2UXC T;  2R6G F;  5HEG A;  3SIO A;  3FZF B;  4QH5 A;  2M6B A;  3RRW A;  3GN5 A;  4AI6 A;  5LBQ B;  3WTH A;  4ALX A;  3SS1 A;  2BYS A;  4UV9 B;  2Y58 A;  2MPK A;  3ZCJ A;  1HX8 A;  3OVU A;  3HKD E;  3I1A A;  4TWF A;  4XBF B;  4WBN E;  4COF A;  2XQA A;  2V7K A;  3IF8 B;  3IGQ A;  1SE7 A;  3MJX A;  1W09 A;  5J5G A;  2VL0 A;  1US7 B;  5C8Y E;  4DR5 T;  5CA1 E;  5L3G B;  3UUN A;  1ZV4 X;  5AFL A;  4WBO A;  4HWD A;  5AQU B;  2CRB A;  3LK4 2;  4O2A E;  2CA5 A;  4IL9 A;  2X9W A;  2FJA A;  2X0H A;  3PU8 A;  3ZYL A;  1Z8U A;  3KFW X;  2Q9Q B;  2FUP A;  3RC8 A;  2CCQ A;  4IE6 A;  3WTK A;  2LM9 A;  2PGZ A;  1HNZ T;  4B3S T;  5LHI B;  3C51 A;  2E9X C;  1V9D A;  3NZQ A;  1HNX T;  4X5T A;  3BQI A;  4HFI A;  2VK9 A;  1CUN A;  1N33 T;  3T4M A;  3OYX A;  3O9X A;  3B13 A;  4H9R C;  3N9P A;  2WNJ A;  3L3P A;  2NW9 A;  5IUX A;  3NWI A;  2NTY A;  3AE5 A;  4OK0 A;  3ZCI A;  3SRZ A;  2WY2 A;  4C91 A;  2KWI B;  5EK3 A;  2RA1 A;  3SQ6 A;  2LOP A;  5LHG B;  1S35 A;  2EHO B;  3AEF A;  2YIN A;  5JDQ A;  5J2T E;  2CBJ A;  1VRB A;  2E5L T;  4X64 T;  2X00 A;  2MBG A;  2V6Y B;  3U8K A;  4NUV A;  5SYO A;  5L3D B;  4Z91 A;  2CPT A;  2WZH A;  3CX6 B;  4IGU A;  5EK4 A;  1IBM T;  3WTL A;  1W0A A;  3BK9 A;  2C0S A;  2MOZ A;  2UXX B;  2QGS A;  3CIR A;  3A7M A;  3WTI A;  3N9L A;  2BG9 C;  2FJE A;  4DV6 T;  3Q5X A;  2CXD A;  4FI5 A;  4ZK1 A;  4TN7 B;  4WNK A;  1YKE B;  4DR3 T;  2AXD S;  3PUS A;  4HTE A;  4QXB B;  4Z8X A;  4LFA T;  2A2F X;  3ETV A;  2A72 A;  5LGN B;  2NTX A;  1D0X A;  4U74 A;  2ODU A;  5JVD E;  3Q5E A;  5AQO B;  1UW6 A;  4LML A;  1WCR A;  3RQU A;  4X1Y E;  2XSB A;  1T98 A;  5AQV B;  2HN2 A;  2VWA A;  4DR4 T;  3RQW A;  2W63 A;  2WCA A;  3PMZ A;  3UU4 A;  2LM2 A;  2K48 A;  1U4Q A;  3HA4 A;  4L5G A;  3WTM A;  3ZC1 A;  1KF6 A;  2YDS A;  3AB3 B;  5JRC A;  5AQL B;  4JYA T;  5AQH B;  5AQM B;  2L8K A;  5F8P A;  3ZDH A;  4H9P C;  3DTO A;  1HX1 B;  4DVD A;  1M7K A;  2XQ7 A;  5KE4 A;  3IHR A;  3KBT A;  2CHN A;  2FJD A;  3IBP A;  2DCF A; 
#chains in the Genus database with same CATH homology
 2XQ5 A;  3TLU A;  4LMJ A;  3TLT A;  2W8F A;  4UM3 S;  2YKS A;  1UX2 A;  3U8N A;  2BR8 A;  3P4W A;  5L47 A;  2BR7 A;  3U8L A;  5LXB A;  3P50 A;  4TNV A;  5FJV A;  4IRE A;  4IL9 A;  4BFQ A;  5AFM B;  4QH4 A;  2MAW A;  3U8M A;  1OED B;  4B5D A;  3EHZ A;  3WTI A;  2BG9 C;  5AFK A;  5AFM A;  5LG3 A;  2BYQ A;  2YOE A;  1OED A;  2BYN A;  4ZRU A;  4HFC A;  3C79 A;  2W8G A;  4ZK1 A;  4PIR A;  4IL4 A;  4UM1 A;  3WTK A;  5HEH A;  5HCJ A;  2BJ0 A;  4LMK A;  4QAB A;  2XYS A;  3TLV A;  4UY2 A;  3RIF A;  4XHE A;  2PH9 A;  2WZY A;  5BRX A;  2Y54 A;  2PGZ A;  2XYT A;  3EI0 A;  5BW2 A;  3LSV A;  5CO5 A;  4QAC A;  4ZZC A;  4UM3 P;  2LLY A;  3JAF A;  1I9B A;  4ILC A;  3WIP A;  3WTN A;  4X5T A;  5CFB A;  4HFI A;  2XQ4 A;  2C9T A;  2WNC A;  4ILB A;  3GUA A;  4AFH A;  4ZJS A;  2KSR A;  3EAM A;  4ZK4 A;  4HFB A;  3UUB A;  2XZ5 A;  3U8J A;  3T4M A;  4HFE A;  1UW6 A;  4D01 A;  4ZZB A;  1OED C;  2X00 D;  3WTJ A;  4LML A;  4QAA A;  3RQU A;  2Y56 A;  4UM3 A;  4Z90 A;  2WNJ A;  3SQ9 A;  3C84 A;  4ZR6 A;  5AIN A;  4NZB A;  4ILA A;  2WNL A;  3ZDG A;  2Y57 A;  4EZ1 A;  5IUX A;  5HCM A;  2XQ3 A;  5HEG A;  3SIO A;  4WV9 A;  4AFG A;  2BG9 E;  4QH5 A;  3UU8 A;  3UU6 A;  2M6B A;  2ZJU A;  4AFT A;  3RI5 A;  4UXU A;  4DBM A;  3RQW A;  3PEO A;  5KZU A;  3SQ6 A;  2UZ6 A;  5L4E A;  5AFJ A;  2XQ9 A;  3RHW A;  2Y7Y A;  4HQP A;  4XK9 A;  2XZ6 A;  4HFH A;  3PMZ A;  3WTH A;  4ALX A;  3UU4 A;  2YN6 A;  2LM2 A;  2XNV A;  2BYS A;  2LKH A;  5AFN A;  4TWH A;  3UQ4 A;  4TWD A;  2Y58 A;  2XNU A;  2ZJV A;  4HFD A;  3WTM A;  3UQ7 A;  5J5F A;  3UU5 A;  2XQ6 A;  4QH1 A;  4A97 A;  5BP0 A;  5L4H A;  3UU3 A;  3ZDH A;  2LKG A;  4A98 A;  2BG9 B;  4TWF A;  2WN9 A;  4COF A;  2XQA A;  3WTO A;  3ZKR A;  3RIA A;  2X00 A;  3IGQ A;  1UV6 A;  2YMD A;  2XQ7 A;  5KE4 A;  2BG9 A;  1OED E;  3U8K A;  2XQ8 A;  4ZJT A;  5SYO A;  4Z91 A;  3JAD A;  4TNW A;  2BYR A;  5J5I A;  5J5G A;  3JAE A;  2YME A;  2VL0 A;  4F8H A;  5TVC A;  5J0Z A;  2BYP A;  2QC1 B;  2M6I A;  4BQT A;  5JME A;  5J5H A;  5HEJ A;  3SH1 A;  5HEO A;  4FRR A;  5AFH A;  4NPP A;  5AFL A;  3WTL A;  3TLW A;  5HEU A;  3TLS A;  2XNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...