4QACA

X-ray structure of acetylcholine binding protein (achbp) in complex with 4-(4-methylpiperidin-1-yl)-6-(4-(trifluoromethyl)phenyl)pyrimidin-2-amine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
209
Chain Sequence
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Structural basis for cooperative interactions of substituted 2-aminopyrimidines with the acetylcholine binding protein.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein
total genus 52
structure length 209
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qacA00
4ZK1A 3UU6A 2YN6A 3T4MA 5KZUA 5HEHA 5KE4A 3C84A 4A97A 4AFTA 4ZRUA 4HFCA 5HCJA 4PIRA 3P50A 5BP0A 1UV6A 3UU8A 2BYSA 2ZJVA 4AFHA 2PGZA 4LMKA 3WTMA 5HEJA 4HFDA 3ZDGA 2XYSA 4DBMA 5L4EA 5HEOA 4IREA 3IGQA 4HFHA 5SYOA 3TLUA 3ZKRA 5J5GA 4LMJA 4IL4A 4ZK4A 3ZDHA 5J5FA 2C9TA 2YKSA 3GUAA 4QAAA 4XK9A 2X00D 2XQ9A 4QH4A 1UX2A 4Z91A 4B5DA 5AFJA 4Z90A 4QACA 3JAEA 4TWHA 4ZR6A 4EZ1A 5HEUA 5LXBA 3RHWA 3U8KA 4HFIA 2BG9E 2BR7A 3RIAA 2XYTA 4ILAA 2Y7YA 2YOEA 5FJVA 3TLVA 2BG9C 2QC1B 2XQ6A 2Y57A 2XNVA 5CFBA 5LG3A 5AFMB 3U8NA 1UW6A 2W8FA 2XQ8A 2WZYA 2XQ7A 4ILBA 5AFKA 3TLTA 5AINA 2XQ4A 4TNVA 4BQTA 4IL9A 3JADA 3RQWA 4ZZBA 5J5HA 4TWFA 4QABA 3RI5A 2BYPA 4ZJTA 2XZ5A 3UU5A 5AFLA 4XHEA 2BYQA 2BYNA 1I9BA 3LSVA 4UY2A 4ZJSA 2XQ3A 2BG9B 2BYRA 3JAFA 3RIFA 3U8JA 4A98A 4F8HA 2X00A 3PEOA 5HCMA 3U8MA 2BJ0A 4TWDA 3WIPA 2VL0A 4HFEA 3UU4A 3EHZA 4LMLA 5CO5A 2Y56A 2WNLA 3U8LA 3WTLA 4COFA 3WTIA 5J5IA 4QH5A 5JMEA 2XZ6A 3SIOA 2Y58A 4UM3P 4TNWA 2UZ6A 5BW2A 3UQ7A 3P4WA 2YMEA 3PMZA 4UM1A 4UM3S 5AFMA 5AFNA 5BRXA 2PH9A 2XQ5A 3SQ9A 3EAMA 2WN9A 4D01A 2W8GA 4HQPA 4NZBA 3TLWA 3WTOA 5IUXA 5L47A 3SH1A 3TLSA 4X5TA 4UM3A 2BR8A 2XNTA 3C79A 5AFHA 4QH1A 4ZZCA 2XNUA 3UUBA 4AFGA 2Y54A 4ILCA 3WTKA 2BG9A 2WNJA 4FRRA 4UXUA 3WTHA 4ALXA 3SQ6A 4HFBA 4WV9A 2YMDA 3RQUA 4BFQA 2WNCA 5TVCA 3UU3A 3UQ4A 2ZJUA 3WTJA 5L4HA 3EI0A 3WTNA 4NPPA 5J0ZA 5HEGA 2XQAA
chains in the Genus database with same CATH superfamily
4ZK1A 3UU6A 2YN6A 3T4MA 5KZUA 5HEHA 5KE4A 3C84A 4A97A 4AFTA 4ZRUA 4HFCA 5HCJA 4PIRA 3P50A 5BP0A 1UV6A 3UU8A 2BYSA 2ZJVA 4AFHA 2PGZA 4LMKA 3WTMA 5HEJA 4HFDA 3ZDGA 2XYSA 4DBMA 5L4EA 5HEOA 4IREA 3IGQA 4HFHA 5SYOA 3TLUA 3ZKRA 5J5GA 4LMJA 4IL4A 4ZK4A 3ZDHA 5J5FA 2C9TA 2YKSA 3GUAA 4QAAA 4XK9A 2X00D 2XQ9A 4QH4A 1UX2A 4Z91A 4B5DA 5AFJA 4Z90A 4QACA 3JAEA 4TWHA 4ZR6A 4EZ1A 5HEUA 5LXBA 3RHWA 3U8KA 4HFIA 2BG9E 2BR7A 3RIAA 2XYTA 4ILAA 2Y7YA 2YOEA 5FJVA 3TLVA 2BG9C 2QC1B 2XQ6A 2Y57A 2XNVA 5CFBA 5LG3A 5AFMB 3U8NA 1UW6A 2W8FA 2XQ8A 2WZYA 2XQ7A 4ILBA 5AFKA 3TLTA 5AINA 2XQ4A 4TNVA 4BQTA 4IL9A 3JADA 3RQWA 4ZZBA 5J5HA 4TWFA 4QABA 3RI5A 2BYPA 4ZJTA 2XZ5A 3UU5A 5AFLA 4XHEA 2BYQA 2BYNA 1I9BA 3LSVA 4UY2A 4ZJSA 2XQ3A 2BG9B 2BYRA 3JAFA 3RIFA 3U8JA 4A98A 4F8HA 2X00A 3PEOA 5HCMA 3U8MA 2BJ0A 4TWDA 3WIPA 2VL0A 4HFEA 3UU4A 3EHZA 4LMLA 5CO5A 2Y56A 2WNLA 3U8LA 3WTLA 4COFA 3WTIA 5J5IA 4QH5A 5JMEA 2XZ6A 3SIOA 2Y58A 4UM3P 4TNWA 2UZ6A 5BW2A 3UQ7A 3P4WA 2YMEA 3PMZA 4UM1A 4UM3S 5AFMA 5AFNA 5BRXA 2PH9A 2XQ5A 3SQ9A 3EAMA 2WN9A 4D01A 2W8GA 4HQPA 4NZBA 3TLWA 3WTOA 5IUXA 5L47A 3SH1A 3TLSA 4X5TA 4UM3A 2BR8A 2XNTA 3C79A 5AFHA 4QH1A 4ZZCA 2XNUA 3UUBA 4AFGA 2Y54A 4ILCA 3WTKA 2BG9A 2WNJA 4FRRA 4UXUA 3WTHA 4ALXA 3SQ6A 4HFBA 4WV9A 2YMDA 3RQUA 4BFQA 2WNCA 5TVCA 3UU3A 3UQ4A 2ZJUA 3WTJA 5L4HA 3EI0A 3WTNA 4NPPA 5J0ZA 5HEGA 2XQAA
chains in the Genus database with same CATH topology
4ZK1A 3UU6A 2YN6A 3T4MA 5KZUA 5HEHA 5KE4A 3C84A 4A97A 4AFTA 4ZRUA 4HFCA 5HCJA 4PIRA 3P50A 5BP0A 1UV6A 3UU8A 2BYSA 2ZJVA 4AFHA 2PGZA 4LMKA 3WTMA 5HEJA 4HFDA 3ZDGA 2XYSA 4DBMA 5L4EA 5HEOA 4IREA 3IGQA 4HFHA 5SYOA 3TLUA 3ZKRA 5J5GA 4LMJA 4IL4A 4ZK4A 3ZDHA 5J5FA 2C9TA 2YKSA 3GUAA 4QAAA 4XK9A 2X00D 2XQ9A 4QH4A 1UX2A 4Z91A 4B5DA 5AFJA 4Z90A 4QACA 3JAEA 4TWHA 4ZR6A 4EZ1A 5HEUA 5LXBA 3RHWA 3U8KA 4HFIA 2BG9E 2BR7A 3RIAA 2XYTA 4ILAA 2Y7YA 2YOEA 5FJVA 3TLVA 2BG9C 2QC1B 2XQ6A 2Y57A 2XNVA 5CFBA 5LG3A 5AFMB 3U8NA 1UW6A 2W8FA 2XQ8A 2WZYA 2XQ7A 4ILBA 5AFKA 3TLTA 5AINA 2XQ4A 4TNVA 4BQTA 4IL9A 3JADA 3RQWA 4ZZBA 5J5HA 4TWFA 4QABA 3RI5A 2BYPA 4ZJTA 2XZ5A 3UU5A 5AFLA 4XHEA 2BYQA 2BYNA 1I9BA 3LSVA 4UY2A 4ZJSA 2XQ3A 2BG9B 2BYRA 3JAFA 3RIFA 3U8JA 4A98A 4F8HA 2X00A 3PEOA 5HCMA 3U8MA 2BJ0A 4TWDA 3WIPA 2VL0A 4HFEA 3UU4A 3EHZA 4LMLA 5CO5A 2Y56A 2WNLA 3U8LA 3WTLA 4COFA 3WTIA 5J5IA 4QH5A 5JMEA 2XZ6A 3SIOA 2Y58A 4UM3P 4TNWA 2UZ6A 5BW2A 3UQ7A 3P4WA 2YMEA 3PMZA 4UM1A 4UM3S 5AFMA 5AFNA 5BRXA 2PH9A 2XQ5A 3SQ9A 3EAMA 2WN9A 4D01A 2W8GA 4HQPA 4NZBA 3TLWA 3WTOA 5IUXA 5L47A 3SH1A 3TLSA 4X5TA 4UM3A 2BR8A 2XNTA 3C79A 5AFHA 4QH1A 4ZZCA 2XNUA 3UUBA 4AFGA 2Y54A 4ILCA 3WTKA 2BG9A 2WNJA 4FRRA 4UXUA 3WTHA 4ALXA 3SQ6A 4HFBA 4WV9A 2YMDA 3RQUA 4BFQA 2WNCA 5TVCA 3UU3A 3UQ4A 2ZJUA 3WTJA 5L4HA 3EI0A 3WTNA 4NPPA 5J0ZA 5HEGA 2XQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZK1 A;  3UU6 A;  2YN6 A;  3T4M A;  5KZU A;  5HEH A;  5KE4 A;  3C84 A;  4A97 A;  4AFT A;  4ZRU A;  4HFC A;  5HCJ A;  4PIR A;  3P50 A;  5BP0 A;  1UV6 A;  3UU8 A;  2BYS A;  2ZJV A;  4AFH A;  2PGZ A;  4LMK A;  3WTM A;  5HEJ A;  4HFD A;  3ZDG A;  2XYS A;  4DBM A;  5L4E A;  5HEO A;  4IRE A;  3IGQ A;  4HFH A;  5SYO A;  3TLU A;  3ZKR A;  5J5G A;  4LMJ A;  4IL4 A;  4ZK4 A;  3ZDH A;  5J5F A;  2C9T A;  2YKS A;  3GUA A;  4QAA A;  4XK9 A;  2X00 D;  2XQ9 A;  4QH4 A;  1UX2 A;  4Z91 A;  4B5D A;  5AFJ A;  4Z90 A;  4QAC A;  3JAE A;  4TWH A;  4ZR6 A;  4EZ1 A;  5HEU A;  5LXB A;  3RHW A;  3U8K A;  4HFI A;  2BG9 E;  2BR7 A;  3RIA A;  2XYT A;  4ILA A;  2Y7Y A;  2YOE A;  5FJV A;  3TLV A;  2BG9 C;  2QC1 B;  2XQ6 A;  2Y57 A;  2XNV A;  5CFB A;  5LG3 A;  5AFM B;  3U8N A;  1UW6 A;  2W8F A;  2XQ8 A;  2WZY A;  2XQ7 A;  4ILB A;  5AFK A;  3TLT A;  5AIN A;  2XQ4 A;  4TNV A;  4BQT A;  4IL9 A;  3JAD A;  3RQW A;  4ZZB A;  5J5H A;  4TWF A;  4QAB A;  3RI5 A;  2BYP A;  4ZJT A;  2XZ5 A;  3UU5 A;  5AFL A;  4XHE A;  2BYQ A;  2BYN A;  1I9B A;  3LSV A;  4UY2 A;  4ZJS A;  2XQ3 A;  2BG9 B;  2BYR A;  3JAF A;  3RIF A;  3U8J A;  4A98 A;  4F8H A;  2X00 A;  3PEO A;  5HCM A;  3U8M A;  2BJ0 A;  4TWD A;  3WIP A;  2VL0 A;  4HFE A;  3UU4 A;  3EHZ A;  4LML A;  5CO5 A;  2Y56 A;  2WNL A;  3U8L A;  3WTL A;  4COF A;  3WTI A;  5J5I A;  4QH5 A;  5JME A;  2XZ6 A;  3SIO A;  2Y58 A;  4UM3 P;  4TNW A;  2UZ6 A;  5BW2 A;  3UQ7 A;  3P4W A;  2YME A;  3PMZ A;  4UM1 A;  4UM3 S;  5AFM A;  5AFN A;  5BRX A;  2PH9 A;  2XQ5 A;  3SQ9 A;  3EAM A;  2WN9 A;  4D01 A;  2W8G A;  4HQP A;  4NZB A;  3TLW A;  3WTO A;  5IUX A;  5L47 A;  3SH1 A;  3TLS A;  4X5T A;  4UM3 A;  2BR8 A;  2XNT A;  3C79 A;  5AFH A;  4QH1 A;  4ZZC A;  2XNU A;  3UUB A;  4AFG A;  2Y54 A;  4ILC A;  3WTK A;  2BG9 A;  2WNJ A;  4FRR A;  4UXU A;  3WTH A;  4ALX A;  3SQ6 A;  4HFB A;  4WV9 A;  2YMD A;  3RQU A;  4BFQ A;  2WNC A;  5TVC A;  3UU3 A;  3UQ4 A;  2ZJU A;  3WTJ A;  5L4H A;  3EI0 A;  3WTN A;  4NPP A;  5J0Z A;  5HEG A;  2XQA A; 
#chains in the Genus database with same CATH topology
 4ZK1 A;  3UU6 A;  2YN6 A;  3T4M A;  5KZU A;  5HEH A;  5KE4 A;  3C84 A;  4A97 A;  4AFT A;  4ZRU A;  4HFC A;  5HCJ A;  4PIR A;  3P50 A;  5BP0 A;  1UV6 A;  3UU8 A;  2BYS A;  2ZJV A;  4AFH A;  2PGZ A;  4LMK A;  3WTM A;  5HEJ A;  4HFD A;  3ZDG A;  2XYS A;  4DBM A;  5L4E A;  5HEO A;  4IRE A;  3IGQ A;  4HFH A;  5SYO A;  3TLU A;  3ZKR A;  5J5G A;  4LMJ A;  4IL4 A;  4ZK4 A;  3ZDH A;  5J5F A;  2C9T A;  2YKS A;  3GUA A;  4QAA A;  4XK9 A;  2X00 D;  2XQ9 A;  4QH4 A;  1UX2 A;  4Z91 A;  4B5D A;  5AFJ A;  4Z90 A;  4QAC A;  3JAE A;  4TWH A;  4ZR6 A;  4EZ1 A;  5HEU A;  5LXB A;  3RHW A;  3U8K A;  4HFI A;  2BG9 E;  2BR7 A;  3RIA A;  2XYT A;  4ILA A;  2Y7Y A;  2YOE A;  5FJV A;  3TLV A;  2BG9 C;  2QC1 B;  2XQ6 A;  2Y57 A;  2XNV A;  5CFB A;  5LG3 A;  5AFM B;  3U8N A;  1UW6 A;  2W8F A;  2XQ8 A;  2WZY A;  2XQ7 A;  4ILB A;  5AFK A;  3TLT A;  5AIN A;  2XQ4 A;  4TNV A;  4BQT A;  4IL9 A;  3JAD A;  3RQW A;  4ZZB A;  5J5H A;  4TWF A;  4QAB A;  3RI5 A;  2BYP A;  4ZJT A;  2XZ5 A;  3UU5 A;  5AFL A;  4XHE A;  2BYQ A;  2BYN A;  1I9B A;  3LSV A;  4UY2 A;  4ZJS A;  2XQ3 A;  2BG9 B;  2BYR A;  3JAF A;  3RIF A;  3U8J A;  4A98 A;  4F8H A;  2X00 A;  3PEO A;  5HCM A;  3U8M A;  2BJ0 A;  4TWD A;  3WIP A;  2VL0 A;  4HFE A;  3UU4 A;  3EHZ A;  4LML A;  5CO5 A;  2Y56 A;  2WNL A;  3U8L A;  3WTL A;  4COF A;  3WTI A;  5J5I A;  4QH5 A;  5JME A;  2XZ6 A;  3SIO A;  2Y58 A;  4UM3 P;  4TNW A;  2UZ6 A;  5BW2 A;  3UQ7 A;  3P4W A;  2YME A;  3PMZ A;  4UM1 A;  4UM3 S;  5AFM A;  5AFN A;  5BRX A;  2PH9 A;  2XQ5 A;  3SQ9 A;  3EAM A;  2WN9 A;  4D01 A;  2W8G A;  4HQP A;  4NZB A;  3TLW A;  3WTO A;  5IUX A;  5L47 A;  3SH1 A;  3TLS A;  4X5T A;  4UM3 A;  2BR8 A;  2XNT A;  3C79 A;  5AFH A;  4QH1 A;  4ZZC A;  2XNU A;  3UUB A;  4AFG A;  2Y54 A;  4ILC A;  3WTK A;  2BG9 A;  2WNJ A;  4FRR A;  4UXU A;  3WTH A;  4ALX A;  3SQ6 A;  4HFB A;  4WV9 A;  2YMD A;  3RQU A;  4BFQ A;  2WNC A;  5TVC A;  3UU3 A;  3UQ4 A;  2ZJU A;  3WTJ A;  5L4H A;  3EI0 A;  3WTN A;  4NPP A;  5J0Z A;  5HEG A;  2XQA A; 
#chains in the Genus database with same CATH homology
 4ZK1 A;  3UU6 A;  2YN6 A;  3T4M A;  5KZU A;  5HEH A;  5KE4 A;  3C84 A;  4A97 A;  4AFT A;  4ZRU A;  4HFC A;  5HCJ A;  4PIR A;  3P50 A;  5BP0 A;  1UV6 A;  3UU8 A;  2BYS A;  2ZJV A;  4AFH A;  2PGZ A;  4LMK A;  3WTM A;  5HEJ A;  4HFD A;  3ZDG A;  2XYS A;  4DBM A;  5L4E A;  5HEO A;  4IRE A;  3IGQ A;  4HFH A;  5SYO A;  3TLU A;  3ZKR A;  5J5G A;  4LMJ A;  4IL4 A;  4ZK4 A;  3ZDH A;  5J5F A;  2C9T A;  2YKS A;  3GUA A;  4QAA A;  4XK9 A;  2X00 D;  2XQ9 A;  4QH4 A;  1UX2 A;  4Z91 A;  4B5D A;  5AFJ A;  4Z90 A;  4QAC A;  3JAE A;  4TWH A;  4ZR6 A;  4EZ1 A;  5HEU A;  5LXB A;  3RHW A;  3U8K A;  4HFI A;  2BG9 E;  2BR7 A;  3RIA A;  2XYT A;  4ILA A;  2Y7Y A;  2YOE A;  5FJV A;  3TLV A;  2BG9 C;  2QC1 B;  2XQ6 A;  2Y57 A;  2XNV A;  5CFB A;  5LG3 A;  5AFM B;  3U8N A;  1UW6 A;  2W8F A;  2XQ8 A;  2WZY A;  2XQ7 A;  4ILB A;  5AFK A;  3TLT A;  5AIN A;  2XQ4 A;  4TNV A;  4BQT A;  4IL9 A;  3JAD A;  3RQW A;  4ZZB A;  5J5H A;  4TWF A;  4QAB A;  3RI5 A;  2BYP A;  4ZJT A;  2XZ5 A;  3UU5 A;  5AFL A;  4XHE A;  2BYQ A;  2BYN A;  1I9B A;  3LSV A;  4UY2 A;  4ZJS A;  2XQ3 A;  2BG9 B;  2BYR A;  3JAF A;  3RIF A;  3U8J A;  4A98 A;  4F8H A;  2X00 A;  3PEO A;  5HCM A;  3U8M A;  2BJ0 A;  4TWD A;  3WIP A;  2VL0 A;  4HFE A;  3UU4 A;  3EHZ A;  4LML A;  5CO5 A;  2Y56 A;  2WNL A;  3U8L A;  3WTL A;  4COF A;  3WTI A;  5J5I A;  4QH5 A;  5JME A;  2XZ6 A;  3SIO A;  2Y58 A;  4UM3 P;  4TNW A;  2UZ6 A;  5BW2 A;  3UQ7 A;  3P4W A;  2YME A;  3PMZ A;  4UM1 A;  4UM3 S;  5AFM A;  5AFN A;  5BRX A;  2PH9 A;  2XQ5 A;  3SQ9 A;  3EAM A;  2WN9 A;  4D01 A;  2W8G A;  4HQP A;  4NZB A;  3TLW A;  3WTO A;  5IUX A;  5L47 A;  3SH1 A;  3TLS A;  4X5T A;  4UM3 A;  2BR8 A;  2XNT A;  3C79 A;  5AFH A;  4QH1 A;  4ZZC A;  2XNU A;  3UUB A;  4AFG A;  2Y54 A;  4ILC A;  3WTK A;  2BG9 A;  2WNJ A;  4FRR A;  4UXU A;  3WTH A;  4ALX A;  3SQ6 A;  4HFB A;  4WV9 A;  2YMD A;  3RQU A;  4BFQ A;  2WNC A;  5TVC A;  3UU3 A;  3UQ4 A;  2ZJU A;  3WTJ A;  5L4H A;  3EI0 A;  3WTN A;  4NPP A;  5J0Z A;  5HEG A;  2XQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...