4QACA

X-ray structure of acetylcholine binding protein (achbp) in complex with 4-(4-methylpiperidin-1-yl)-6-(4-(trifluoromethyl)phenyl)pyrimidin-2-amine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
209
Chain Sequence
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylcholine-binding protein
molecule keywords Acetylcholine-binding protein
publication title Structural basis for cooperative interactions of substituted 2-aminopyrimidines with the acetylcholine binding protein.
pubmed doi rcsb
source organism Lymnaea stagnalis
total genus 52
structure length 209
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qacA00
4XK9A 3WTNA 4ILBA 5J5HA 2BJ0A 3ZDHA 4TWFA 3UU5A 3RHWA 2XNTA 3JAEA 3TLUA 3U8JA 4LMLA 4HFDA 2W8FA 2XNVA 2BG9E 3C79A 2Y58A 4QABA 3EAMA 4NZBA 3U8NA 5BP0A 4XHEA 3WTHA 4WV9A 4A98A 5LG3A 1I9BA 4ZZBA 2PGZA 3WTOA 5AINA 2WNLA 4ZR6A 4HFBA 3U8MA 2W8GA 3TLWA 5FJVA 3RI5A 5CFBA 4ZJSA 3JAFA 4HFHA 1UV6A 2YMDA 4ZZCA 2BR8A 4A97A 3SQ6A 5HEOA 4X5TA 5AFKA 2BG9A 2Y57A 4PIRA 3TLVA 5L47A 4NPPA 5HEHA 3UU4A 2XQ9A 2YMEA 2BYPA 2XYTA 5LXBA 2ZJVA 5TVCA 5HCMA 2XZ6A 3RQUA 1UX2A 4ZK4A 2BG9C 4AFHA 2X00D 4UM3A 4HQPA 4HFIA 2XQ4A 2C9TA 3SQ9A 4LMKA 2ZJUA 4F8HA 5HEUA 4AFTA 4QAAA 4UM1A 5AFJA 5CO5A 2BYSA 5L4HA 3WIPA 5AFNA 3TLSA 2Y7YA 2BYRA 4UY2A 2XQAA 3RIFA 4D01A 4ALXA 4IL9A 4DBMA 5J5FA 3WTJA 3U8LA 4IL4A 2BR7A 5AFMA 2WN9A 3RQWA 2PH9A 3C84A 3ZKRA 2BYNA 5AFHA 5IUXA 2UZ6A 5KE4A 5JMEA 3RIAA 4HFEA 2WZYA 4BQTA 3UUBA 2XQ3A 3T4MA 4ZJTA 3SH1A 2XNUA 4ZRUA 2QC1B 4UXUA 2XQ8A 4TWHA 4IREA 3P50A 3UU6A 1UW6A 2YOEA 3GUAA 3PMZA 4UM3P 5HCJA 4BFQA 3U8KA 5J0ZA 2XYSA 4B5DA 2BYQA 4TNWA 3IGQA 5HEGA 2Y56A 3SIOA 4QH1A 4QH5A 3P4WA 5BRXA 2XZ5A 5AFLA 3ZDGA 2WNCA 3JADA 3WTIA 2BG9B 5AFMB 3WTMA 2XQ7A 4Z90A 3UU3A 2Y54A 4QH4A 3TLTA 2XQ5A 4ILAA 5KZUA 3UQ7A 3WTLA 4QACA 5HEJA 2YKSA 4LMJA 5J5GA 4Z91A 3EHZA 3PEOA 4TNVA 4FRRA 4TWDA 5J5IA 3WTKA 4AFGA 4UM3S 3LSVA 3UU8A 5L4EA 5BW2A 2WNJA 2YN6A 2VL0A 3EI0A 4HFCA 4ILCA 2XQ6A 4COFA 5SYOA 4ZK1A 2X00A 4EZ1A 3UQ4A
chains in the Genus database with same CATH superfamily
4XK9A 3WTNA 4ILBA 5J5HA 2BJ0A 3ZDHA 4TWFA 3UU5A 3RHWA 2XNTA 3JAEA 3TLUA 3U8JA 4LMLA 4HFDA 2W8FA 2XNVA 2BG9E 3C79A 2Y58A 4QABA 3EAMA 4NZBA 3U8NA 5BP0A 4XHEA 3WTHA 4WV9A 4A98A 5LG3A 1I9BA 4ZZBA 2PGZA 3WTOA 5AINA 2WNLA 4ZR6A 4HFBA 3U8MA 2W8GA 3TLWA 5FJVA 3RI5A 5CFBA 4ZJSA 3JAFA 4HFHA 1UV6A 2YMDA 4ZZCA 2BR8A 4A97A 3SQ6A 5HEOA 4X5TA 5AFKA 2BG9A 2Y57A 4PIRA 3TLVA 5L47A 4NPPA 5HEHA 3UU4A 2XQ9A 2YMEA 2BYPA 2XYTA 5LXBA 2ZJVA 5TVCA 5HCMA 2XZ6A 3RQUA 1UX2A 4ZK4A 2BG9C 4AFHA 2X00D 4UM3A 4HQPA 4HFIA 2XQ4A 2C9TA 3SQ9A 4LMKA 2ZJUA 4F8HA 5HEUA 4AFTA 4QAAA 4UM1A 5AFJA 5CO5A 2BYSA 5L4HA 3WIPA 5AFNA 3TLSA 2Y7YA 2BYRA 4UY2A 2XQAA 3RIFA 4D01A 4ALXA 4IL9A 4DBMA 5J5FA 3WTJA 3U8LA 4IL4A 2BR7A 5AFMA 2WN9A 3RQWA 2PH9A 3C84A 3ZKRA 2BYNA 5AFHA 5IUXA 2UZ6A 5KE4A 5JMEA 3RIAA 4HFEA 2WZYA 4BQTA 3UUBA 2XQ3A 3T4MA 4ZJTA 3SH1A 2XNUA 4ZRUA 2QC1B 4UXUA 2XQ8A 4TWHA 4IREA 3P50A 3UU6A 1UW6A 2YOEA 3GUAA 3PMZA 4UM3P 5HCJA 4BFQA 3U8KA 5J0ZA 2XYSA 4B5DA 2BYQA 4TNWA 3IGQA 5HEGA 2Y56A 3SIOA 4QH1A 4QH5A 3P4WA 5BRXA 2XZ5A 5AFLA 3ZDGA 2WNCA 3JADA 3WTIA 2BG9B 5AFMB 3WTMA 2XQ7A 4Z90A 3UU3A 2Y54A 4QH4A 3TLTA 2XQ5A 4ILAA 5KZUA 3UQ7A 3WTLA 4QACA 5HEJA 2YKSA 4LMJA 5J5GA 4Z91A 3EHZA 3PEOA 4TNVA 4FRRA 4TWDA 5J5IA 3WTKA 4AFGA 4UM3S 3LSVA 3UU8A 5L4EA 5BW2A 2WNJA 2YN6A 2VL0A 3EI0A 4HFCA 4ILCA 2XQ6A 4COFA 5SYOA 4ZK1A 2X00A 4EZ1A 3UQ4A
chains in the Genus database with same CATH topology
4XK9A 3WTNA 4ILBA 5J5HA 2BJ0A 3ZDHA 4TWFA 3UU5A 3RHWA 2XNTA 3JAEA 3TLUA 3U8JA 4LMLA 4HFDA 2W8FA 2XNVA 2BG9E 3C79A 2Y58A 4QABA 3EAMA 4NZBA 3U8NA 5BP0A 4XHEA 3WTHA 4WV9A 4A98A 5LG3A 1I9BA 4ZZBA 2PGZA 3WTOA 5AINA 2WNLA 4ZR6A 4HFBA 3U8MA 2W8GA 3TLWA 5FJVA 3RI5A 5CFBA 4ZJSA 3JAFA 4HFHA 1UV6A 2YMDA 4ZZCA 2BR8A 4A97A 3SQ6A 5HEOA 4X5TA 5AFKA 2BG9A 2Y57A 4PIRA 3TLVA 5L47A 4NPPA 5HEHA 3UU4A 2XQ9A 2YMEA 2BYPA 2XYTA 5LXBA 2ZJVA 5TVCA 5HCMA 2XZ6A 3RQUA 1UX2A 4ZK4A 2BG9C 4AFHA 2X00D 4UM3A 4HQPA 4HFIA 2XQ4A 2C9TA 3SQ9A 4LMKA 2ZJUA 4F8HA 5HEUA 4AFTA 4QAAA 4UM1A 5AFJA 5CO5A 2BYSA 5L4HA 3WIPA 5AFNA 3TLSA 2Y7YA 2BYRA 4UY2A 2XQAA 3RIFA 4D01A 4ALXA 4IL9A 4DBMA 5J5FA 3WTJA 3U8LA 4IL4A 2BR7A 5AFMA 2WN9A 3RQWA 2PH9A 3C84A 3ZKRA 2BYNA 5AFHA 5IUXA 2UZ6A 5KE4A 5JMEA 3RIAA 4HFEA 2WZYA 4BQTA 3UUBA 2XQ3A 3T4MA 4ZJTA 3SH1A 2XNUA 4ZRUA 2QC1B 4UXUA 2XQ8A 4TWHA 4IREA 3P50A 3UU6A 1UW6A 2YOEA 3GUAA 3PMZA 4UM3P 5HCJA 4BFQA 3U8KA 5J0ZA 2XYSA 4B5DA 2BYQA 4TNWA 3IGQA 5HEGA 2Y56A 3SIOA 4QH1A 4QH5A 3P4WA 5BRXA 2XZ5A 5AFLA 3ZDGA 2WNCA 3JADA 3WTIA 2BG9B 5AFMB 3WTMA 2XQ7A 4Z90A 3UU3A 2Y54A 4QH4A 3TLTA 2XQ5A 4ILAA 5KZUA 3UQ7A 3WTLA 4QACA 5HEJA 2YKSA 4LMJA 5J5GA 4Z91A 3EHZA 3PEOA 4TNVA 4FRRA 4TWDA 5J5IA 3WTKA 4AFGA 4UM3S 3LSVA 3UU8A 5L4EA 5BW2A 2WNJA 2YN6A 2VL0A 3EI0A 4HFCA 4ILCA 2XQ6A 4COFA 5SYOA 4ZK1A 2X00A 4EZ1A 3UQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XK9 A;  3WTN A;  4ILB A;  5J5H A;  2BJ0 A;  3ZDH A;  4TWF A;  3UU5 A;  3RHW A;  2XNT A;  3JAE A;  3TLU A;  3U8J A;  4LML A;  4HFD A;  2W8F A;  2XNV A;  2BG9 E;  3C79 A;  2Y58 A;  4QAB A;  3EAM A;  4NZB A;  3U8N A;  5BP0 A;  4XHE A;  3WTH A;  4WV9 A;  4A98 A;  5LG3 A;  1I9B A;  4ZZB A;  2PGZ A;  3WTO A;  5AIN A;  2WNL A;  4ZR6 A;  4HFB A;  3U8M A;  2W8G A;  3TLW A;  5FJV A;  3RI5 A;  5CFB A;  4ZJS A;  3JAF A;  4HFH A;  1UV6 A;  2YMD A;  4ZZC A;  2BR8 A;  4A97 A;  3SQ6 A;  5HEO A;  4X5T A;  5AFK A;  2BG9 A;  2Y57 A;  4PIR A;  3TLV A;  5L47 A;  4NPP A;  5HEH A;  3UU4 A;  2XQ9 A;  2YME A;  2BYP A;  2XYT A;  5LXB A;  2ZJV A;  5TVC A;  5HCM A;  2XZ6 A;  3RQU A;  1UX2 A;  4ZK4 A;  2BG9 C;  4AFH A;  2X00 D;  4UM3 A;  4HQP A;  4HFI A;  2XQ4 A;  2C9T A;  3SQ9 A;  4LMK A;  2ZJU A;  4F8H A;  5HEU A;  4AFT A;  4QAA A;  4UM1 A;  5AFJ A;  5CO5 A;  2BYS A;  5L4H A;  3WIP A;  5AFN A;  3TLS A;  2Y7Y A;  2BYR A;  4UY2 A;  2XQA A;  3RIF A;  4D01 A;  4ALX A;  4IL9 A;  4DBM A;  5J5F A;  3WTJ A;  3U8L A;  4IL4 A;  2BR7 A;  5AFM A;  2WN9 A;  3RQW A;  2PH9 A;  3C84 A;  3ZKR A;  2BYN A;  5AFH A;  5IUX A;  2UZ6 A;  5KE4 A;  5JME A;  3RIA A;  4HFE A;  2WZY A;  4BQT A;  3UUB A;  2XQ3 A;  3T4M A;  4ZJT A;  3SH1 A;  2XNU A;  4ZRU A;  2QC1 B;  4UXU A;  2XQ8 A;  4TWH A;  4IRE A;  3P50 A;  3UU6 A;  1UW6 A;  2YOE A;  3GUA A;  3PMZ A;  4UM3 P;  5HCJ A;  4BFQ A;  3U8K A;  5J0Z A;  2XYS A;  4B5D A;  2BYQ A;  4TNW A;  3IGQ A;  5HEG A;  2Y56 A;  3SIO A;  4QH1 A;  4QH5 A;  3P4W A;  5BRX A;  2XZ5 A;  5AFL A;  3ZDG A;  2WNC A;  3JAD A;  3WTI A;  2BG9 B;  5AFM B;  3WTM A;  2XQ7 A;  4Z90 A;  3UU3 A;  2Y54 A;  4QH4 A;  3TLT A;  2XQ5 A;  4ILA A;  5KZU A;  3UQ7 A;  3WTL A;  4QAC A;  5HEJ A;  2YKS A;  4LMJ A;  5J5G A;  4Z91 A;  3EHZ A;  3PEO A;  4TNV A;  4FRR A;  4TWD A;  5J5I A;  3WTK A;  4AFG A;  4UM3 S;  3LSV A;  3UU8 A;  5L4E A;  5BW2 A;  2WNJ A;  2YN6 A;  2VL0 A;  3EI0 A;  4HFC A;  4ILC A;  2XQ6 A;  4COF A;  5SYO A;  4ZK1 A;  2X00 A;  4EZ1 A;  3UQ4 A; 
#chains in the Genus database with same CATH topology
 4XK9 A;  3WTN A;  4ILB A;  5J5H A;  2BJ0 A;  3ZDH A;  4TWF A;  3UU5 A;  3RHW A;  2XNT A;  3JAE A;  3TLU A;  3U8J A;  4LML A;  4HFD A;  2W8F A;  2XNV A;  2BG9 E;  3C79 A;  2Y58 A;  4QAB A;  3EAM A;  4NZB A;  3U8N A;  5BP0 A;  4XHE A;  3WTH A;  4WV9 A;  4A98 A;  5LG3 A;  1I9B A;  4ZZB A;  2PGZ A;  3WTO A;  5AIN A;  2WNL A;  4ZR6 A;  4HFB A;  3U8M A;  2W8G A;  3TLW A;  5FJV A;  3RI5 A;  5CFB A;  4ZJS A;  3JAF A;  4HFH A;  1UV6 A;  2YMD A;  4ZZC A;  2BR8 A;  4A97 A;  3SQ6 A;  5HEO A;  4X5T A;  5AFK A;  2BG9 A;  2Y57 A;  4PIR A;  3TLV A;  5L47 A;  4NPP A;  5HEH A;  3UU4 A;  2XQ9 A;  2YME A;  2BYP A;  2XYT A;  5LXB A;  2ZJV A;  5TVC A;  5HCM A;  2XZ6 A;  3RQU A;  1UX2 A;  4ZK4 A;  2BG9 C;  4AFH A;  2X00 D;  4UM3 A;  4HQP A;  4HFI A;  2XQ4 A;  2C9T A;  3SQ9 A;  4LMK A;  2ZJU A;  4F8H A;  5HEU A;  4AFT A;  4QAA A;  4UM1 A;  5AFJ A;  5CO5 A;  2BYS A;  5L4H A;  3WIP A;  5AFN A;  3TLS A;  2Y7Y A;  2BYR A;  4UY2 A;  2XQA A;  3RIF A;  4D01 A;  4ALX A;  4IL9 A;  4DBM A;  5J5F A;  3WTJ A;  3U8L A;  4IL4 A;  2BR7 A;  5AFM A;  2WN9 A;  3RQW A;  2PH9 A;  3C84 A;  3ZKR A;  2BYN A;  5AFH A;  5IUX A;  2UZ6 A;  5KE4 A;  5JME A;  3RIA A;  4HFE A;  2WZY A;  4BQT A;  3UUB A;  2XQ3 A;  3T4M A;  4ZJT A;  3SH1 A;  2XNU A;  4ZRU A;  2QC1 B;  4UXU A;  2XQ8 A;  4TWH A;  4IRE A;  3P50 A;  3UU6 A;  1UW6 A;  2YOE A;  3GUA A;  3PMZ A;  4UM3 P;  5HCJ A;  4BFQ A;  3U8K A;  5J0Z A;  2XYS A;  4B5D A;  2BYQ A;  4TNW A;  3IGQ A;  5HEG A;  2Y56 A;  3SIO A;  4QH1 A;  4QH5 A;  3P4W A;  5BRX A;  2XZ5 A;  5AFL A;  3ZDG A;  2WNC A;  3JAD A;  3WTI A;  2BG9 B;  5AFM B;  3WTM A;  2XQ7 A;  4Z90 A;  3UU3 A;  2Y54 A;  4QH4 A;  3TLT A;  2XQ5 A;  4ILA A;  5KZU A;  3UQ7 A;  3WTL A;  4QAC A;  5HEJ A;  2YKS A;  4LMJ A;  5J5G A;  4Z91 A;  3EHZ A;  3PEO A;  4TNV A;  4FRR A;  4TWD A;  5J5I A;  3WTK A;  4AFG A;  4UM3 S;  3LSV A;  3UU8 A;  5L4E A;  5BW2 A;  2WNJ A;  2YN6 A;  2VL0 A;  3EI0 A;  4HFC A;  4ILC A;  2XQ6 A;  4COF A;  5SYO A;  4ZK1 A;  2X00 A;  4EZ1 A;  3UQ4 A; 
#chains in the Genus database with same CATH homology
 4XK9 A;  3WTN A;  4ILB A;  5J5H A;  2BJ0 A;  3ZDH A;  4TWF A;  3UU5 A;  3RHW A;  2XNT A;  3JAE A;  3TLU A;  3U8J A;  4LML A;  4HFD A;  2W8F A;  2XNV A;  2BG9 E;  3C79 A;  2Y58 A;  4QAB A;  3EAM A;  4NZB A;  3U8N A;  5BP0 A;  4XHE A;  3WTH A;  4WV9 A;  4A98 A;  5LG3 A;  1I9B A;  4ZZB A;  2PGZ A;  3WTO A;  5AIN A;  2WNL A;  4ZR6 A;  4HFB A;  3U8M A;  2W8G A;  3TLW A;  5FJV A;  3RI5 A;  5CFB A;  4ZJS A;  3JAF A;  4HFH A;  1UV6 A;  2YMD A;  4ZZC A;  2BR8 A;  4A97 A;  3SQ6 A;  5HEO A;  4X5T A;  5AFK A;  2BG9 A;  2Y57 A;  4PIR A;  3TLV A;  5L47 A;  4NPP A;  5HEH A;  3UU4 A;  2XQ9 A;  2YME A;  2BYP A;  2XYT A;  5LXB A;  2ZJV A;  5TVC A;  5HCM A;  2XZ6 A;  3RQU A;  1UX2 A;  4ZK4 A;  2BG9 C;  4AFH A;  2X00 D;  4UM3 A;  4HQP A;  4HFI A;  2XQ4 A;  2C9T A;  3SQ9 A;  4LMK A;  2ZJU A;  4F8H A;  5HEU A;  4AFT A;  4QAA A;  4UM1 A;  5AFJ A;  5CO5 A;  2BYS A;  5L4H A;  3WIP A;  5AFN A;  3TLS A;  2Y7Y A;  2BYR A;  4UY2 A;  2XQA A;  3RIF A;  4D01 A;  4ALX A;  4IL9 A;  4DBM A;  5J5F A;  3WTJ A;  3U8L A;  4IL4 A;  2BR7 A;  5AFM A;  2WN9 A;  3RQW A;  2PH9 A;  3C84 A;  3ZKR A;  2BYN A;  5AFH A;  5IUX A;  2UZ6 A;  5KE4 A;  5JME A;  3RIA A;  4HFE A;  2WZY A;  4BQT A;  3UUB A;  2XQ3 A;  3T4M A;  4ZJT A;  3SH1 A;  2XNU A;  4ZRU A;  2QC1 B;  4UXU A;  2XQ8 A;  4TWH A;  4IRE A;  3P50 A;  3UU6 A;  1UW6 A;  2YOE A;  3GUA A;  3PMZ A;  4UM3 P;  5HCJ A;  4BFQ A;  3U8K A;  5J0Z A;  2XYS A;  4B5D A;  2BYQ A;  4TNW A;  3IGQ A;  5HEG A;  2Y56 A;  3SIO A;  4QH1 A;  4QH5 A;  3P4W A;  5BRX A;  2XZ5 A;  5AFL A;  3ZDG A;  2WNC A;  3JAD A;  3WTI A;  2BG9 B;  5AFM B;  3WTM A;  2XQ7 A;  4Z90 A;  3UU3 A;  2Y54 A;  4QH4 A;  3TLT A;  2XQ5 A;  4ILA A;  5KZU A;  3UQ7 A;  3WTL A;  4QAC A;  5HEJ A;  2YKS A;  4LMJ A;  5J5G A;  4Z91 A;  3EHZ A;  3PEO A;  4TNV A;  4FRR A;  4TWD A;  5J5I A;  3WTK A;  4AFG A;  4UM3 S;  3LSV A;  3UU8 A;  5L4E A;  5BW2 A;  2WNJ A;  2YN6 A;  2VL0 A;  3EI0 A;  4HFC A;  4ILC A;  2XQ6 A;  4COF A;  5SYO A;  4ZK1 A;  2X00 A;  4EZ1 A;  3UQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...