4QACA

X-ray structure of acetylcholine binding protein (achbp) in complex with 4-(4-methylpiperidin-1-yl)-6-(4-(trifluoromethyl)phenyl)pyrimidin-2-amine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
209
Chain Sequence
DYKDDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Structural basis for cooperative interactions of substituted 2-aminopyrimidines with the acetylcholine binding protein.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein
total genus 52
structure length 209
sequence length 213
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4qacA00
4UM1A 5LXBA 5AFNA 4ILAA 5J5HA 3SIOA 3GUAA 4IREA 4ILCA 3SQ6A 4A98A 4PIRA 4TNWA 3WTOA 3C79A 4HFIA 4UXUA 3TLWA 5J0ZA 5KE4A 1I9BA 2X00D 2YMDA 4NZBA 5BRXA 5HCMA 4ZRUA 3IGQA 3TLSA 2Y56A 2Y57A 4D01A 4COFA 2PGZA 2XYTA 3JADA 3RIAA 1UV6A 4UM3A 5TVCA 3SQ9A 2WNCA 5AFKA 3WTJA 3U8MA 5J5GA 5BW2A 4X5TA 2BYPA 4WV9A 4ZR6A 5J5FA 5HEGA 5HEJA 2BYQA 2BR7A 3RQWA 3U8KA 4UM3P 2QC1B 2W8GA 3JAFA 4ZK4A 2BYSA 2XQ5A 4ZZBA 3WTLA 4UM3S 2XQ9A 4A97A 3EHZA 5HEOA 3RI5A 4ILBA 3U8JA 2BR8A 4QACA 4HQPA 3JAEA 2UZ6A 2WNJA 3EAMA 2XZ5A 3UU4A 2BG9B 5J5IA 3UU6A 3UQ4A 3RQUA 2ZJUA 3UU3A 4TWFA 5CFBA 4UY2A 5CO5A 3WTMA 5FJVA 5JMEA 3WIPA 3RIFA 3SH1A 5L4EA 4AFHA 3TLTA 4ZJSA 4TNVA 4AFGA 2YKSA 2Y58A 3P4WA 2BYNA 2XNTA 4LMJA 2XNVA 5AFMB 5BP0A 4HFDA 2YN6A 5SYOA 4ZJTA 2W8FA 4ZZCA 3ZDGA 4NPPA 3WTIA 4Z90A 4TWDA 3ZDHA 2BJ0A 5L4HA 2XQ7A 5AFLA 5AINA 2WZYA 4IL9A 2PH9A 2YMEA 3ZKRA 4LMLA 3P50A 5LG3A 3UQ7A 4Z91A 4BQTA 2XQ8A 3U8NA 4QH5A 2XQAA 5HEHA 1UW6A 2BG9E 5AFHA 3LSVA 2BYRA 4XK9A 2WN9A 3EI0A 2VL0A 2BG9C 4LMKA 2XZ6A 4TWHA 5KZUA 4DBMA 3RHWA 3T4MA 3PEOA 4FRRA 2WNLA 2Y54A 4ALXA 2BG9A 4B5DA 3TLUA 5IUXA 4EZ1A 3U8LA 2XQ3A 2XQ4A 3TLVA 3WTHA 5L47A 4BFQA 5AFJA 3UU8A 3WTKA 4HFHA 4F8HA 4QABA 5HEUA 4QAAA 2XNUA 2X00A 2ZJVA 2Y7YA 2XQ6A 4HFBA 4QH1A 4XHEA 5HCJA 3WTNA 3PMZA 1UX2A 2C9TA 5AFMA 3UU5A 4AFTA 2XYSA 2YOEA 4QH4A 3C84A 4HFCA 3UUBA 4IL4A 4ZK1A 4HFEA
chains in the Genus database with same CATH superfamily
4UM1A 5LXBA 5AFNA 4ILAA 5J5HA 3SIOA 3GUAA 4IREA 4ILCA 3SQ6A 4A98A 4PIRA 4TNWA 3WTOA 3C79A 4HFIA 4UXUA 3TLWA 5J0ZA 5KE4A 1I9BA 2X00D 2YMDA 4NZBA 5BRXA 5HCMA 4ZRUA 3IGQA 3TLSA 2Y56A 2Y57A 4D01A 4COFA 2PGZA 2XYTA 3JADA 3RIAA 1UV6A 4UM3A 5TVCA 3SQ9A 2WNCA 5AFKA 3WTJA 3U8MA 5J5GA 5BW2A 4X5TA 2BYPA 4WV9A 4ZR6A 5J5FA 5HEGA 5HEJA 2BYQA 2BR7A 3RQWA 3U8KA 4UM3P 2QC1B 2W8GA 3JAFA 4ZK4A 2BYSA 2XQ5A 4ZZBA 3WTLA 4UM3S 2XQ9A 4A97A 3EHZA 5HEOA 3RI5A 4ILBA 3U8JA 2BR8A 4QACA 4HQPA 3JAEA 2UZ6A 2WNJA 3EAMA 2XZ5A 3UU4A 2BG9B 5J5IA 3UU6A 3UQ4A 3RQUA 2ZJUA 3UU3A 4TWFA 5CFBA 4UY2A 5CO5A 3WTMA 5FJVA 5JMEA 3WIPA 3RIFA 3SH1A 5L4EA 4AFHA 3TLTA 4ZJSA 4TNVA 4AFGA 2YKSA 2Y58A 3P4WA 2BYNA 2XNTA 4LMJA 2XNVA 5AFMB 5BP0A 4HFDA 2YN6A 5SYOA 4ZJTA 2W8FA 4ZZCA 3ZDGA 4NPPA 3WTIA 4Z90A 4TWDA 3ZDHA 2BJ0A 5L4HA 2XQ7A 5AFLA 5AINA 2WZYA 4IL9A 2PH9A 2YMEA 3ZKRA 4LMLA 3P50A 5LG3A 3UQ7A 4Z91A 4BQTA 2XQ8A 3U8NA 4QH5A 2XQAA 5HEHA 1UW6A 2BG9E 5AFHA 3LSVA 2BYRA 4XK9A 2WN9A 3EI0A 2VL0A 2BG9C 4LMKA 2XZ6A 4TWHA 5KZUA 4DBMA 3RHWA 3T4MA 3PEOA 4FRRA 2WNLA 2Y54A 4ALXA 2BG9A 4B5DA 3TLUA 5IUXA 4EZ1A 3U8LA 2XQ3A 2XQ4A 3TLVA 3WTHA 5L47A 4BFQA 5AFJA 3UU8A 3WTKA 4HFHA 4F8HA 4QABA 5HEUA 4QAAA 2XNUA 2X00A 2ZJVA 2Y7YA 2XQ6A 4HFBA 4QH1A 4XHEA 5HCJA 3WTNA 3PMZA 1UX2A 2C9TA 5AFMA 3UU5A 4AFTA 2XYSA 2YOEA 4QH4A 3C84A 4HFCA 3UUBA 4IL4A 4ZK1A 4HFEA
chains in the Genus database with same CATH topology
4UM1A 5LXBA 5AFNA 4ILAA 5J5HA 3SIOA 3GUAA 4IREA 4ILCA 3SQ6A 4A98A 4PIRA 4TNWA 3WTOA 3C79A 4HFIA 4UXUA 3TLWA 5J0ZA 5KE4A 1I9BA 2X00D 2YMDA 4NZBA 5BRXA 5HCMA 4ZRUA 3IGQA 3TLSA 2Y56A 2Y57A 4D01A 4COFA 2PGZA 2XYTA 3JADA 3RIAA 1UV6A 4UM3A 5TVCA 3SQ9A 2WNCA 5AFKA 3WTJA 3U8MA 5J5GA 5BW2A 4X5TA 2BYPA 4WV9A 4ZR6A 5J5FA 5HEGA 5HEJA 2BYQA 2BR7A 3RQWA 3U8KA 4UM3P 2QC1B 2W8GA 3JAFA 4ZK4A 2BYSA 2XQ5A 4ZZBA 3WTLA 4UM3S 2XQ9A 4A97A 3EHZA 5HEOA 3RI5A 4ILBA 3U8JA 2BR8A 4QACA 4HQPA 3JAEA 2UZ6A 2WNJA 3EAMA 2XZ5A 3UU4A 2BG9B 5J5IA 3UU6A 3UQ4A 3RQUA 2ZJUA 3UU3A 4TWFA 5CFBA 4UY2A 5CO5A 3WTMA 5FJVA 5JMEA 3WIPA 3RIFA 3SH1A 5L4EA 4AFHA 3TLTA 4ZJSA 4TNVA 4AFGA 2YKSA 2Y58A 3P4WA 2BYNA 2XNTA 4LMJA 2XNVA 5AFMB 5BP0A 4HFDA 2YN6A 5SYOA 4ZJTA 2W8FA 4ZZCA 3ZDGA 4NPPA 3WTIA 4Z90A 4TWDA 3ZDHA 2BJ0A 5L4HA 2XQ7A 5AFLA 5AINA 2WZYA 4IL9A 2PH9A 2YMEA 3ZKRA 4LMLA 3P50A 5LG3A 3UQ7A 4Z91A 4BQTA 2XQ8A 3U8NA 4QH5A 2XQAA 5HEHA 1UW6A 2BG9E 5AFHA 3LSVA 2BYRA 4XK9A 2WN9A 3EI0A 2VL0A 2BG9C 4LMKA 2XZ6A 4TWHA 5KZUA 4DBMA 3RHWA 3T4MA 3PEOA 4FRRA 2WNLA 2Y54A 4ALXA 2BG9A 4B5DA 3TLUA 5IUXA 4EZ1A 3U8LA 2XQ3A 2XQ4A 3TLVA 3WTHA 5L47A 4BFQA 5AFJA 3UU8A 3WTKA 4HFHA 4F8HA 4QABA 5HEUA 4QAAA 2XNUA 2X00A 2ZJVA 2Y7YA 2XQ6A 4HFBA 4QH1A 4XHEA 5HCJA 3WTNA 3PMZA 1UX2A 2C9TA 5AFMA 3UU5A 4AFTA 2XYSA 2YOEA 4QH4A 3C84A 4HFCA 3UUBA 4IL4A 4ZK1A 4HFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM1 A;  5LXB A;  5AFN A;  4ILA A;  5J5H A;  3SIO A;  3GUA A;  4IRE A;  4ILC A;  3SQ6 A;  4A98 A;  4PIR A;  4TNW A;  3WTO A;  3C79 A;  4HFI A;  4UXU A;  3TLW A;  5J0Z A;  5KE4 A;  1I9B A;  2X00 D;  2YMD A;  4NZB A;  5BRX A;  5HCM A;  4ZRU A;  3IGQ A;  3TLS A;  2Y56 A;  2Y57 A;  4D01 A;  4COF A;  2PGZ A;  2XYT A;  3JAD A;  3RIA A;  1UV6 A;  4UM3 A;  5TVC A;  3SQ9 A;  2WNC A;  5AFK A;  3WTJ A;  3U8M A;  5J5G A;  5BW2 A;  4X5T A;  2BYP A;  4WV9 A;  4ZR6 A;  5J5F A;  5HEG A;  5HEJ A;  2BYQ A;  2BR7 A;  3RQW A;  3U8K A;  4UM3 P;  2QC1 B;  2W8G A;  3JAF A;  4ZK4 A;  2BYS A;  2XQ5 A;  4ZZB A;  3WTL A;  4UM3 S;  2XQ9 A;  4A97 A;  3EHZ A;  5HEO A;  3RI5 A;  4ILB A;  3U8J A;  2BR8 A;  4QAC A;  4HQP A;  3JAE A;  2UZ6 A;  2WNJ A;  3EAM A;  2XZ5 A;  3UU4 A;  2BG9 B;  5J5I A;  3UU6 A;  3UQ4 A;  3RQU A;  2ZJU A;  3UU3 A;  4TWF A;  5CFB A;  4UY2 A;  5CO5 A;  3WTM A;  5FJV A;  5JME A;  3WIP A;  3RIF A;  3SH1 A;  5L4E A;  4AFH A;  3TLT A;  4ZJS A;  4TNV A;  4AFG A;  2YKS A;  2Y58 A;  3P4W A;  2BYN A;  2XNT A;  4LMJ A;  2XNV A;  5AFM B;  5BP0 A;  4HFD A;  2YN6 A;  5SYO A;  4ZJT A;  2W8F A;  4ZZC A;  3ZDG A;  4NPP A;  3WTI A;  4Z90 A;  4TWD A;  3ZDH A;  2BJ0 A;  5L4H A;  2XQ7 A;  5AFL A;  5AIN A;  2WZY A;  4IL9 A;  2PH9 A;  2YME A;  3ZKR A;  4LML A;  3P50 A;  5LG3 A;  3UQ7 A;  4Z91 A;  4BQT A;  2XQ8 A;  3U8N A;  4QH5 A;  2XQA A;  5HEH A;  1UW6 A;  2BG9 E;  5AFH A;  3LSV A;  2BYR A;  4XK9 A;  2WN9 A;  3EI0 A;  2VL0 A;  2BG9 C;  4LMK A;  2XZ6 A;  4TWH A;  5KZU A;  4DBM A;  3RHW A;  3T4M A;  3PEO A;  4FRR A;  2WNL A;  2Y54 A;  4ALX A;  2BG9 A;  4B5D A;  3TLU A;  5IUX A;  4EZ1 A;  3U8L A;  2XQ3 A;  2XQ4 A;  3TLV A;  3WTH A;  5L47 A;  4BFQ A;  5AFJ A;  3UU8 A;  3WTK A;  4HFH A;  4F8H A;  4QAB A;  5HEU A;  4QAA A;  2XNU A;  2X00 A;  2ZJV A;  2Y7Y A;  2XQ6 A;  4HFB A;  4QH1 A;  4XHE A;  5HCJ A;  3WTN A;  3PMZ A;  1UX2 A;  2C9T A;  5AFM A;  3UU5 A;  4AFT A;  2XYS A;  2YOE A;  4QH4 A;  3C84 A;  4HFC A;  3UUB A;  4IL4 A;  4ZK1 A;  4HFE A; 
#chains in the Genus database with same CATH topology
 4UM1 A;  5LXB A;  5AFN A;  4ILA A;  5J5H A;  3SIO A;  3GUA A;  4IRE A;  4ILC A;  3SQ6 A;  4A98 A;  4PIR A;  4TNW A;  3WTO A;  3C79 A;  4HFI A;  4UXU A;  3TLW A;  5J0Z A;  5KE4 A;  1I9B A;  2X00 D;  2YMD A;  4NZB A;  5BRX A;  5HCM A;  4ZRU A;  3IGQ A;  3TLS A;  2Y56 A;  2Y57 A;  4D01 A;  4COF A;  2PGZ A;  2XYT A;  3JAD A;  3RIA A;  1UV6 A;  4UM3 A;  5TVC A;  3SQ9 A;  2WNC A;  5AFK A;  3WTJ A;  3U8M A;  5J5G A;  5BW2 A;  4X5T A;  2BYP A;  4WV9 A;  4ZR6 A;  5J5F A;  5HEG A;  5HEJ A;  2BYQ A;  2BR7 A;  3RQW A;  3U8K A;  4UM3 P;  2QC1 B;  2W8G A;  3JAF A;  4ZK4 A;  2BYS A;  2XQ5 A;  4ZZB A;  3WTL A;  4UM3 S;  2XQ9 A;  4A97 A;  3EHZ A;  5HEO A;  3RI5 A;  4ILB A;  3U8J A;  2BR8 A;  4QAC A;  4HQP A;  3JAE A;  2UZ6 A;  2WNJ A;  3EAM A;  2XZ5 A;  3UU4 A;  2BG9 B;  5J5I A;  3UU6 A;  3UQ4 A;  3RQU A;  2ZJU A;  3UU3 A;  4TWF A;  5CFB A;  4UY2 A;  5CO5 A;  3WTM A;  5FJV A;  5JME A;  3WIP A;  3RIF A;  3SH1 A;  5L4E A;  4AFH A;  3TLT A;  4ZJS A;  4TNV A;  4AFG A;  2YKS A;  2Y58 A;  3P4W A;  2BYN A;  2XNT A;  4LMJ A;  2XNV A;  5AFM B;  5BP0 A;  4HFD A;  2YN6 A;  5SYO A;  4ZJT A;  2W8F A;  4ZZC A;  3ZDG A;  4NPP A;  3WTI A;  4Z90 A;  4TWD A;  3ZDH A;  2BJ0 A;  5L4H A;  2XQ7 A;  5AFL A;  5AIN A;  2WZY A;  4IL9 A;  2PH9 A;  2YME A;  3ZKR A;  4LML A;  3P50 A;  5LG3 A;  3UQ7 A;  4Z91 A;  4BQT A;  2XQ8 A;  3U8N A;  4QH5 A;  2XQA A;  5HEH A;  1UW6 A;  2BG9 E;  5AFH A;  3LSV A;  2BYR A;  4XK9 A;  2WN9 A;  3EI0 A;  2VL0 A;  2BG9 C;  4LMK A;  2XZ6 A;  4TWH A;  5KZU A;  4DBM A;  3RHW A;  3T4M A;  3PEO A;  4FRR A;  2WNL A;  2Y54 A;  4ALX A;  2BG9 A;  4B5D A;  3TLU A;  5IUX A;  4EZ1 A;  3U8L A;  2XQ3 A;  2XQ4 A;  3TLV A;  3WTH A;  5L47 A;  4BFQ A;  5AFJ A;  3UU8 A;  3WTK A;  4HFH A;  4F8H A;  4QAB A;  5HEU A;  4QAA A;  2XNU A;  2X00 A;  2ZJV A;  2Y7Y A;  2XQ6 A;  4HFB A;  4QH1 A;  4XHE A;  5HCJ A;  3WTN A;  3PMZ A;  1UX2 A;  2C9T A;  5AFM A;  3UU5 A;  4AFT A;  2XYS A;  2YOE A;  4QH4 A;  3C84 A;  4HFC A;  3UUB A;  4IL4 A;  4ZK1 A;  4HFE A; 
#chains in the Genus database with same CATH homology
 4UM1 A;  5LXB A;  5AFN A;  4ILA A;  5J5H A;  3SIO A;  3GUA A;  4IRE A;  4ILC A;  3SQ6 A;  4A98 A;  4PIR A;  4TNW A;  3WTO A;  3C79 A;  4HFI A;  4UXU A;  3TLW A;  5J0Z A;  5KE4 A;  1I9B A;  2X00 D;  2YMD A;  4NZB A;  5BRX A;  5HCM A;  4ZRU A;  3IGQ A;  3TLS A;  2Y56 A;  2Y57 A;  4D01 A;  4COF A;  2PGZ A;  2XYT A;  3JAD A;  3RIA A;  1UV6 A;  4UM3 A;  5TVC A;  3SQ9 A;  2WNC A;  5AFK A;  3WTJ A;  3U8M A;  5J5G A;  5BW2 A;  4X5T A;  2BYP A;  4WV9 A;  4ZR6 A;  5J5F A;  5HEG A;  5HEJ A;  2BYQ A;  2BR7 A;  3RQW A;  3U8K A;  4UM3 P;  2QC1 B;  2W8G A;  3JAF A;  4ZK4 A;  2BYS A;  2XQ5 A;  4ZZB A;  3WTL A;  4UM3 S;  2XQ9 A;  4A97 A;  3EHZ A;  5HEO A;  3RI5 A;  4ILB A;  3U8J A;  2BR8 A;  4QAC A;  4HQP A;  3JAE A;  2UZ6 A;  2WNJ A;  3EAM A;  2XZ5 A;  3UU4 A;  2BG9 B;  5J5I A;  3UU6 A;  3UQ4 A;  3RQU A;  2ZJU A;  3UU3 A;  4TWF A;  5CFB A;  4UY2 A;  5CO5 A;  3WTM A;  5FJV A;  5JME A;  3WIP A;  3RIF A;  3SH1 A;  5L4E A;  4AFH A;  3TLT A;  4ZJS A;  4TNV A;  4AFG A;  2YKS A;  2Y58 A;  3P4W A;  2BYN A;  2XNT A;  4LMJ A;  2XNV A;  5AFM B;  5BP0 A;  4HFD A;  2YN6 A;  5SYO A;  4ZJT A;  2W8F A;  4ZZC A;  3ZDG A;  4NPP A;  3WTI A;  4Z90 A;  4TWD A;  3ZDH A;  2BJ0 A;  5L4H A;  2XQ7 A;  5AFL A;  5AIN A;  2WZY A;  4IL9 A;  2PH9 A;  2YME A;  3ZKR A;  4LML A;  3P50 A;  5LG3 A;  3UQ7 A;  4Z91 A;  4BQT A;  2XQ8 A;  3U8N A;  4QH5 A;  2XQA A;  5HEH A;  1UW6 A;  2BG9 E;  5AFH A;  3LSV A;  2BYR A;  4XK9 A;  2WN9 A;  3EI0 A;  2VL0 A;  2BG9 C;  4LMK A;  2XZ6 A;  4TWH A;  5KZU A;  4DBM A;  3RHW A;  3T4M A;  3PEO A;  4FRR A;  2WNL A;  2Y54 A;  4ALX A;  2BG9 A;  4B5D A;  3TLU A;  5IUX A;  4EZ1 A;  3U8L A;  2XQ3 A;  2XQ4 A;  3TLV A;  3WTH A;  5L47 A;  4BFQ A;  5AFJ A;  3UU8 A;  3WTK A;  4HFH A;  4F8H A;  4QAB A;  5HEU A;  4QAA A;  2XNU A;  2X00 A;  2ZJV A;  2Y7Y A;  2XQ6 A;  4HFB A;  4QH1 A;  4XHE A;  5HCJ A;  3WTN A;  3PMZ A;  1UX2 A;  2C9T A;  5AFM A;  3UU5 A;  4AFT A;  2XYS A;  2YOE A;  4QH4 A;  3C84 A;  4HFC A;  3UUB A;  4IL4 A;  4ZK1 A;  4HFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...