3U8KA

Crystal structure of the acetylcholine binding protein (achbp) from lymnaea stagnalis in complex with ns3573 (1-(5-ethoxypyridin-3-yl)-1,4-diazepane)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
209
structure length
209
Chain Sequence
b'LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine alpha 4 beta 2 receptors: unique role of halogen bonding revealed.
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine-binding protein/agonist
total genus 49
structure length 209
sequence length 209
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3u8kA00
3T4MA 4DBMA 2XNTA 4AFTA 3ZDHA 3ZDGA 5BW2A 2Y56A 3WTIA 4BFQA 3UU5A 4HFCA 3TLWA 3JADA 2YKSA 2BG9B 2PH9A 4WV9A 3RI5A 4IL9A 4HFIA 3GUAA 5J5FA 5JMEA 2WZYA 3U8NA 2XQ4A 2VL0A 2W8GA 2XNUA 4HFDA 3UQ7A 2BYNA 2WNCA 4ZR6A 4ZJSA 5LG3A 1UW6A 5TVCA 5AFMB 4BQTA 3UUBA 3IGQA 4NZBA 4NPPA 4UM3P 2WN9A 3RQWA 4HFBA 3UU8A 4QH5A 3RQUA 5KE4A 2YMDA 2WNJA 2XYTA 2PGZA 3PMZA 3EHZA 4F8HA 5J0ZA 3LSVA 4LMLA 2XQ6A 5HEUA 4ZK4A 2UZ6A 3WTMA 2BR7A 4TNVA 4ZJTA 3U8KA 5BP0A 2YMEA 4LMJA 4Z90A 2Y58A 2XQ5A 3EAMA 4HFHA 5CO5A 2BJ0A 3RHWA 3TLVA 3U8LA 5HEGA 3WTJA 1UX2A 3WTKA 5IUXA 3SIOA 3U8JA 4AFHA 5BRXA 5LXBA 3TLTA 2BG9A 4UY2A 5AFKA 4AFGA 3JAEA 2XQ9A 2C9TA 2QC1B 4QACA 3SQ6A 5AFNA 3C84A 2XYSA 4ZZBA 2ZJVA 3RIAA 4ZZCA 2ZJUA 2YN6A 2BYSA 4HQPA 4X5TA 4LMKA 3ZKRA 5AINA 4TNWA 2WNLA 4QABA 2YOEA 5AFMA 2XZ6A 2X00A 5J5HA 2BR8A 5AFLA 3EI0A 4UXUA 2Y7YA 4XHEA 5HCJA 3UQ4A 4EZ1A 3WTNA 5CFBA 5HEOA 3JAFA 3UU4A 5HEJA 2Y57A 5J5GA 4Z91A 5HCMA 3WTOA 4TWDA 4FRRA 4QAAA 4TWHA 5L4HA 3RIFA 3P4WA 4HFEA 3PEOA 5HEHA 2BYPA 2BYQA 3WTHA 4ILAA 4UM3A 3SQ9A 4UM3S 5SYOA 2XNVA 2XQ8A 1I9BA 4D01A 4ILBA 5AFHA 3WTLA 2XQ7A 4ZRUA 2XQ3A 2Y54A 4PIRA 5KZUA 5J5IA 2BG9E 3WIPA 4B5DA 4QH4A 2XZ5A 4COFA 4TWFA 3UU6A 5L47A 2X00D 4A97A 1UV6A 2BG9C 4IREA 4XK9A 2W8FA 3P50A 3TLSA 5FJVA 3SH1A 4ALXA 4A98A 4ILCA 3U8MA 3C79A 4ZK1A 5AFJA 5L4EA 3UU3A 4QH1A 4UM1A 2XQAA 4IL4A 3TLUA 2BYRA
chains in the Genus database with same CATH superfamily
3T4MA 4DBMA 2XNTA 4AFTA 3ZDHA 3ZDGA 5BW2A 2Y56A 3WTIA 4BFQA 3UU5A 4HFCA 3TLWA 3JADA 2YKSA 2BG9B 2PH9A 4WV9A 3RI5A 4IL9A 4HFIA 3GUAA 5J5FA 5JMEA 2WZYA 3U8NA 2XQ4A 2VL0A 2W8GA 2XNUA 4HFDA 3UQ7A 2BYNA 2WNCA 4ZR6A 4ZJSA 5LG3A 1UW6A 5TVCA 5AFMB 4BQTA 3UUBA 3IGQA 4NZBA 4NPPA 4UM3P 2WN9A 3RQWA 4HFBA 3UU8A 4QH5A 3RQUA 5KE4A 2YMDA 2WNJA 2XYTA 2PGZA 3PMZA 3EHZA 4F8HA 5J0ZA 3LSVA 4LMLA 2XQ6A 5HEUA 4ZK4A 2UZ6A 3WTMA 2BR7A 4TNVA 4ZJTA 3U8KA 5BP0A 2YMEA 4LMJA 4Z90A 2Y58A 2XQ5A 3EAMA 4HFHA 5CO5A 2BJ0A 3RHWA 3TLVA 3U8LA 5HEGA 3WTJA 1UX2A 3WTKA 5IUXA 3SIOA 3U8JA 4AFHA 5BRXA 5LXBA 3TLTA 2BG9A 4UY2A 5AFKA 4AFGA 3JAEA 2XQ9A 2C9TA 2QC1B 4QACA 3SQ6A 5AFNA 3C84A 2XYSA 4ZZBA 2ZJVA 3RIAA 4ZZCA 2ZJUA 2YN6A 2BYSA 4HQPA 4X5TA 4LMKA 3ZKRA 5AINA 4TNWA 2WNLA 4QABA 2YOEA 5AFMA 2XZ6A 2X00A 5J5HA 2BR8A 5AFLA 3EI0A 4UXUA 2Y7YA 4XHEA 5HCJA 3UQ4A 4EZ1A 3WTNA 5CFBA 5HEOA 3JAFA 3UU4A 5HEJA 2Y57A 5J5GA 4Z91A 5HCMA 3WTOA 4TWDA 4FRRA 4QAAA 4TWHA 5L4HA 3RIFA 3P4WA 4HFEA 3PEOA 5HEHA 2BYPA 2BYQA 3WTHA 4ILAA 4UM3A 3SQ9A 4UM3S 5SYOA 2XNVA 2XQ8A 1I9BA 4D01A 4ILBA 5AFHA 3WTLA 2XQ7A 4ZRUA 2XQ3A 2Y54A 4PIRA 5KZUA 5J5IA 2BG9E 3WIPA 4B5DA 4QH4A 2XZ5A 4COFA 4TWFA 3UU6A 5L47A 2X00D 4A97A 1UV6A 2BG9C 4IREA 4XK9A 2W8FA 3P50A 3TLSA 5FJVA 3SH1A 4ALXA 4A98A 4ILCA 3U8MA 3C79A 4ZK1A 5AFJA 5L4EA 3UU3A 4QH1A 4UM1A 2XQAA 4IL4A 3TLUA 2BYRA
chains in the Genus database with same CATH topology
3T4MA 4DBMA 2XNTA 4AFTA 3ZDHA 3ZDGA 5BW2A 2Y56A 3WTIA 4BFQA 3UU5A 4HFCA 3TLWA 3JADA 2YKSA 2BG9B 2PH9A 4WV9A 3RI5A 4IL9A 4HFIA 3GUAA 5J5FA 5JMEA 2WZYA 3U8NA 2XQ4A 2VL0A 2W8GA 2XNUA 4HFDA 3UQ7A 2BYNA 2WNCA 4ZR6A 4ZJSA 5LG3A 1UW6A 5TVCA 5AFMB 4BQTA 3UUBA 3IGQA 4NZBA 4NPPA 4UM3P 2WN9A 3RQWA 4HFBA 3UU8A 4QH5A 3RQUA 5KE4A 2YMDA 2WNJA 2XYTA 2PGZA 3PMZA 3EHZA 4F8HA 5J0ZA 3LSVA 4LMLA 2XQ6A 5HEUA 4ZK4A 2UZ6A 3WTMA 2BR7A 4TNVA 4ZJTA 3U8KA 5BP0A 2YMEA 4LMJA 4Z90A 2Y58A 2XQ5A 3EAMA 4HFHA 5CO5A 2BJ0A 3RHWA 3TLVA 3U8LA 5HEGA 3WTJA 1UX2A 3WTKA 5IUXA 3SIOA 3U8JA 4AFHA 5BRXA 5LXBA 3TLTA 2BG9A 4UY2A 5AFKA 4AFGA 3JAEA 2XQ9A 2C9TA 2QC1B 4QACA 3SQ6A 5AFNA 3C84A 2XYSA 4ZZBA 2ZJVA 3RIAA 4ZZCA 2ZJUA 2YN6A 2BYSA 4HQPA 4X5TA 4LMKA 3ZKRA 5AINA 4TNWA 2WNLA 4QABA 2YOEA 5AFMA 2XZ6A 2X00A 5J5HA 2BR8A 5AFLA 3EI0A 4UXUA 2Y7YA 4XHEA 5HCJA 3UQ4A 4EZ1A 3WTNA 5CFBA 5HEOA 3JAFA 3UU4A 5HEJA 2Y57A 5J5GA 4Z91A 5HCMA 3WTOA 4TWDA 4FRRA 4QAAA 4TWHA 5L4HA 3RIFA 3P4WA 4HFEA 3PEOA 5HEHA 2BYPA 2BYQA 3WTHA 4ILAA 4UM3A 3SQ9A 4UM3S 5SYOA 2XNVA 2XQ8A 1I9BA 4D01A 4ILBA 5AFHA 3WTLA 2XQ7A 4ZRUA 2XQ3A 2Y54A 4PIRA 5KZUA 5J5IA 2BG9E 3WIPA 4B5DA 4QH4A 2XZ5A 4COFA 4TWFA 3UU6A 5L47A 2X00D 4A97A 1UV6A 2BG9C 4IREA 4XK9A 2W8FA 3P50A 3TLSA 5FJVA 3SH1A 4ALXA 4A98A 4ILCA 3U8MA 3C79A 4ZK1A 5AFJA 5L4EA 3UU3A 4QH1A 4UM1A 2XQAA 4IL4A 3TLUA 2BYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4M A;  4DBM A;  2XNT A;  4AFT A;  3ZDH A;  3ZDG A;  5BW2 A;  2Y56 A;  3WTI A;  4BFQ A;  3UU5 A;  4HFC A;  3TLW A;  3JAD A;  2YKS A;  2BG9 B;  2PH9 A;  4WV9 A;  3RI5 A;  4IL9 A;  4HFI A;  3GUA A;  5J5F A;  5JME A;  2WZY A;  3U8N A;  2XQ4 A;  2VL0 A;  2W8G A;  2XNU A;  4HFD A;  3UQ7 A;  2BYN A;  2WNC A;  4ZR6 A;  4ZJS A;  5LG3 A;  1UW6 A;  5TVC A;  5AFM B;  4BQT A;  3UUB A;  3IGQ A;  4NZB A;  4NPP A;  4UM3 P;  2WN9 A;  3RQW A;  4HFB A;  3UU8 A;  4QH5 A;  3RQU A;  5KE4 A;  2YMD A;  2WNJ A;  2XYT A;  2PGZ A;  3PMZ A;  3EHZ A;  4F8H A;  5J0Z A;  3LSV A;  4LML A;  2XQ6 A;  5HEU A;  4ZK4 A;  2UZ6 A;  3WTM A;  2BR7 A;  4TNV A;  4ZJT A;  3U8K A;  5BP0 A;  2YME A;  4LMJ A;  4Z90 A;  2Y58 A;  2XQ5 A;  3EAM A;  4HFH A;  5CO5 A;  2BJ0 A;  3RHW A;  3TLV A;  3U8L A;  5HEG A;  3WTJ A;  1UX2 A;  3WTK A;  5IUX A;  3SIO A;  3U8J A;  4AFH A;  5BRX A;  5LXB A;  3TLT A;  2BG9 A;  4UY2 A;  5AFK A;  4AFG A;  3JAE A;  2XQ9 A;  2C9T A;  2QC1 B;  4QAC A;  3SQ6 A;  5AFN A;  3C84 A;  2XYS A;  4ZZB A;  2ZJV A;  3RIA A;  4ZZC A;  2ZJU A;  2YN6 A;  2BYS A;  4HQP A;  4X5T A;  4LMK A;  3ZKR A;  5AIN A;  4TNW A;  2WNL A;  4QAB A;  2YOE A;  5AFM A;  2XZ6 A;  2X00 A;  5J5H A;  2BR8 A;  5AFL A;  3EI0 A;  4UXU A;  2Y7Y A;  4XHE A;  5HCJ A;  3UQ4 A;  4EZ1 A;  3WTN A;  5CFB A;  5HEO A;  3JAF A;  3UU4 A;  5HEJ A;  2Y57 A;  5J5G A;  4Z91 A;  5HCM A;  3WTO A;  4TWD A;  4FRR A;  4QAA A;  4TWH A;  5L4H A;  3RIF A;  3P4W A;  4HFE A;  3PEO A;  5HEH A;  2BYP A;  2BYQ A;  3WTH A;  4ILA A;  4UM3 A;  3SQ9 A;  4UM3 S;  5SYO A;  2XNV A;  2XQ8 A;  1I9B A;  4D01 A;  4ILB A;  5AFH A;  3WTL A;  2XQ7 A;  4ZRU A;  2XQ3 A;  2Y54 A;  4PIR A;  5KZU A;  5J5I A;  2BG9 E;  3WIP A;  4B5D A;  4QH4 A;  2XZ5 A;  4COF A;  4TWF A;  3UU6 A;  5L47 A;  2X00 D;  4A97 A;  1UV6 A;  2BG9 C;  4IRE A;  4XK9 A;  2W8F A;  3P50 A;  3TLS A;  5FJV A;  3SH1 A;  4ALX A;  4A98 A;  4ILC A;  3U8M A;  3C79 A;  4ZK1 A;  5AFJ A;  5L4E A;  3UU3 A;  4QH1 A;  4UM1 A;  2XQA A;  4IL4 A;  3TLU A;  2BYR A; 
#chains in the Genus database with same CATH topology
 3T4M A;  4DBM A;  2XNT A;  4AFT A;  3ZDH A;  3ZDG A;  5BW2 A;  2Y56 A;  3WTI A;  4BFQ A;  3UU5 A;  4HFC A;  3TLW A;  3JAD A;  2YKS A;  2BG9 B;  2PH9 A;  4WV9 A;  3RI5 A;  4IL9 A;  4HFI A;  3GUA A;  5J5F A;  5JME A;  2WZY A;  3U8N A;  2XQ4 A;  2VL0 A;  2W8G A;  2XNU A;  4HFD A;  3UQ7 A;  2BYN A;  2WNC A;  4ZR6 A;  4ZJS A;  5LG3 A;  1UW6 A;  5TVC A;  5AFM B;  4BQT A;  3UUB A;  3IGQ A;  4NZB A;  4NPP A;  4UM3 P;  2WN9 A;  3RQW A;  4HFB A;  3UU8 A;  4QH5 A;  3RQU A;  5KE4 A;  2YMD A;  2WNJ A;  2XYT A;  2PGZ A;  3PMZ A;  3EHZ A;  4F8H A;  5J0Z A;  3LSV A;  4LML A;  2XQ6 A;  5HEU A;  4ZK4 A;  2UZ6 A;  3WTM A;  2BR7 A;  4TNV A;  4ZJT A;  3U8K A;  5BP0 A;  2YME A;  4LMJ A;  4Z90 A;  2Y58 A;  2XQ5 A;  3EAM A;  4HFH A;  5CO5 A;  2BJ0 A;  3RHW A;  3TLV A;  3U8L A;  5HEG A;  3WTJ A;  1UX2 A;  3WTK A;  5IUX A;  3SIO A;  3U8J A;  4AFH A;  5BRX A;  5LXB A;  3TLT A;  2BG9 A;  4UY2 A;  5AFK A;  4AFG A;  3JAE A;  2XQ9 A;  2C9T A;  2QC1 B;  4QAC A;  3SQ6 A;  5AFN A;  3C84 A;  2XYS A;  4ZZB A;  2ZJV A;  3RIA A;  4ZZC A;  2ZJU A;  2YN6 A;  2BYS A;  4HQP A;  4X5T A;  4LMK A;  3ZKR A;  5AIN A;  4TNW A;  2WNL A;  4QAB A;  2YOE A;  5AFM A;  2XZ6 A;  2X00 A;  5J5H A;  2BR8 A;  5AFL A;  3EI0 A;  4UXU A;  2Y7Y A;  4XHE A;  5HCJ A;  3UQ4 A;  4EZ1 A;  3WTN A;  5CFB A;  5HEO A;  3JAF A;  3UU4 A;  5HEJ A;  2Y57 A;  5J5G A;  4Z91 A;  5HCM A;  3WTO A;  4TWD A;  4FRR A;  4QAA A;  4TWH A;  5L4H A;  3RIF A;  3P4W A;  4HFE A;  3PEO A;  5HEH A;  2BYP A;  2BYQ A;  3WTH A;  4ILA A;  4UM3 A;  3SQ9 A;  4UM3 S;  5SYO A;  2XNV A;  2XQ8 A;  1I9B A;  4D01 A;  4ILB A;  5AFH A;  3WTL A;  2XQ7 A;  4ZRU A;  2XQ3 A;  2Y54 A;  4PIR A;  5KZU A;  5J5I A;  2BG9 E;  3WIP A;  4B5D A;  4QH4 A;  2XZ5 A;  4COF A;  4TWF A;  3UU6 A;  5L47 A;  2X00 D;  4A97 A;  1UV6 A;  2BG9 C;  4IRE A;  4XK9 A;  2W8F A;  3P50 A;  3TLS A;  5FJV A;  3SH1 A;  4ALX A;  4A98 A;  4ILC A;  3U8M A;  3C79 A;  4ZK1 A;  5AFJ A;  5L4E A;  3UU3 A;  4QH1 A;  4UM1 A;  2XQA A;  4IL4 A;  3TLU A;  2BYR A; 
#chains in the Genus database with same CATH homology
 3T4M A;  4DBM A;  2XNT A;  4AFT A;  3ZDH A;  3ZDG A;  5BW2 A;  2Y56 A;  3WTI A;  4BFQ A;  3UU5 A;  4HFC A;  3TLW A;  3JAD A;  2YKS A;  2BG9 B;  2PH9 A;  4WV9 A;  3RI5 A;  4IL9 A;  4HFI A;  3GUA A;  5J5F A;  5JME A;  2WZY A;  3U8N A;  2XQ4 A;  2VL0 A;  2W8G A;  2XNU A;  4HFD A;  3UQ7 A;  2BYN A;  2WNC A;  4ZR6 A;  4ZJS A;  5LG3 A;  1UW6 A;  5TVC A;  5AFM B;  4BQT A;  3UUB A;  3IGQ A;  4NZB A;  4NPP A;  4UM3 P;  2WN9 A;  3RQW A;  4HFB A;  3UU8 A;  4QH5 A;  3RQU A;  5KE4 A;  2YMD A;  2WNJ A;  2XYT A;  2PGZ A;  3PMZ A;  3EHZ A;  4F8H A;  5J0Z A;  3LSV A;  4LML A;  2XQ6 A;  5HEU A;  4ZK4 A;  2UZ6 A;  3WTM A;  2BR7 A;  4TNV A;  4ZJT A;  3U8K A;  5BP0 A;  2YME A;  4LMJ A;  4Z90 A;  2Y58 A;  2XQ5 A;  3EAM A;  4HFH A;  5CO5 A;  2BJ0 A;  3RHW A;  3TLV A;  3U8L A;  5HEG A;  3WTJ A;  1UX2 A;  3WTK A;  5IUX A;  3SIO A;  3U8J A;  4AFH A;  5BRX A;  5LXB A;  3TLT A;  2BG9 A;  4UY2 A;  5AFK A;  4AFG A;  3JAE A;  2XQ9 A;  2C9T A;  2QC1 B;  4QAC A;  3SQ6 A;  5AFN A;  3C84 A;  2XYS A;  4ZZB A;  2ZJV A;  3RIA A;  4ZZC A;  2ZJU A;  2YN6 A;  2BYS A;  4HQP A;  4X5T A;  4LMK A;  3ZKR A;  5AIN A;  4TNW A;  2WNL A;  4QAB A;  2YOE A;  5AFM A;  2XZ6 A;  2X00 A;  5J5H A;  2BR8 A;  5AFL A;  3EI0 A;  4UXU A;  2Y7Y A;  4XHE A;  5HCJ A;  3UQ4 A;  4EZ1 A;  3WTN A;  5CFB A;  5HEO A;  3JAF A;  3UU4 A;  5HEJ A;  2Y57 A;  5J5G A;  4Z91 A;  5HCM A;  3WTO A;  4TWD A;  4FRR A;  4QAA A;  4TWH A;  5L4H A;  3RIF A;  3P4W A;  4HFE A;  3PEO A;  5HEH A;  2BYP A;  2BYQ A;  3WTH A;  4ILA A;  4UM3 A;  3SQ9 A;  4UM3 S;  5SYO A;  2XNV A;  2XQ8 A;  1I9B A;  4D01 A;  4ILB A;  5AFH A;  3WTL A;  2XQ7 A;  4ZRU A;  2XQ3 A;  2Y54 A;  4PIR A;  5KZU A;  5J5I A;  2BG9 E;  3WIP A;  4B5D A;  4QH4 A;  2XZ5 A;  4COF A;  4TWF A;  3UU6 A;  5L47 A;  2X00 D;  4A97 A;  1UV6 A;  2BG9 C;  4IRE A;  4XK9 A;  2W8F A;  3P50 A;  3TLS A;  5FJV A;  3SH1 A;  4ALX A;  4A98 A;  4ILC A;  3U8M A;  3C79 A;  4ZK1 A;  5AFJ A;  5L4E A;  3UU3 A;  4QH1 A;  4UM1 A;  2XQA A;  4IL4 A;  3TLU A;  2BYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...